1% 2% This file is formatted by: 3% bibtool petsc.bib -- expand.macros=on -- print.line.length=100 -- pass.comments=on 4% 5% If the reference uses PETSc, include a field listing components used, e.g. 6% petsc_uses = {KSP, SNES, TS, TAO}, 7% 8% For journal names, write out the full name, do not define abbreviations 9% 10% There are some additional historical comments below which may be of interest, 11% particularly in terms of notes about particularly impactful publications using PETSc. 12% 13 14% LiteralHTML: 15% LiteralHTML: <H2><center>Research and Publications that make use of PETSc</center></H2> 16% LiteralHTML: 17% LiteralHTML: <a name="nano"><H3><center>Nano-simulations</center></H3> 18% LiteralHTML: 19@Misc{ semver-webpage, 20 author = {{Semantic Versioning 2.0.0}}, 21 note = {\url{https://semver.org}} 22} 23 24@article{veldhuizen1984d, 25 title = {{D}-stability and {K}aps-{R}entrop-methods}, 26 author = {Veldhuizen, M van}, 27 journal = {Computing}, 28 volume = {32}, 29 number = {3}, 30 pages = {229--237}, 31 year = {1984}, 32 publisher = {Springer} 33} 34 35@article{shampine1982implementation, 36 title = {Implementation of {R}osenbrock methods}, 37 author = {Shampine, Lawrence F}, 38 journal = {ACM Transactions on Mathematical Software (TOMS)}, 39 volume = {8}, 40 number = {2}, 41 pages = {93--113}, 42 year = {1982}, 43 publisher = {ACM New York, NY, USA} 44} 45 46@book{wanner1996solving, 47 title = {Solving ordinary differential equations {II}}, 48 author = {Wanner, Gerhard and Hairer, Ernst}, 49 volume = {375}, 50 year = {1996}, 51 publisher = {Springer Berlin Heidelberg New York} 52} 53 54@article{kaps1979generalized, 55 title = {Generalized {R}unge--{K}utta methods of order four with stepsize control for stiff ordinary differential equations}, 56 author = {Kaps, Peter and Rentrop, Peter}, 57 journal = {Numerische Mathematik}, 58 volume = {33}, 59 pages = {55--68}, 60 year = {1979}, 61 publisher = {Springer} 62} 63 64@book{butcher2016numerical, 65 title = {Numerical methods for ordinary differential equations}, 66 author = {Butcher, John Charles}, 67 year = {2016}, 68 publisher = {John Wiley \& Sons} 69} 70 71@article{chung1993, 72 author = {Chung, J. and Hulbert, G. M.}, 73 title = {A Time Integration Algorithm for Structural Dynamics With Improved Numerical Dissipation: The Generalized-alpha Method}, 74 journal = {Journal of Applied Mechanics}, 75 volume = {60}, 76 number = {2}, 77 pages = {371-375}, 78 year = {1993}, 79 month = {06}, 80 issn = {0021-8936}, 81 doi = {10.1115/1.2900803}, 82 url = {https://doi.org/10.1115/1.2900803}, 83 eprint = {https://asmedigitalcollection.asme.org/appliedmechanics/article-pdf/60/2/371/5463014/371\_1.pdf}, 84} 85 86@article{hosea1996analysis, 87 title = {Analysis and implementation of {TR-BDF2}}, 88 author = {Hosea, ME and Shampine, LF}, 89 journal = {Applied Numerical Mathematics}, 90 volume = {20}, 91 number = {1-2}, 92 pages = {21--37}, 93 year = {1996}, 94 publisher = {Elsevier} 95} 96 97@article{kennedy2019diagonally, 98 title = {Diagonally implicit {R}unge--{K}utta methods for stiff {ODE}s}, 99 author = {Kennedy, Christopher A and Carpenter, Mark H}, 100 journal = {Applied Numerical Mathematics}, 101 volume = {146}, 102 pages = {221--244}, 103 year = {2019}, 104 publisher = {Elsevier} 105} 106 107@inproceedings{xu2017adaptive, 108 title = {Adaptive relaxed {ADMM}: Convergence theory and practical implementation}, 109 author = {Xu, Zheng and Figueiredo, Mario AT and Yuan, Xiaoming and Studer, Christoph and Goldstein, Tom}, 110 booktitle = {Proceedings of the IEEE conference on computer vision and pattern recognition}, 111 pages = {7389--7398}, 112 year = {2017} 113} 114 115@article{hindmarsh1996time, 116 title = {Time-step limits for stable solutions of the ice-sheet equation}, 117 author = {Hindmarsh, Richard CA and Payne, Antony J}, 118 journal = {Annals of Glaciology}, 119 volume = {23}, 120 pages = {74--85}, 121 year = {1996}, 122 publisher = {Cambridge University Press} 123} 124 125@article{benson2006flexible, 126 title = {Flexible complementarity solvers for large-scale applications}, 127 author = {Benson, Steven J and Munson, Todd S}, 128 journal = {Optimization Methods and Software}, 129 volume = {21}, 130 number = {1}, 131 pages = {155--168}, 132 year = {2006}, 133 publisher ={Taylor \& Francis} 134} 135 136@article{byrd1994representations, 137 title = {Representations of quasi-{N}ewton matrices and their use in limited memory methods}, 138 author = {Byrd, Richard H and Nocedal, Jorge and Schnabel, Robert B}, 139 journal = {Mathematical Programming}, 140 volume = {63}, 141 number = {1-3}, 142 pages = {129--156}, 143 year = {1994}, 144 publisher = {Springer} 145} 146 147@article{gilbert1989some, 148 title = {Some numerical experiments with variable-storage quasi-{N}ewton algorithms}, 149 author = {Gilbert, Jean Charles and Lemar{\'e}chal, Claude}, 150 journal = {Mathematical programming}, 151 volume = {45}, 152 number = {1-3}, 153 pages = {407--435}, 154 year = {1989}, 155 publisher = {Springer} 156} 157 158@inproceedings{dener2019accelerating, 159 title = {Accelerating limited-memory quasi-{N}ewton convergence for large-scale optimization}, 160 author = {Dener, Alp and Munson, Todd}, 161 booktitle = {Computational Science--ICCS 2019: 19th International Conference, Faro, Portugal, June 12--14, 2019, Proceedings, Part III 19}, 162 pages = {495--507}, 163 year = {2019}, 164 organization = {Springer} 165} 166 167@article{park2021linear, 168 title = {Linear and nonlinear solvers for simulating multiphase flow within large-scale engineered subsurface systems}, 169 author = {Park, Heeho D and Hammond, Glenn E and Valocchi, Albert J and LaForce, Tara}, 170 journal = {Advances in Water Resources}, 171 volume = {156}, 172 pages = {104029}, 173 year = {2021}, 174 publisher = {Elsevier} 175} 176 177@inproceedings{va1981design, 178 title = {Design of optimally smoothing multi-stage schemes for the {E}uler equations}, 179 author = {Van Leer, Bram and Tai, Chang-Hsien and Powell, Kenneth}, 180 booktitle = {9th Computational Fluid Dynamics Conference}, 181 pages = {1933}, 182 year = {1981} 183} 184 185@article{pierce1997preconditioned, 186 title = {Preconditioned multigrid methods for compressible flow calculations on stretched meshes}, 187 author = {Pierce, Niles A and Giles, Michael B}, 188 journal = {Journal of Computational Physics}, 189 volume = {136}, 190 number = {2}, 191 pages = {425--445}, 192 year = {1997}, 193 publisher = {Elsevier} 194} 195 196@article{kong2016highly, 197 title = {A highly scalable multilevel {S}chwarz method with boundary geometry preserving coarse spaces for {3D} elasticity problems on domains with complex geometry}, 198 author = {Kong, Fande and Cai, Xiao-Chuan}, 199 journal = {SIAM Journal on Scientific Computing}, 200 volume = {38}, 201 number = {2}, 202 pages = {C73--C95}, 203 year = {2016}, 204 publisher = {SIAM} 205} 206 207@inproceedings{gutierrez2017accommodating, 208 title = {Accommodating thread-level heterogeneity in coupled parallel applications}, 209 author = {Guti{\'e}rrez, Samuel K and Davis, Kei and Arnold, Dorian C and Baker, Randal S and Robey, Robert W and McCormick, Patrick and 210 Holladay, Daniel and Dahl, Jon A and Zerr, R Joe and Weik, Florian and others}, 211 booktitle = {2017 {IEEE} International Parallel and Distributed Processing Symposium ({IPDPS})}, 212 pages = {469--478}, 213 year = {2017}, 214 organization = {IEEE} 215} 216 217@article{heroux2011bi, 218 title = {Bi-modal MPI and MPI+ threads computing on scalable multicore systems}, 219 author = {Heroux, Michael A and Brightwell, R and Wolf, Michael M}, 220 journal = {IJHPCA (Submitted)}, 221 year = {2011} 222} 223 224@inproceedings{bozdaug2005parallel, 225 title = {A parallel distance-2 graph coloring algorithm for distributed memory computers}, 226 author = {Bozda{\u{g}}, Doruk and Catalyurek, Umit and Gebremedhin, Assefaw H and Manne, Fredrik and Boman, Erik G and {\"O}zg{\"u}ner, F{\"u}sun}, 227 booktitle = {International conference on high performance computing and communications}, 228 pages = {796--806}, 229 year = {2005}, 230 organization = {Springer} 231} 232 233@article{dohrmann2009overlapping, 234 title = {An overlapping {S}chwarz algorithm for almost incompressible elasticity}, 235 author = {Dohrmann, Clark R and Widlund, Olof B}, 236 journal = {SIAM journal on numerical analysis}, 237 volume = {47}, 238 number = {4}, 239 pages = {2897--2923}, 240 year = {2009}, 241 publisher = {SIAM} 242} 243 244@article{dohrmann2008domain, 245 title = {Domain decomposition for less regular subdomains: Overlapping {S}chwarz in two dimensions}, 246 author = {Dohrmann, Clark R and Klawonn, Axel and Widlund, Olof B}, 247 journal = {SIAM journal on numerical analysis}, 248 volume = {46}, 249 number = {4}, 250 pages = {2153--2168}, 251 year = {2008}, 252 publisher = {SIAM} 253} 254 255@incollection{dohrmann2008family, 256 title = {A family of energy minimizing coarse spaces for overlapping {S}chwarz preconditioners}, 257 author = {Dohrmann, Clark R and Klawonn, Axel and Widlund, Olof B}, 258 booktitle = {Domain decomposition methods in science and engineering XVII}, 259 pages = {247--254}, 260 year = {2008}, 261 publisher = {Springer} 262} 263 264@book{dohrmann2008extending, 265 title = {Extending theory for domain decomposition algorithms to irregular subdomains}, 266 author = {Dohrmann, Clark R and Klawonn, Axel and Widlund, Olof B}, 267 year = {2008}, 268 publisher = {Springer} 269} 270 271@article{dryja1994schwarz, 272 title = {{S}chwarz analysis of iterative substructuring algorithms for elliptic problems in three dimensions}, 273 author = {Dryja, Maksymilian and Smith, Barry F and Widlund, Olof B}, 274 journal = {SIAM journal on numerical analysis}, 275 volume = {31}, 276 number = {6}, 277 pages = {1662--1694}, 278 year = {1994}, 279 publisher = {SIAM} 280} 281 282@book{smith1990domain, 283 title = {Domain decomposition algorithms for the partial differential equations of linear elasticity}, 284 author = {Smith, Barry F}, 285 year = {1990}, 286 publisher = {New York University} 287} 288 289@article{bramble1989construction, 290 title = {The construction of preconditioners for elliptic problems by substructuring. {IV}}, 291 author = {Bramble, James H and Pasciak, Joseph E and Schatz, Alfred H}, 292 journal = {Mathematics of Computation}, 293 volume = {53}, 294 number = {187}, 295 pages = {1--24}, 296 year = {1989} 297} 298 299@article{kaczmarz1937angenaherte, 300 title = {Angenaherte auflosung von systemen linearer gleichungen}, 301 author = {Kaczmarz, Stefan}, 302 journal = {Bull. Int. Acad. Pol. Sic. Let., Cl. Sci. Math. Nat.}, 303 pages = {355--357}, 304 year = {1937} 305} 306 307@article{nataf2022recent, 308 title = {Recent advances in domain decomposition methods for large-scale saddle point problems}, 309 author = {Nataf, Fr{\'e}d{\'e}ric and Tournier, Pierre-Henri}, 310 journal = {Comptes Rendus. M{\'e}canique}, 311 volume = {350}, 312 number = {S1}, 313 pages = {1--15}, 314 year = {2022} 315} 316 317@article{al2022robustpd, 318 title = {A robust algebraic multilevel domain decomposition preconditioner for sparse symmetric positive definite matrices}, 319 author = {Al Daas, Hussam and Jolivet, Pierre}, 320 journal = {SIAM Journal on Scientific Computing}, 321 volume = {44}, 322 number = {4}, 323 pages = {A2582--A2598}, 324 year = {2022}, 325 publisher = {SIAM} 326} 327 328@article{al2022robust, 329 title = {A robust algebraic domain decomposition preconditioner for sparse normal equations}, 330 author = {Al Daas, Hussam and Jolivet, Pierre and Scott, Jennifer A}, 331 journal = {SIAM Journal on Scientific Computing}, 332 volume = {44}, 333 number = {3}, 334 pages = {A1047--A1068}, 335 year = {2022}, 336 publisher = {SIAM} 337} 338 339@article{al2021multilevel, 340 title = {A multilevel {S}chwarz preconditioner based on a hierarchy of robust coarse spaces}, 341 author = {Al Daas, Hussam and Grigori, Laura and Jolivet, Pierre and Tournier, Pierre-Henri}, 342 journal = {SIAM Journal on Scientific Computing}, 343 volume = {43}, 344 number = {3}, 345 pages = {A1907--A1928}, 346 year = {2021}, 347 publisher = {SIAM} 348} 349 350@book{dolean2015introduction, 351 title = {An introduction to domain decomposition methods: algorithms, theory, and parallel implementation}, 352 author = {Dolean, Victorita and Jolivet, Pierre and Nataf, Fr{\'e}d{\'e}ric}, 353 year = {2015}, 354 publisher = {SIAM} 355} 356 357@article{spillane2011robust, 358 title = {A robust two-level domain decomposition preconditioner for systems of {PDE}s}, 359 author = {Spillane, Nicole and Dolean, Victorita and Hauret, Patrice and Nataf, Fr{\'e}d{\'e}ric and Pechstein, Clemens and Scheichl, Robert}, 360 journal = {Comptes Rendus Mathematique}, 361 volume = {349}, 362 number = {23-24}, 363 pages = {1255--1259}, 364 year = {2011}, 365 publisher = {Elsevier} 366} 367 368@article{kong2020highly, 369 title = {A Highly Parallel Multilevel {N}ewton--{K}rylov--{S}chwarz Method with Subspace-Based Coarsening and 370 Partition-Based Balancing for the Multigroup Neutron Transport Equation on Three-Dimensional Unstructured Meshes}, 371 author = {Kong, Fande and Wang, Yaqi and Gaston, Derek R and Permann, Cody J and Slaughter, Andrew E and Lindsay, 372 Alexander D and DeHart, Mark D and Martineau, Richard C}, 373 journal = {SIAM Journal on Scientific Computing}, 374 volume = {42}, 375 number = {5}, 376 pages = {C193--C220}, 377 year = {2020}, 378 publisher = {SIAM} 379} 380 381@article{ipsen2001note, 382 title = {A note on preconditioning nonsymmetric matrices}, 383 author = {Ipsen, Ilse CF}, 384 journal = {SIAM Journal on Scientific Computing}, 385 volume = {23}, 386 number = {3}, 387 pages = {1050--1051}, 388 year = {2001}, 389 publisher = {SIAM} 390} 391 392@article{murphy2000note, 393 title = {A note on preconditioning for indefinite linear systems}, 394 author = {Murphy, Malcolm F and Golub, Gene H and Wathen, Andrew J}, 395 journal = {SIAM Journal on Scientific Computing}, 396 volume = {21}, 397 number = {6}, 398 pages = {1969--1972}, 399 year = {2000}, 400 publisher = {SIAM} 401} 402 403@article{oliphant1961implicit, 404 title = {An implicit, numerical method for solving two-dimensional time-dependent diffusion problems}, 405 author = {Oliphant, Thomas A}, 406 journal = {Quarterly of Applied mathematics}, 407 volume = {19}, 408 number = {3}, 409 pages = {221--229}, 410 year = {1961} 411} 412 413@article{dupont1968approximate, 414 title = {An approximate factorization procedure for solving self-adjoint elliptic difference equations}, 415 author = {Dupont, Todd and Kendall, Richard P and Rachford, Jr, HH}, 416 journal = {SIAM Journal on Numerical Analysis}, 417 volume = {5}, 418 number = {3}, 419 pages = {559--573}, 420 year = {1968}, 421 publisher = {SIAM} 422} 423 424@inproceedings{manteuffel1979shifted, 425 title = {Shifted incomplete {C}holesky factorization}, 426 author = {Manteuffel, Thomas A}, 427 booktitle = {Sparse Matrix Proceedings 1978}, 428 pages = {41--61}, 429 year = {1979}, 430 organization = {SIAM, Philadelphia, PA} 431} 432 433@incollection{chan1997approximate, 434 title = {Approximate and incomplete factorizations}, 435 author = {Chan, Tony F and Van Der Vorst, Henk A}, 436 booktitle = {Parallel numerical algorithms}, 437 pages = {167--202}, 438 year = {1997}, 439 publisher = {Springer} 440} 441 442@article{mandel2008multispace, 443 title = {Multispace and multilevel {BDDC}}, 444 author = {Mandel, Jan and Soused{\'\i}k, Bed{\v{r}}ich and Dohrmann, Clark R}, 445 journal = {Computing}, 446 volume = {83}, 447 number = {2-3}, 448 pages = {55--85}, 449 year = {2008}, 450 publisher = {Springer} 451} 452 453@article{klawonn2006dual, 454 title = {Dual-primal {FETI} methods for linear elasticity}, 455 author = {Klawonn, Axel and Widlund, Olof B}, 456 journal = {Communications on Pure and Applied Mathematics: A Journal Issued by the Courant Institute of Mathematical Sciences}, 457 volume = {59}, 458 number = {11}, 459 pages = {1523--1572}, 460 year = {2006}, 461 publisher = {Wiley Online Library} 462} 463 464@article{dohrmann2007approximate, 465 title = {An approximate {BDDC} preconditioner}, 466 author = {Dohrmann, Clark R}, 467 journal = {Numerical Linear Algebra with Applications}, 468 volume = {14}, 469 number = {2}, 470 pages = {149--168}, 471 year = {2007}, 472 publisher = {Wiley Online Library} 473} 474 475@book{dryja1987additive, 476 title = {An additive variant of the {S}chwarz alternating method for the case of many subregions}, 477 author = {Dryja, Maksymilian and Widlund, Olof}, 478 year = {1987}, 479 publisher = {Ultracomputer Research Laboratory, Univ., Courant Inst. of Mathematical~…} 480} 481 482@article{couturier2016tsirm, 483 title = {{TSIRM}: A two-stage iteration with least-squares residual minimization algorithm to solve large sparse linear and nonlinear systems}, 484 author = {Couturier, Rapha{\"e}l and Khodja, Lilia Ziane and Guyeux, Christophe}, 485 journal = {Journal of Computational Science}, 486 volume = {17}, 487 pages = {535--546}, 488 year = {2016}, 489 publisher = {Elsevier} 490} 491 492@article{chan1998transpose, 493 title = {Transpose-free formulations of Lanczos-type methods for nonsymmetric linear systems}, 494 author = {Chan, Tony F and De Pillis, Lisette and Van Der Vorst, Henk}, 495 journal = {Numerical Algorithms}, 496 volume = {17}, 497 pages = {51--66}, 498 year = {1998}, 499 publisher = {Springer} 500} 501 502@article{catabriga2006performance, 503 title = {Performance of {LCD} iterative method in the finite element and finite difference solution of convection--diffusion equations}, 504 author = {Catabriga, L and Valli, AMP and Melotti, BZ and Pessoa, LM and Coutinho, ALGA}, 505 journal = {Communications in numerical methods in engineering}, 506 volume = {22}, 507 number = {6}, 508 pages = {643--656}, 509 year = {2006}, 510 publisher = {Wiley Online Library} 511} 512 513@article{catabriga2004evaluating, 514 title = {Evaluating the {LCD} algorithm for solving linear systems of equations arising from implicit {SUPG} formulation of compressible flows}, 515 author = {Catabriga, Lucia and Coutinho, Alvaro LGA and Franca, Leopoldo P}, 516 journal = {International Journal for Numerical Methods in Engineering}, 517 volume = {60}, 518 number = {9}, 519 pages = {1513--1534}, 520 year = {2004}, 521 publisher = {Wiley Online Library} 522} 523 524@article{dai2004study, 525 title = {Study on semi-conjugate direction methods for non-symmetric systems}, 526 author = {Dai, Yu-Hong and Yuan, Jinyun}, 527 journal = {International journal for numerical methods in engineering}, 528 volume = {60}, 529 number = {8}, 530 pages = {1383--1399}, 531 year = {2004}, 532 publisher = {Wiley Online Library} 533} 534 535@article{yuan2004semi, 536 title = {Semi-conjugate direction methods for real positive definite systems}, 537 author = {Yuan, JY and Golub, Gene H and Plemmons, Robert J and Cecilio, WAG}, 538 journal = {BIT Numerical Mathematics}, 539 volume = {44}, 540 pages = {189--207}, 541 year = {2004}, 542 publisher = {Springer} 543} 544 545@article{ji2017breakdown, 546 title = {A breakdown-free block conjugate gradient method}, 547 author = {Ji, Hao and Li, Yaohang}, 548 journal = {BIT Numerical Mathematics}, 549 volume = {57}, 550 pages = {379--403}, 551 year = {2017}, 552 publisher = {Springer} 553} 554 555@inproceedings{jolivet2016block, 556 title = {Block iterative methods and recycling for improved scalability of linear solvers}, 557 author = {Jolivet, Pierre and Tournier, Pierre-Henri}, 558 booktitle = {SC'16: Proceedings of the International Conference for High Performance Computing, Networking, Storage and Analysis}, 559 pages = {190--203}, 560 year = {2016}, 561 organization = {IEEE} 562} 563 564@article{calandra2013modified, 565 title = {A modified block flexible {GMRES} method with deflation at each iteration for the solution of non-{H}ermitian linear systems with multiple right-hand sides}, 566 author = {Calandra, Henri and Gratton, Serge and Lago, Rafael and Vasseur, Xavier and Carvalho, Luiz Mariano}, 567 journal = {SIAM Journal on Scientific Computing}, 568 volume = {35}, 569 number = {5}, 570 pages = {S345--S367}, 571 year = {2013}, 572 publisher = {SIAM} 573} 574 575@article{o1980block, 576 title = {The block conjugate gradient algorithm and related methods}, 577 author = {O'Leary, Dianne P}, 578 journal = {Linear algebra and its applications}, 579 volume = {29}, 580 pages = {293--322}, 581 year = {1980}, 582 publisher = {Elsevier} 583} 584 585@article{erhel1996restarted, 586 title = {Restarted {GMRES} preconditioned by deflation}, 587 author = {Erhel, Jocelyne and Burrage, Kevin and Pohl, Bert}, 588 journal = {Journal of computational and applied mathematics}, 589 volume = {69}, 590 number = {2}, 591 pages = {303--318}, 592 year = {1996}, 593 publisher = {Elsevier} 594} 595 596@article{bai1994newton, 597 title = {A {N}ewton basis {GMRES} implementation}, 598 author = {Bai, Zhaojun and Hu, Dan and Reichel, Lothar}, 599 journal = {IMA Journal of Numerical Analysis}, 600 volume = {14}, 601 number = {4}, 602 pages = {563--581}, 603 year = {1994}, 604 publisher = {Oxford University Press} 605} 606 607@article{sidje1997alternatives, 608 title = {Alternatives for parallel Krylov subspace basis computation}, 609 author = {Sidje, Roger B}, 610 journal = {Numerical linear algebra with applications}, 611 volume = {4}, 612 number = {4}, 613 pages = {305--331}, 614 year = {1997}, 615 publisher = {Wiley Online Library} 616} 617 618@inproceedings{mohiyuddin2009minimizing, 619 title = {Minimizing communication in sparse matrix solvers}, 620 author = {Mohiyuddin, Marghoob and Hoemmen, Mark and Demmel, James and Yelick, Katherine}, 621 booktitle = {Proceedings of the Conference on High Performance Computing Networking, Storage and Analysis}, 622 pages = {1--12}, 623 year = {2009} 624} 625 626@article{demmel2012communication, 627 title = {Communication-optimal parallel and sequential {QR} and {LU} factorizations}, 628 author = {Demmel, James and Grigori, Laura and Hoemmen, Mark and Langou, Julien}, 629 journal = {SIAM Journal on Scientific Computing}, 630 volume = {34}, 631 number = {1}, 632 pages = {A206--A239}, 633 year = {2012}, 634 publisher = {SIAM} 635} 636 637@article{philippe2012generation, 638 title = {On the generation of {K}rylov subspace bases}, 639 author = {Philippe, Bernard and Reichel, Lothar}, 640 journal = {Applied Numerical Mathematics}, 641 volume = {62}, 642 number = {9}, 643 pages = {1171--1186}, 644 year = {2012}, 645 publisher = {Elsevier} 646} 647 648@article{wakam2013memory, 649 title = {Memory efficient hybrid algebraic solvers for linear systems arising from compressible flows}, 650 author = {Wakam, D{\'e}sir{\'e} Nuentsa and Pacull, Fran{\c{c}}ois}, 651 journal = {Computers \& Fluids}, 652 volume = {80}, 653 pages = {158--167}, 654 year = {2013}, 655 publisher = {Elsevier} 656} 657 658@misc{wakam2011parallelism, 659 title = {Parallelism and robustness in {GMRES} with the {N}ewton basis and the deflated restarting}, 660 author = {Wakam, D{\'e}sir{\'e} Nuentsa and Erhel, Jocelyne}, 661 year = {2011}, 662 url = {https://hal.inria.fr/inria-00638247/en} 663} 664 665@article{tu2015feti, 666 title = {A {FETI-DP} type domain decomposition algorithm for three-dimensional incompressible {S}tokes equations}, 667 author = {Tu, Xuemin and Li, Jing}, 668 journal = {SIAM Journal on Numerical Analysis}, 669 volume = {53}, 670 number = {2}, 671 pages = {720--742}, 672 year = {2015}, 673 publisher = {SIAM} 674} 675 676@article{farhat2001feti, 677 title = {{FETI-DP}: a dual--primal unified {FETI} method—part {I}: A faster alternative to the two-level {FETI} method}, 678 author = {Farhat, Charbel and Lesoinne, Michel and LeTallec, Patrick and Pierson, Kendall and Rixen, Daniel}, 679 journal = {International journal for numerical methods in engineering}, 680 volume = {50}, 681 number = {7}, 682 pages = {1523--1544}, 683 year = {2001}, 684 publisher = {Wiley Online Library} 685} 686 687@article{lottes2023optimal, 688 title = {Optimal polynomial smoothers for multigrid {V}-cycles}, 689 author = {Lottes, James}, 690 journal = {Numerical Linear Algebra with Applications}, 691 volume = {30}, 692 number = {6}, 693 pages = {e2518}, 694 year = {2023}, 695 publisher = {Wiley Online Library} 696} 697 698@article{phillips2022optimal, 699 title = {Optimal {C}hebyshev Smoothers and One-sided {V}-cycles}, 700 author = {Phillips, Malachi and Fischer, Paul}, 701 journal = {arXiv preprint arXiv:2210.03179}, 702 year = {2022} 703} 704 705@incollection{toint1981towards, 706 title = {Towards an efficient sparsity exploiting {N}ewton method for minimization}, 707 author = {Toint, Philippe}, 708 booktitle = {Sparse matrices and their uses}, 709 pages = {57--88}, 710 year = {1981}, 711 publisher = {Academic press} 712} 713 714@article{cools2019numerically, 715 title = {Numerically stable recurrence relations for the communication hiding pipelined conjugate gradient method}, 716 author = {Cools, Siegfried and Cornelis, Jeffrey and Vanroose, Wim}, 717 journal = {IEEE Transactions on Parallel and Distributed Systems}, 718 volume = {30}, 719 number = {11}, 720 pages = {2507--2522}, 721 year = {2019}, 722 publisher = {IEEE} 723} 724 725@article{cornelis2018communication, 726 title = {The communication-hiding conjugate gradient method with deep pipelines}, 727 author = {Cornelis, Jeffrey and Cools, Siegfried and Vanroose, Wim}, 728 journal = {arXiv preprint arXiv:1801.04728}, 729 year = {2018} 730} 731 732@article{d1993conjugate, 733 title = {Conjugate gradient algorithms with reduced synchronization overhead on distributed memory multiprocessors}, 734 author = {D’Azevedo, EF and Eijkhout, VL and Romine, CH}, 735 journal = {Computer Science Technical Report CS-93-185, University of Tennessee, Knoxville}, 736 year = {1993} 737} 738 739@book{malek2014preconditioning, 740 title = {Preconditioning and the conjugate gradient method in the context of solving {PDEs}}, 741 author = {M{\'a}lek, Josef and Strako{\v{s}}, Zden{\v{e}}k}, 742 year = {2014}, 743 publisher = {SIAM} 744} 745 746@book{fokkema1996enhanced, 747 title = {Enhanced implementation of {BiCGstab}(l) for solving linear systems of equations}, 748 author = {Fokkema, Diederik R}, 749 year = {1996}, 750 publisher = {Citeseer} 751} 752 753@article{sleijpen1994bicgstab, 754 title = {{BiCGstab}(l) and other hybrid {Bi-CG} methods}, 755 author = {Sleijpen, Gerard LG and Van der Vorst, Henk A and Fokkema, Diederik R}, 756 journal = {Numerical Algorithms}, 757 volume = {7}, 758 pages = {75--109}, 759 year = {1994}, 760 publisher = {Springer} 761} 762 763@article{sleijpen1995overview, 764 title = {An overview of approaches for the stable computation of hybrid {BiCG} methods}, 765 author = {Sleijpen, Gerard LG and Van der Vorst, Henk A}, 766 journal = {Applied numerical mathematics}, 767 volume = {19}, 768 number = {3}, 769 pages = {235--254}, 770 year = {1995}, 771 publisher = {Elsevier} 772} 773 774@article{fischer1998projection, 775 title = {Projection techniques for iterative solution of Ax= b with successive right-hand sides}, 776 author = {Fischer, Paul F}, 777 journal = {Computer methods in applied mechanics and engineering}, 778 volume = {163}, 779 number = {1-4}, 780 pages = {193--204}, 781 year = {1998}, 782 publisher = {Elsevier} 783} 784 785@article{maskery2018insights, 786 title = {Insights into the mechanical properties of several triply periodic minimal surface lattice structures 787 made by polymer additive manufacturing}, 788 author = {Maskery, Ian and Sturm, Logan and Aremu, Adedeji O and Panesar, Ajit and Williams, 789 Christopher B and Tuck, Christopher J and Wildman, Ricky D and Ashcroft, Ian A and Hague, Richard JM}, 790 journal = {Polymer}, 791 volume = {152}, 792 pages = {62--71}, 793 year = {2018}, 794 publisher = {Elsevier} 795} 796 797@book{karniadakis2005spectral, 798 title = {Spectral/hp element methods for computational fluid dynamics}, 799 author = {Karniadakis, George and Sherwin, Spencer J}, 800 year = {2005}, 801 publisher = {Oxford University Press, USA} 802} 803 804@article{golub1969calculation, 805 title = {Calculation of {G}auss quadrature rules}, 806 author = {Golub, Gene H and Welsch, John H}, 807 journal = {Mathematics of computation}, 808 volume = {23}, 809 number = {106}, 810 pages = {221--230}, 811 year = {1969} 812} 813 814@article{soderlind2006adaptive, 815 title = {Adaptive time-stepping and computational stability}, 816 author = {S{\"o}derlind, Gustaf and Wang, Lina}, 817 journal = {Journal of Computational and Applied Mathematics}, 818 volume = {185}, 819 number = {2}, 820 pages = {225--243}, 821 year = {2006}, 822 publisher = {Elsevier} 823} 824 825@article{soderlind2003digital, 826 title = {Digital filters in adaptive time-stepping}, 827 author = {S{\"o}derlind, Gustaf}, 828 journal = {{ACM} Transactions on Mathematical Software ({TOMS})}, 829 volume = {29}, 830 number = {1}, 831 pages = {1--26}, 832 year = {2003}, 833 publisher = {ACM New York, NY, USA} 834} 835 836@article{volkwein2013proper, 837 title = {Proper orthogonal decomposition: Theory and reduced-order modelling}, 838 author = {Volkwein, Stefan}, 839 journal = {Lecture Notes, University of Konstanz}, 840 volume = {4}, 841 number = {4}, 842 pages = {1--29}, 843 year = {2013}, 844 url = {http://www.math.uni-konstanz.de/numerik/personen/volkwein/teaching/POD-Book.pdf} 845} 846 847@article{frisvad2012building, 848 title = {Building an orthonormal basis from a {3D} unit vector without normalization}, 849 author = {Frisvad, Jeppe Revall}, 850 journal = {Journal of Graphics Tools}, 851 volume = {16}, 852 number = {3}, 853 pages = {151--159}, 854 year = {2012}, 855 publisher = {Taylor \& Francis} 856} 857 858@article{constantinescu2007multirate, 859 title = {Multirate timestepping methods for hyperbolic conservation laws}, 860 author = {Constantinescu, Emil M and Sandu, Adrian}, 861 journal = {Journal of Scientific Computing}, 862 volume = {33}, 863 number = {3}, 864 pages = {239--278}, 865 year = {2007}, 866 publisher = {Springer} 867} 868 869@article{liu2022newton, 870 title = {A {N}ewton-{MR} algorithm with complexity guarantees for nonconvex smooth unconstrained optimization}, 871 author = {Liu, Yang and Roosta, Fred}, 872 journal = {arXiv preprint arXiv:2208.07095}, 873 year = {2022} 874} 875 876@article{choi2011minres, 877 title = {{MINRES-QLP}: A {K}rylov subspace method for indefinite or singular symmetric systems}, 878 author = {Choi, Sou-Cheng T and Paige, Christopher C and Saunders, Michael A}, 879 journal = {SIAM Journal on Scientific Computing}, 880 volume = {33}, 881 number = {4}, 882 pages = {1810--1836}, 883 year = {2011}, 884 publisher = {SIAM} 885} 886 887@article{chen2020predict, 888 title = {Predict-and-recompute conjugate gradient variants}, 889 author = {Chen, Tyler and Carson, Erin}, 890 journal = {SIAM Journal on Scientific Computing}, 891 volume = {42}, 892 number = {5}, 893 pages = {A3084--A3108}, 894 year = {2020}, 895 publisher = {SIAM} 896} 897 898@article{cools2018analyzing, 899 title = {Analyzing the effect of local rounding error propagation on the maximal attainable accuracy of the pipelined conjugate gradient method}, 900 author = {Cools, Siegfried and Yetkin, Emrullah Fatih and Agullo, Emmanuel and Giraud, Luc and Vanroose, Wim}, 901 journal = {SIAM Journal on Matrix Analysis and Applications}, 902 volume = {39}, 903 number = {1}, 904 pages = {426--450}, 905 year = {2018}, 906 publisher = {SIAM} 907} 908 909@inproceedings{tiwari2020pipelined, 910 title = {Pipelined preconditioned conjugate gradient methods for distributed memory systems}, 911 author = {Tiwari, Manasi and Vadhiyar, Sathish}, 912 booktitle = {2020 IEEE 27th International Conference on High Performance Computing, Data, and Analytics (HiPC)}, 913 pages = {151--160}, 914 year = {2020}, 915 organization = {IEEE} 916} 917 918@article{nash1984newton, 919 title = {Newton-type minimization via the {L}anczos method}, 920 author = {Nash, Stephen G}, 921 journal = {SIAM Journal on Numerical Analysis}, 922 volume = {21}, 923 number = {4}, 924 pages = {770--788}, 925 year = {1984}, 926 publisher = {SIAM} 927} 928 929@inproceedings{eller2016scalable, 930 title = {Scalable non-blocking preconditioned conjugate gradient methods}, 931 author = {Eller, Paul R and Gropp, William}, 932 booktitle = {SC'16: Proceedings of the International Conference for High Performance Computing, Networking, Storage and Analysis}, 933 pages = {204--215}, 934 year = {2016}, 935 organization = {IEEE} 936} 937 938@article{gould1999solving, 939 title = {Solving the trust-region subproblem using the Lanczos method}, 940 author = {Gould, Nicholas IM and Lucidi, Stefano and Roma, Massimo and Toint, Philippe L}, 941 journal = {SIAM Journal on Optimization}, 942 volume = {9}, 943 number = {2}, 944 pages = {504--525}, 945 year = {1999}, 946 publisher = {SIAM} 947} 948 949@article{cools2017communication, 950 title = {The communication-hiding pipelined {BiCGstab} method for the parallel solution of large unsymmetric linear systems}, 951 author = {Cools, Siegfried and Vanroose, Wim}, 952 journal = {Parallel Computing}, 953 volume = {65}, 954 pages = {1--20}, 955 year = {2017}, 956 publisher = {Elsevier} 957} 958 959@Misc{moabwebsite, 960 key = {MOAB}, 961 title = {{MOAB} Website}, 962 howpublished = {\url{https://www.mcs.anl.gov/~fathom/moab-docs/html/contents.html}}, 963 year = {2023} 964} 965 966@book{deuflhard2011, 967 title = {{N}ewton Methods for Nonlinear Problems}, 968 author = {Peter Deuflhard}, 969 volume = {35}, 970 year = {2011}, 971 isbn = {978-3-642-23898-7}, 972 doi = {10.1007/978-3-642-23899-4}, 973 publisher = {Springer-Verlag}, 974 address = {Berlin, Heidelberg} 975} 976 977@article{ketcheson2010runge, 978 title = {{R}unge--{K}utta methods with minimum storage implementations}, 979 author = {Ketcheson, David I}, 980 journal = {Journal of Computational Physics}, 981 volume = {229}, 982 number = {5}, 983 pages = {1763--1773}, 984 year = {2010}, 985 publisher = {Elsevier} 986} 987 988@article{WalkerNi2011, 989 title = {{A}nderson acceleration for fixed-point iterations}, 990 author = {Homer F Walker and Peng Ni}, 991 journal = {SIAM Journal on Numerical Analysis}, 992 volume = {49}, 993 number = {4}, 994 pages = {1715--1735}, 995 year = {2011}, 996 publisher = {SIAM} 997} 998 999@article{Hua2007, 1000 title = {Numerical simulation of microdroplet formation in coflowing immiscible liquids}, 1001 author = {Hua, Jinsong and Zhang, Baili and Lou, Jing}, 1002 journal = {AIChE Journal}, 1003 volume = {53}, 1004 number = {10}, 1005 pages = {2534--2548}, 1006 year = {2007}, 1007 publisher = {Wiley Online Library} 1008} 1009 1010@Article{ openblas, 1011 title = {{OpenBLAS}: A High Performance {BLAS} Library on {L}oongson {3A} {CPU}}, 1012 journal = {Journal of Software}, 1013 volume = {22}, 1014 pages = {208--216}, 1015 year = {2011}, 1016 url = {https://www.jos.org.cn/josen/article/abstract/11042}, 1017 author = {ZHANG Xian-Yi and WANG Qian and ZHANG Yun-Quan Richard} 1018} 1019 1020@Misc{ openblas-website, 1021 title = {{OpenBLAS}}, 1022 key = {OpenBLAS}, 1023 howpublished = {\url{https://www.openblas.net}} 1024} 1025 1026@Misc{ openacc-website, 1027 title = {{OpenACC}}, 1028 key = {OpenACC}, 1029 howpublished = {\url{https://www.openacc.org}} 1030} 1031 1032@Misc{ bueler2020petsc, 1033 title = {{PETSc} for Partial Differential Equations: Numerical Solutions in {C} and {P}ython}, 1034 author = {Bueler, Ed}, 1035 year = {2020}, 1036 publisher = {SIAM}, 1037 petsc_uses = {KSP} 1038} 1039 1040@TechReport{ petscforgpuexascale, 1041 title = {Toward Performance-Portable {PETSc} for {GPU}-based Exascale Systems}, 1042 author = {Richard Tran Mills and Mark F. Adams and Satish Balay and Jed Brown and Alp Dener 1043 and Matthew Knepley and Scott E. Kruger and Hannah~Morgan and Todd Munson and Karl 1044 Rupp and Barry F. Smith and Stefano Zampini and Hong Zhang and Junchao Zhang}, 1045 institution = {Argonne National Laboratory}, 1046 number = {ANL/MCS-P9401-1020}, 1047 note = {\url{https://arxiv.org/abs/2011.00715}}, 1048 year = {2020}, 1049 petsc_uses = {KSP} 1050} 1051 1052@Article{ mills2021, 1053 title = {Toward performance-portable {PETS}c for {GPU}-based exascale systems}, 1054 journal = {Parallel Computing}, 1055 volume = {108}, 1056 pages = {102831}, 1057 year = {2021}, 1058 issn = {0167-8191}, 1059 doi = {https://doi.org/10.1016/j.parco.2021.102831}, 1060 url = {https://www.sciencedirect.com/science/article/pii/S016781912100079X}, 1061 author = {Richard Tran Mills and Mark F. Adams and Satish Balay and Jed Brown and Alp Dener 1062 and Matthew Knepley and Scott E. Kruger and Hannah Morgan and Todd Munson and Karl 1063 Rupp and Barry F. Smith and Stefano Zampini and Hong Zhang and Junchao Zhang} 1064} 1065 1066@Article{ mills2024, 1067 title = {{PETSc/TAO} Developments for Early Exascale Systems}, 1068 author = {Richard Tran Mills and Mark F. Adams and Satish Balay and Jed Brown and 1069 Jacob Faibussowitsch and Tobin Isaac and Matthew G. Knepley and Todd Munson and 1070 Hansul Suh and Stefano Zampini and Hong Zhang and Junchao Zhang}, 1071 journal = {International Journal of High Performance Computing Applications}, 1072 url = {http://arxiv.org/abs/2401.05868}, 1073 note = {Submitted}, 1074 year = {2024} 1075} 1076 1077@Article{ rupp:2016:pis:2988256.2907944, 1078 author = {Karl Rupp and Josef Weinbub and Ansgar J\"{u}ngel and Tibor Grasser}, 1079 title = {Pipelined Iterative Solvers with Kernel Fusion for Graphics Processing Units}, 1080 journal = {ACM Trans. Math. Softw.}, 1081 issue_date = {September 2016}, 1082 volume = {43}, 1083 number = {2}, 1084 month = aug, 1085 year = {2016}, 1086 issn = {0098-3500}, 1087 pages = {11:1--11:27}, 1088 articleno = {11}, 1089 numpages = {27}, 1090 doi = {10.1145/2907944}, 1091 acmid = {2907944}, 1092 publisher = {ACM}, 1093 address = {New York, NY, USA}, 1094 keywords = {BiCGStab method, CUDA, GMRES method, GPU, Iterative solvers, OpenCL, conjugate 1095 gradient method}, 1096 petsc_uses = {KSP} 1097} 1098 1099@Article{ dalcin2011parallel, 1100 title = {Parallel distributed computing using python}, 1101 author = {Dalcin, Lisandro D and Paz, Rodrigo R and Kler, Pablo A and Cosimo, Alejandro}, 1102 journal = {Advances in Water Resources}, 1103 volume = {34}, 1104 number = {9}, 1105 pages = {1124--1139}, 1106 year = {2011}, 1107 publisher = {Elsevier}, 1108 petsc_uses = {KSP} 1109} 1110 1111@Article{ mendezpongaortiz2018, 1112 title = {Diffusive molecular dynamics simulations of lithiation of silicon nanopillars}, 1113 author = {JP Mendez and M Ponga and M Ortiz}, 1114 journal = {Journal of the Mechanics and Physics of Solids}, 1115 year = {2018}, 1116 petsc_uses = {KSP} 1117} 1118 1119@TechReport{ morgan2020evaluation, 1120 title = {Evaluation of {PETS}c on a Heterogeneous Architecture, the {OLCF} {S}ummit 1121 System: Part 1: Vector Node Performance}, 1122 author = {Morgan, Hannah Mairs and Mills, Richard Tran and Smith, Barry}, 1123 year = {2020}, 1124 institution = {Argonne National Laboratory}, 1125 url = {https://publications.anl.gov/anlpubs/2020/04/159190.pdf}, 1126 petsc_uses = {KSP} 1127} 1128 1129@TechReport{ pdeconstrainedspectraladjoints, 1130 title = {PDE constrained optimization, error estimation and control with spectral elements 1131 using PETSc and TAO}, 1132 author = {Oana Marin and Emil Constantinescu and Barry Smith}, 1133 type = {Preprint}, 1134 number = {ANL/MCS-P9031-1117}, 1135 institution = {ANL}, 1136 month = nov, 1137 year = {2017}, 1138 petsc_uses = {KSP} 1139} 1140 1141@InProceedings{ asc2013, 1142 author = {S. Abhyankar and B. F. Smith and E. Constantinescu}, 1143 title = {Evaluation of overlapping restricted additive {S}chwarz preconditioning for 1144 parallel solution of very large power flow problems}, 1145 booktitle = {HiPCNA-PG’13}, 1146 year = {2013}, 1147 petsc_uses = {KSP} 1148} 1149 1150@InProceedings{ as2013, 1151 author = {S. Abhyankar and B. F. Smith}, 1152 title = {{PETSc:} An Advanced Math and Computing Framework for Rapidly Developing Parallel 1153 Smart Grid Applications}, 1154 booktitle = {Proceedings of the IEEE PES General Meeting}, 1155 year = {2013}, 1156 petsc_uses = {KSP} 1157} 1158 1159@TechReport{ tspaper, 1160 title = {{PETSc/TS}: A Modern Scalable {DAE/ODE} Solver Library}, 1161 author = {Shrirang Abhyankar and Jed Brown and Emil Constantinescu and Debojyoti Ghosh and 1162 Barry F. Smith}, 1163 type = {Preprint}, 1164 number = {ANL/MCS-P5061-0114}, 1165 institution = {ANL}, 1166 month = jan, 1167 year = {2014}, 1168 petsc_uses = {KSP} 1169} 1170 1171@TechReport{ abhyankaretal2018, 1172 author = {Shrirang Abhyankar and Jed Brown and Emil M. Constantinescu and Debojyoti Ghosh 1173 and Barry F. Smith and Hong Zhang}, 1174 title = {{PETSc/TS}: {A} Modern Scalable {ODE/DAE} Solver Library}, 1175 journal = {arXiv e-preprints}, 1176 eprint = {1806.01437}, 1177 archiveprefix = {arXiv}, 1178 year = {2018}, 1179 petsc_uses = {KSP} 1180} 1181 1182@Article{ zhang2021cams, 1183 title = {Optimal checkpointing for adjoint multistage time-stepping schemes}, 1184 author = {Hong Zhang and Emil M. Constantinescu}, 1185 journal = {arXiv e-preprints}, 1186 eprint = {2202.11890}, 1187 archiveprefix = {arXiv}, 1188 year = {2022}, 1189 petsc_uses = {KSP} 1190} 1191 1192@InProceedings{ zhangconstantinescu2021b, 1193 title = {Revolve-based adjoint checkpointing for multistage time integration}, 1194 author = {Hong Zhang and Emil M. Constantinescu}, 1195 booktitle = {Proceedings of the International Conference on Computational Science (ICCS)}, 1196 month = jun, 1197 year = {2021}, 1198 petsc_uses = {KSP} 1199} 1200 1201@Article{ zhang2022tsadjoint, 1202 author = {Zhang, Hong and Constantinescu, Emil M. and Smith, Barry F.}, 1203 title = {{PETSc TSAdjoint: A Discrete Adjoint ODE Solver for First-Order and Second-Order 1204 Sensitivity Analysis}}, 1205 journal = {SIAM Journal on Scientific Computing}, 1206 volume = {44}, 1207 number = {1}, 1208 pages = {C1-C24}, 1209 year = {2022}, 1210 doi = {10.1137/21M140078X}, 1211 petsc_uses = {KSP} 1212} 1213 1214@TechReport{ bb2008, 1215 author = {Tomasz Blachowicz and Bartlomiej Baron}, 1216 title = {A graphical extension for the Windows version of the Parallel Finite Element 1217 Micromagnetics Package (MagParExt)}, 1218 url = {http://arxiv.org/abs/0807.2655}, 1219 year = {2008}, 1220 petsc_uses = {KSP} 1221} 1222 1223@Article{ jacvgv2008, 1224 author = {R. Y. Jaafar and A Asenjo and O Chubykalo-Fesenko and M Vazquez and E M Gonzalez 1225 and J L Vicent}, 1226 title = {Field induced vortex dynamics in magnetic {Ni} nanotriangles}, 1227 journal = {Nanotechnology}, 1228 volume = {19}, 1229 year = {2008}, 1230 doi = {10.1088/0957-4484/19/28/285717}, 1231 petsc_uses = {KSP} 1232} 1233 1234@Article{ yjdwh2008, 1235 author = {Lin Yuan and Jianjun Jiang and Gang Du and Zhongyou Wang and Huahui He}, 1236 title = {Micromagnetic Simulation of Magnetic Particles with Surface Anisotropy}, 1237 journal = {Journal of the Magnetics Society of Japan}, 1238 volume = {32}, 1239 year = {2008}, 1240 pages = {50-53}, 1241 url = {http://www.jstage.jst.go.jp/article/msjmag/32/2_1/32_50/_article}, 1242 petsc_uses = {KSP} 1243} 1244 1245@Article{ mtrtrsa2008, 1246 author = {D. Makarov and S. Tibus and C. T. Rettner and T. Thomson and B. D. Terris and T. 1247 Schrefl and M. Albrecht}, 1248 title = {Magnetic strip patterns induced by focused ion beam irradiation}, 1249 journal = {J. Appl. Phys.}, 1250 volume = {103}, 1251 year = {2008}, 1252 doi = {10.1063/1.2894587}, 1253 petsc_uses = {KSP} 1254} 1255 1256@InProceedings{ tmrttsa2008, 1257 author = {S. Tibus and D. Makarov and C. T. Rettner and T. Thomson and B. D. Terris and T. 1258 Schrefl and M. Albrecht}, 1259 title = {Patterning of magnetic films by focused ion beam irradiation}, 1260 booktitle = {Intermag 2008 paper no. CM-05, submitted to IEEE Trans. Magn.}, 1261 year = {2008}, 1262 petsc_uses = {KSP} 1263} 1264 1265@Article{ yjdbh2007, 1266 author = {Lin Yuan and Jianju Jiang and Yongjiang di and Shaowei Bie and Huahui He}, 1267 title = {Micromagnetic simulation of the magnetic dispersion angle and effective damping 1268 factor for the single-phase soft magnetic films}, 1269 journal = {J. Magn. Magn. Mater.}, 1270 volume = {320}, 1271 number = {7}, 1272 pages = {1393-1397}, 1273 doi = {10.1016/j.jmmm.2007.11.025}, 1274 petsc_uses = {KSP} 1275} 1276 1277@Article{ lxky2007, 1278 author = {DENG Lian-wen and HUANG Xiao-zhong and ZH0U Ke-sheng and YANG}, 1279 title = {Micromagnetic simulation and experimental study on microwave permeability of 1280 nano-magnetic films}, 1281 journal = {Transactions of Nonferrous Metals Society of China}, 1282 year = {2007}, 1283 pages = {756-759}, 1284 url = {http://www.ysxbcn.com/icnfm2007/part2B/s0756.pdf}, 1285 petsc_uses = {KSP} 1286} 1287 1288@Article{ yjdwh2008a, 1289 author = {Lin Yuan and Jianjun Jiang and Gang Du and Zhongyou Wang and Huahui He}, 1290 title = {Micromagnetic Simulation of Magnetic Particles with Surface Anisotropy}, 1291 journal = {Journal of the Magnetics Society of Japan}, 1292 volume = {32}, 1293 year = {2008}, 1294 pages = {50-53}, 1295 doi = {10.3379/msjmag.32.50}, 1296 petsc_uses = {KSP} 1297} 1298 1299@Article{ lylw2007, 1300 author = {Ching-Ming Lee and L. X. Ye and J. M. Lee and Te-Ho Wu}, 1301 title = {Micromagnetic study of magnetization reversal in patterned {DyFeCo} thin films}, 1302 journal = {Phys. Stat. Sol.}, 1303 volume = {204}, 1304 number = {12}, 1305 pages = {4049-4052}, 1306 year = {2007}, 1307 doi = {10.1002/pssa.200777359}, 1308 petsc_uses = {KSP} 1309} 1310 1311@InProceedings{ sg2007, 1312 author = {Simon Greaves}, 1313 title = {Micromagnetic Simulations of Magnetic Recording Media}, 1314 booktitle = {High Performance Computing on Vector Systems 2007}, 1315 doi = {10.1007/978-3-540-74384-2_17}, 1316 petsc_uses = {KSP} 1317} 1318 1319@Article{ bsc2007, 1320 author = {Nadjib Benatmane and Werner Scholz and T.W. Clinton}, 1321 title = {Magnetic Configurations and Phase Diagrams of sub-100 nm {NiFe} Nanorings}, 1322 journal = {IEEE Trans. Magn.}, 1323 volume = {43}, 1324 year = {2007}, 1325 pages = {2884-2886}, 1326 doi = {10.1109/TMAG.2007.892867}, 1327 petsc_uses = {KSP} 1328} 1329 1330@Article{ ffbf, 1331 author = {T. Fischbacher and M. Franchin and G. Bordignon and H. Fangohr}, 1332 title = {A Systematic Approach to Multiphysics Extensions of Finite-Element-Based 1333 Micromagnetic Simulations: Nmag.}, 1334 journal = {IEEE Trans. Magn. Volume}, 1335 volume = {43}, 1336 pages = {2896-2898}, 1337 doi = {10.1109/TMAG.2007.893843}, 1338 petsc_uses = {KSP} 1339} 1340 1341@InBook{ dfssfs2006, 1342 author = {R. Dittrich and J. Fidler and D. Suess and W. Schol and H. Forster, T. Schrefl}, 1343 chapter = {Computational Aspects of Micromagnetics}, 1344 title = {The Science of Hysteresis}, 1345 editor = { G. Bertotti and I. Mayergoyz}, 1346 url = {http://books.elsevier.com/us/elsevier/us/subindex.asp?maintarget=&isbn=0124808743}, 1347 petsc_uses = {KSP} 1348} 1349 1350@InBook{ fss, 1351 author = {J. Fidler and T. Schrefl and W. Scholz}, 1352 chapter = {Computational Micromagnetics}, 1353 title = {Handbook of Theoretical and Computational Nanotechnology}, 1354 editor = {M. Rieth and W. Schommers}, 1355 url = {http://www.amazon.com/gp/product/158883042X}, 1356 petsc_uses = {KSP} 1357} 1358 1359@InBook{ shbsef, 1360 author = {Thomas Schrefl and Gino Hrkac and Simon Bance and Dieter Suess and Otmar Ertl and 1361 Josef Fidler}, 1362 chapter = {Numerical Methods in Micromagnetics (Finite Element Method)}, 1363 title = {Handbook of Magnetism and Advanced Magnetic Materials}, 1364 editor = {Helmut Kronmueller and Stuart Parkin}, 1365 doi = {10.1002/9780470022184.hmm203}, 1366 petsc_uses = {KSP} 1367} 1368 1369@InBook{ sfs, 1370 author = {D. Suess and J. Fidler and T. Schrefl}, 1371 chapter = {Micromagnetic Simulation of magnetic materials}, 1372 title = {Handbook of Magnetic Materials}, 1373 editor = {K. H. J. Buschow}, 1374 url = {http://www.amazon.com/gp/product/0444518509}, 1375 petsc_uses = {KSP} 1376} 1377 1378@Article{ fsxzs, 1379 author = {J. Fernandez-de-Castro and Xiao Shen and Jianhua Xue and Yuming Zhou and S. 1380 Sharma}, 1381 title = {Writer Flux Closure and Transition Degradation Mechanism in Perpendicular 1382 Recording.}, 1383 journal = {IEEE Trans. Magn. Volume}, 1384 volume = {43}, 1385 pages = {2175-2177}, 1386 doi = {10.1109/TMAG.2007.893122}, 1387 petsc_uses = {KSP} 1388} 1389 1390@Article{ sb2006, 1391 author = {W. Scholz and S. Batra}, 1392 title = {Effect of write current waveform on magnetization and head field dynamics of 1393 perpendicular recording heads}, 1394 journal = {IEEE Trans. Magn.}, 1395 volume = {42}, 1396 year = {2006}, 1397 pages = {2264--2266}, 1398 url = {http://magnet.atp.tuwien.ac.at/scholz/projects/papers/ieee/scholz_2006_42_2264.pdf}, 1399 petsc_uses = {KSP} 1400} 1401 1402@Article{ bsr2006, 1403 author = {S. Batra and W. Scholz and T. Roscamp}, 1404 title = {Effect of thermal fluctuation field on the noise performance of a perpendicular 1405 recording system}, 1406 journal = {J. Appl. Phys.}, 1407 volume = {99}, 1408 year = {2006}, 1409 url = {http://magnet.atp.tuwien.ac.at/scholz/projects/papers/jap/batra_2006_99.pdf}, 1410 petsc_uses = {KSP} 1411} 1412 1413@InProceedings{ japios2006, 1414 author = {F. Johnson and S. Amancherla and G.J. Parker and L.E. Iorio and P.R. 1415 Subramanian}, 1416 title = {Micromagnetic simulations of the dependence of domain wall width with grain size 1417 in systems with cubic and uniaxial anisotropy.}, 1418 booktitle = {Intermag 2006 Conference}, 1419 petsc_uses = {KSP} 1420} 1421 1422@Article{ kbmb2006, 1423 author = {A. Kaya and M. Benakli and M.L. Mallary and J.A. Bain}, 1424 title = {A Micromagnetic Study of the Effect of Spatial Variations in Damping in 1425 Perpendicular Recording Heads}, 1426 journal = {IEEE Trans. Magn.}, 1427 volume = {42}, 1428 year = {2006}, 1429 pages = {2428--2430}, 1430 doi = {10.1109/TMAG.2006.879430}, 1431 petsc_uses = {KSP} 1432} 1433 1434@Article{ cclcw2006, 1435 author = {C. C. Chang and Y. C. Chang and C. M. Lee and C. C. Chen and J. Wu}, 1436 title = {Control of Domain Wall Motion in Permalloy Ring}, 1437 journal = {IEEE Trans. Magn.}, 1438 volume = {42}, 1439 year = {2006}, 1440 pages = {2960--2962}, 1441 doi = {10.1109/TMAG.2006.878414}, 1442 petsc_uses = {KSP} 1443} 1444 1445@Article{ bfmfzczg2007, 1446 author = {Richard P. Boardman and Hans Fangohr and Matthew J. Fairman and J. Zimmermann and 1447 Simon J. Cox and Alexander A. Zhukov and Peter A.J. de Groot}, 1448 title = {Micromagnetic modelling of ferromagnetic cones}, 1449 journal = {J. Magn. Magn. Mater.}, 1450 volume = {312}, 1451 year = {2007}, 1452 pages = {234-238}, 1453 url = {http://eprints.soton.ac.uk/45900/}, 1454 petsc_uses = {KSP} 1455} 1456 1457@PhDThesis{ rb2005, 1458 author = {Richard Boardman}, 1459 title = {Computer simulation studies of magnetic nanostructures}, 1460 school = {Computational Engineering and Design Group, School of Engineering Sciences, 1461 University of Southampton, United Kingdom}, 1462 year = {2005}, 1463 url = {http://www.soton.ac.uk/~rpb/thesis.pdf}, 1464 petsc_uses = {KSP} 1465} 1466 1467@InProceedings{ cwwy2006, 1468 author = {I-Hsin Chung and Robert E. Walkup and Hui-Fang Wen and Hao Yu}, 1469 title = {MPI Performance Analysis Tools on Blue Gene/L}, 1470 booktitle = {ACM/IEEE SC 2006 Conference (SC'06)}, 1471 year = {2006}, 1472 url = {http://sc06.supercomputing.org/schedule/pdf/pap159.pdf}, 1473 petsc_uses = {KSP} 1474} 1475 1476@InProceedings{ ch2006, 1477 author = {I.-H. Chung and J.K. Hollingsworth}, 1478 title = {A Case Study Using Automatic Performance Tuning for Large-Scale Scientific 1479 Programs}, 1480 booktitle = {High Performance Distributed Computing, 2006 15th IEEE International Symposium}, 1481 pages = {45--56}, 1482 doi = {10.1109/HPDC.2006.1652135}, 1483 petsc_uses = {KSP} 1484} 1485 1486@Article{ lkpl2005, 1487 author = {C. K. Lim and Y. S. Kim and N. Y. Park and J. Lee}, 1488 title = {Multibit {MRAM} using a pair of memory cells}, 1489 journal = {IEEE Trans. Magn.}, 1490 volume = {41}, 1491 year = {2005}, 1492 pages = {2670-2672}, 1493 doi = {10.1109/TMAG.2005.855288}, 1494 petsc_uses = {KSP} 1495} 1496 1497@Article{ gscn2005, 1498 author = {K. Yu. Guslienko and W. Scholz and R. W. Chantrell and V. Novosad}, 1499 title = {Vortex state oscillations in soft magnetic cylindrical dots}, 1500 journal = {Phys. Rev. B}, 1501 volume = {71}, 1502 year = {2005}, 1503 doi = {10.1103/PhysRevB.71.144407}, 1504 petsc_uses = {KSP} 1505} 1506 1507@PhDThesis{ mda, 1508 author = {Massimiliano d'Aquino}, 1509 title = {Nonlinear Magnetization Dynamics in Thin-Films and Nanoparticles}, 1510 school = { Universita di Napoli Federico II.}, 1511 url = {http://www.fedoa.unina.it/148/01/d_Aquino_thesis.pdf}, 1512 petsc_uses = {KSP} 1513} 1514 1515@TechReport{ ssdfssf2003, 1516 author = {T. Schrefl and W. Scholz and R. Dittrich and H. Forster and D. Suess and M. 1517 Stehno and J. Fidler}, 1518 title = {Micromagnetic Simulations of Domainstructures in Softmagnetic Thin Films}, 1519 url = {http://www.zid.tuwien.ac.at/projekte/2003/03-138-1.html}, 1520 petsc_uses = {KSP} 1521} 1522 1523@InProceedings{ sb2006a, 1524 author = {W. Scholz and S. Batra}, 1525 title = {Effect of write current waveform on magnetization and head field dynamics of 1526 perpendicular recording heads}, 1527 booktitle = {Intermag 2006 Conference, San Diego, CA, paper no. EF-03}, 1528 petsc_uses = {KSP} 1529} 1530 1531@Article{ scholz-batra1, 1532 author = {W. Scholz and S. Batra}, 1533 title = {Micromagnetic Simulation of Head Field and Write Bubble Dynamics in Perpendicular 1534 Recording}, 1535 journal = {IEEE Trans. Magn.}, 1536 note = {submitted}, 1537 year = {2005}, 1538 petsc_uses = {KSP} 1539} 1540 1541@Article{ scholz-batra2, 1542 author = {W. Scholz and S. Batra}, 1543 title = {Micromagnetic Modeling of Head Field Rise Time for High Data-Rate Recording}, 1544 journal = {IEEE Trans. Magn.}, 1545 volume = {41}, 1546 year = {2005}, 1547 pages = {702-706}, 1548 petsc_uses = {KSP} 1549} 1550 1551@Article{ daquino-scholz1, 1552 author = {M. d'Aquino and W. Scholz and T. Schrefl and C. Serpico and J. Fidler}, 1553 title = {Micromagnetic Analysis of Fast Precessional Switching}, 1554 journal = {J. Magn. Magn. Mater.}, 1555 volume = {290-291}, 1556 year = {2005}, 1557 pages = {510-513}, 1558 petsc_uses = {KSP} 1559} 1560 1561@Article{ aq-scholz-fid, 1562 author = {M. d'Aquino and W. Scholz and T. Schrefl and C. Serpico and J. Fidler}, 1563 title = {Numerical and analytical study of fast precessional switching}, 1564 journal = {J. Appl. Phys.}, 1565 volume = {95}, 1566 year = {2004}, 1567 pages = {7055-7057}, 1568 petsc_uses = {KSP} 1569} 1570 1571@InProceedings{ gar-tabik-gar, 1572 author = {E. M. Garzon and S. Tabik and I. Garcia and A. R. Bretones}, 1573 title = {Multiprocessing of the Time Domain Analysis of Thin-Wire Antennas and 1574 Scatterers}, 1575 booktitle = {12th Euromicro Conference on Parallel, Distributed and Network-Based Processing 1576 (PDP'04)}, 1577 year = {2004}, 1578 pages = {80--}, 1579 petsc_uses = {KSP} 1580} 1581 1582@InProceedings{ aq-scholz-mia, 1583 author = {M. d'Aquino and W. Scholz and T. Schrefl and C. Serpico and G. Miano}, 1584 title = {Analysis of fast precessional switching in magnetic thin films}, 1585 booktitle = {Proceedings of PIERS (Progress In Electromagnetic Research Symposium)}, 1586 year = {2004}, 1587 pages = {257-260}, 1588 petsc_uses = {KSP} 1589} 1590 1591@Article{ scholz-fid-seus, 1592 author = {W. Scholz and J. Fidler and T. Schrefl and D. Suess and H. Forster and R. 1593 Dittrich and V. Tsiantos}, 1594 title = {Numerical Micromagnetic Simulation of Fe-Pt Nanoparticles with Multiple Easy 1595 Axes}, 1596 journal = {J. Magn. Magn. Mater.}, 1597 year = {2004}, 1598 pages = {1524-1525}, 1599 petsc_uses = {KSP} 1600} 1601 1602@Article{ boardman-zimmerman, 1603 author = {Richard Boardman and Juergen Zimmermann and Hans Fangohr and Alexander Zhukov and 1604 Peter de Groot}, 1605 title = {Micromagnetic simulation studies of ferromagnetic part-spheres}, 1606 journal = {Journal of Applied Physics}, 1607 year = {2005}, 1608 petsc_uses = {KSP} 1609} 1610 1611@Article{ lim-kim-park, 1612 author = {C. K. Lim and Y. S. Kim and N. Y. Park and J. Lee}, 1613 title = {High Density Magnetic Random Access Memory Using a Pair of Asymmetrical Cell}, 1614 journal = {IEEE Trans. Magn.}, 1615 note = {submitted}, 1616 petsc_uses = {KSP} 1617} 1618 1619@Article{ scholz-suess2, 1620 author = {W. Scholz and D. Suess and T. Schrefl and J. Fidler}, 1621 title = {Micromagnetic simulation of magnetization reversal in small particles with 1622 surface anisotropy}, 1623 journal = {J. Appl. Phys.}, 1624 volume = {95}, 1625 year = {2004}, 1626 pages = {6807-6809}, 1627 petsc_uses = {KSP} 1628} 1629 1630@Article{ scholz-schrefl1, 1631 author = {W. Scholz and T. Schrefl and J. Fidler and T. Matthias and D. Suess and V. 1632 Tsiantos}, 1633 title = {Micromagnetic simulation of the pinning and depinning process in permanent 1634 magnets}, 1635 journal = {IEEE Trans. Magn.}, 1636 volume = {39}, 1637 year = {2003}, 1638 pages = {2920-2922}, 1639 petsc_uses = {KSP} 1640} 1641 1642@Article{ scholz-guslienko, 1643 author = {W. Scholz and K. Y. Guslienko and V. Novosad and D. Suess and T. Schrefl and R. 1644 W. Chantrell and J. Fidler}, 1645 title = {Transition from single-domain to vortex state in soft magnetic cylindrical 1646 nanodots}, 1647 journal = {J. Magn. Magn. Mater.}, 1648 volume = {266}, 1649 year = {2003}, 1650 pages = {155-163}, 1651 petsc_uses = {KSP} 1652} 1653 1654@Article{ scholz1, 1655 author = { W. Scholz and J. Fidler and T. Schrefl and D. Suess and R. Dittrich and H. 1656 Forster and V. Tsiantos}, 1657 title = {Scalable Parallel Micromagnetic Solvers for Magnetic Nanostructures}, 1658 journal = {Comp. Mat. Sci}, 1659 year = {2003}, 1660 pages = {366--383}, 1661 volume = {28}, 1662 url = {http://magnet.atp.tuwien.ac.at/scholz/projects/papers/preprint/scholz/cms03/magpar.pdf}, 1663 petsc_uses = {KSP} 1664} 1665 1666@PhDThesis{ scholz2, 1667 author = {W. Scholz}, 1668 title = {Scalable Parallel Micromagnetic Solvers for Magnetic Nanostructures}, 1669 school = {Vienna University of Technology, Vienna, Austria}, 1670 year = {2003}, 1671 petsc_uses = {KSP} 1672} 1673 1674@Article{ scholz3, 1675 author = {W. Scholz and D. Suess and R. Dittrich and T. Schrefl and V. Tsiantos and H. 1676 Forster and J. Fidler}, 1677 title = {Implementation of a high performance parallel finite element micromagnetics 1678 package}, 1679 journal = {J. Magn. Magn. Mater.}, 1680 year = {2004}, 1681 url = {http://magnet.atp.tuwien.ac.at/scholz/projects/papers/preprint/scholz/icm2003/scholz_petsc.pdf}, 1682 petsc_uses = {KSP} 1683} 1684 1685% LiteralHTML: <td width="100%" colspan="2"><hr size="4" color="#FF5B5B"> </td> 1686@InBook{ zhanggladwell1, 1687 author = {W. Zhang and I. Gladwell}, 1688 chapter = {Performance of MOL for Surface Motion Driven by a Laplacian of Curvature}, 1689 editor = {Z. Chen and R.E. Ewing and Z.-C. Shi}, 1690 year = {2000}, 1691 title = {Numerical Treatment of Multiphase Flows in Porous Media, Lecture Notes in 1692 Physics, vol. 552}, 1693 publisher = {Springer}, 1694 pages = {4190-}, 1695 petsc_uses = {KSP} 1696} 1697 1698@Article{ wolf1, 1699 author = {A. J. Haslan and D. Moldovan and S. R. Phillpot and V. Yamakov}, 1700 title = {Combined Atomistic and Mesoscale simulation of grain growth in nanocrystalline 1701 thin films}, 1702 journal = {Phil. Mag. A}, 1703 year = {2003}, 1704 lab = {ANL}, 1705 petsc_uses = {KSP} 1706} 1707 1708@Article{ wolf2, 1709 author = {A. J. Haslan and D. Moldovan and S. R. Phillpot and H. Gleiter}, 1710 title = {Mesoscopic simulation of two dimensional grain growth with anisotropic 1711 grain-boundary properties}, 1712 journal = {Computational Materials Science}, 1713 year = {2001}, 1714 volume = {23}, 1715 pages = {15--32}, 1716 lab = {ANL}, 1717 petsc_uses = {KSP} 1718} 1719 1720@Article{ wolf3, 1721 author = {D. Moldovan and S. R. Phillpot and A. J. Haslan}, 1722 title = {Role of grain rotation in grain growth by mesoscale simulation}, 1723 journal = {Phil. Mag. A}, 1724 year = {2002}, 1725 volume = {82}, 1726 pages = {1271--1297}, 1727 lab = {ANL}, 1728 petsc_uses = {KSP} 1729} 1730 1731% LiteralHTML: <td width="100%" colspan="2"><hr size="4" color="#FF5B5B"> </td> 1732@Article{ saut, 1733 author = { Olivier Saut}, 1734 title = {Bidimensional Study of the {M}axwell-{B}loch Model in a Nonlinear Crystal}, 1735 journal = {SIAM Journal on Scientific Computing}, 1736 year = {2004}, 1737 note = {submitted}, 1738 url = {http://mip.ups-tlse.fr/\~{ }saut/data/sisc04.pdf}, 1739 petsc_uses = {KSP} 1740} 1741 1742% LiteralHTML: 1743% LiteralHTML: <a name="biology"><H3><center>Biology -- Medical</center></H3> 1744% LiteralHTML: 1745@InBook{ khanallorenziayachepennec2016, 1746 title = {Simulating Patient Specific Multiple Time-Point {MRIs} from a Biophysical Model 1747 of Brain Deformation in {Alzheimer's} Disease}, 1748 booktitle = {Computational Biomechanics for Medicine: Imaging, Modeling and Computing}, 1749 author = {Bishesh Khanal and Marco Lorenzi and Nicholas Ayache and Xavier Pennec}, 1750 editor = {Grand R. Joldes and Barry Doyle and Adam Wittek and Poul M.F. Nielsen and Karol 1751 Miller}, 1752 pages = {167--176}, 1753 isbn = {978-3-319-28329-6}, 1754 doi = {10.1007/978-3-319-28329-6_15}, 1755 publisher = {Springer International Publishing}, 1756 year = {2016}, 1757 petsc_uses = {KSP} 1758} 1759 1760@Article{ ataseven, 1761 author = {Y. Ataseven and Z. Akaliota n-Acar and C.~E. Acar and N. G. Gen\c{c}er}, 1762 title = {Parallel implementation of the accelerated {BEM} approach for {EMSI} of the human 1763 brain}, 1764 journal = {Medical and Biological Engineering and Computing}, 1765 month = feb, 1766 year = {2008}, 1767 doi = {10.1007/s11517-008-0316-0}, 1768 petsc_uses = {KSP} 1769} 1770 1771@Article{ dennis-eberhart-03, 1772 author = {B. H. Dennis and R. C. Eberhart and G. S. Dulikravich and S.W. Radons}, 1773 pages = {832-840}, 1774 volume = {125}, 1775 number = {6}, 1776 title = {Finite-element simulation of cooling of realistic {3-D} human head and neck}, 1777 journal = {J Biomech Eng}, 1778 year = {2003}, 1779 url = {http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?cmd=Retrieve&db=PubMed&list_uids=14986408&dopt=Citation}, 1780 petsc_uses = {KSP} 1781} 1782 1783@Conference{ gu7174parallel, 1784 title = {{A parallel reduced-space sequential-quadratic programming algorithm for 1785 frequency-domain small animal optical tomography}}, 1786 author = {Gu, X. and Kim, H.K. and Masciotti, J. and Hielscher, A.H.}, 1787 booktitle = {Proc. of SPIE Vol}, 1788 volume = {7174}, 1789 number = {717406}, 1790 pages = {1}, 1791 petsc_uses = {KSP} 1792} 1793 1794@Article{ barchanski2005using, 1795 title = {{Using domain decomposition techniques for the calculation of low-frequency 1796 electric current densities in high-resolution 3D human anatomy models}}, 1797 author = {Barchanski, A. and Clemens, M. and De Gersem, H. and Steiner, T. and Weiland, 1798 T.}, 1799 journal = {COMPEL: The International Journal for Computation and Mathematics in Electrical 1800 and Electronic Engineering}, 1801 volume = {24}, 1802 number = {2}, 1803 pages = {458--467}, 1804 issn = {0332-1649}, 1805 year = {2005}, 1806 publisher = {Emerald Group Publishing Limited}, 1807 petsc_uses = {KSP} 1808} 1809 1810@Article{ motrescurienen05, 1811 author = {V. C. Motrescu and U. van Rienen}, 1812 pages = {227--231}, 1813 volume = {3}, 1814 title = {Computation of currents induced by {ELF} electric fields in anisotropic human 1815 tissues using the Finite Integration Technique}, 1816 journal = {Advances in Radio Science}, 1817 year = {2005}, 1818 url = {http://www.copernicus.org/URSI/ars/3/ars-3-227.pdf}, 1819 petsc_uses = {KSP} 1820} 1821 1822@Article{ motrescurienen04, 1823 author = {V. C. Motrescu and U. van Rienen}, 1824 pages = {309--313}, 1825 volume = {2}, 1826 title = {Computation of electrostatic fields in anisotropic human tissues using the Finite 1827 Integration Technique (FIT)}, 1828 journal = {Advances in Radio Science}, 1829 year = {2004}, 1830 url = {http://www.copernicus.org/URSI/ars/ARS_2_1/309.pdf}, 1831 petsc_uses = {KSP} 1832} 1833 1834@InProceedings{ dbl2, 1835 author = {Enzo A. Dari and Mariano I. Cantero and Raul A. Feijoo}, 1836 title = {Computational arterial flow modeling using a parallel {Navier-Stokes} solver}, 1837 booktitle = {ECCOMAS2000}, 1838 year = {2000}, 1839 url = {http://146.134.8.133/Feijoo/CModComplexos/Conferencias/ECCOMAS2000/Darie/eccomas.html}, 1840 petsc_uses = {KSP} 1841} 1842 1843@Unpublished{ cell, 1844 title = {Parallel Simulation Engines for Whole-Cell Models}, 1845 author = {Markus Schwehm and Nils Gehlenborg and Hendrik Post and Amelie Stein and Kirstin 1846 Weber}, 1847 note = {Poster at Second International Conference on Systems Biology (ICSB) 2001}, 1848 url = {http://www.icsb-2001.org/Posters/110_schwehm2.pdf}, 1849 institution = {University of Tubingen, ZBIT - Zentrum fur Bioinformatik Tubingen}, 1850 year = {2001}, 1851 petsc_uses = {KSP} 1852} 1853 1854@Article{ barker2010two, 1855 title = {Two-level {N}ewton and hybrid {S}chwarz preconditioners for fluid-structure 1856 interaction}, 1857 author = {Barker, A.T. and Cai, X.C.}, 1858 journal = {SIAM Journal on Scientific Computing}, 1859 volume = {32}, 1860 number = {4}, 1861 pages = {2395--2417}, 1862 year = {2010}, 1863 publisher = {Society for Industrial and Applied Mathematics}, 1864 petsc_uses = {KSP} 1865} 1866 1867@Article{ barker2010scalable, 1868 title = {Scalable parallel methods for monolithic coupling in fluid-structure interaction 1869 with application to blood flow modeling}, 1870 author = {Barker, A.T. and Cai, X.C.}, 1871 journal = {Journal of Computational Physics}, 1872 volume = {229}, 1873 number = {3}, 1874 pages = {642--659}, 1875 year = {2010}, 1876 publisher = {Elsevier}, 1877 petsc_uses = {KSP} 1878} 1879 1880@Article{ barker2009nks, 1881 title = {{NKS} for fully coupled fluid-structure interaction with application}, 1882 author = {Barker, A.T. and Cai, X.C.}, 1883 journal = {Domain Decomposition Methods in Science and Engineering XVIII}, 1884 pages = {275--282}, 1885 year = {2009}, 1886 publisher = {Springer}, 1887 petsc_uses = {KSP} 1888} 1889 1890@Article{ mirams2013, 1891 author = {Chris Luscombe and Geoff Williams and Jordi Munoz-Muriedas and David J Gavaghan 1892 and Yi Cui and Gary R Mirams}, 1893 title = {Evaluation of an in silico cardiac safety assay: using ion channel screening data 1894 to predict {QT} interval changes in the rabbit ventricular wedge}, 1895 journal = {Journal of pharmacological and toxicological methods}, 1896 volume = {68}, 1897 number = {1}, 1898 pages = {88--96}, 1899 year = {2013}, 1900 doi = {10.1016/j.vascn.2013.04.004}, 1901 petsc_uses = {KSP} 1902} 1903 1904% LiteralHTML: <td width="100%" colspan="2"><hr size="4" color="#FF5B5B"> </td> 1905% LiteralHTML: <center><img alt="" 1906% LiteralHTML: src="images/spine0l.jpg"></center></p> 1907% LiteralHTML: <center><img alt="" 1908% LiteralHTML: src="images/vertebra.jpg"></center></p> 1909% LiteralHTML:<font color="#FF0000"> 1910% LiteralHTML:Treating fractures of the hip and spine is a major medical cost. 1911% LiteralHTML:Understanding bone mechanical properties and how they may lead to 1912% LiteralHTML:fractures is thus an important medical research activity. PETSc and 1913% LiteralHTML:Prometheus have been used for extremely large scale finite element 1914% LiteralHTML:simulation of the solid mechanics of a portion of a human spine by a 1915% LiteralHTML:team of doctors and computational scientists. This computation was 1916% LiteralHTML:a winner of a Gordon Bell Special Prize at SC2004 and ran scalably 1917% LiteralHTML:with over 4000 processors.</p> 1918% LiteralHTML: </font> 1919@Article{ arbenz2008scalable, 1920 title = {A scalable multi-level preconditioner for matrix-free $\mu$-finite element 1921 analysis of human bone structures}, 1922 author = {Arbenz, P. and van Lenthe, G.H. and Mennel, U. and M{\\"u}ller, R. and Sala, M.}, 1923 journal = {International Journal for Numerical Methods in Engineering}, 1924 volume = {73}, 1925 number = {7}, 1926 pages = {927--947}, 1927 year = {2008}, 1928 publisher = {Wiley Online Library}, 1929 petsc_uses = {KSP} 1930} 1931 1932@InProceedings{ adams-04, 1933 author = {Adams, M.~F. and Bayraktar, H.H. and Keaveny, T.M. and Papadopoulos, P.}, 1934 booktitle = {ACM/IEEE Proceedings of SC2004: High Performance Networking and Computing}, 1935 title = {Ultrascalable implicit finite element analyses in solid mechanics with over a 1936 half a billion degrees of freedom}, 1937 note = {Gordon Bell Award}, 1938 year = {2004}, 1939 petsc_uses = {KSP} 1940} 1941 1942@InProceedings{ adams-03b, 1943 author = {Adams, M.~F. and Bayraktar, H.H. and Keaveny, T.M. and Papadopoulos, P.}, 1944 title = {Applications of Algebraic Multigrid to Large-Scale Finite Element Analysis of 1945 Whole Bone Micro-Mechanics on the {IBM SP}}, 1946 booktitle = {ACM/IEEE Proceedings of SC2003: High Performance Networking and Computing}, 1947 year = {2003}, 1948 petsc_uses = {KSP} 1949} 1950 1951@InProceedings{ oghattas2002, 1952 author = {Volkan Akcelik and George Biros and Omar Ghattas}, 1953 title = {Parallel Multiscale {Gauss-Newton-Krylov} Methods For Inverse Wave Propagation}, 1954 booktitle = {Procceedings of SC2002}, 1955 url = {http://www-2.cs.cmu.edu/\~{ }oghattas/papers/sc2002.pdf}, 1956 note = {Winner of SC2002 Best Paper. A parallel algorithm for inverse problems governed 1957 by time-dependent PDEs, and scalability results for an inverse wave propagation 1958 problem of determining the material field of an acoustic medium. Using the 1959 algorithm, they solved a synthetic inverse wave propagation problem though a 1960 pelvic bone geometry involving 2.1 million inversion parameters in 3 hours on 256 1961 processors.}, 1962 year = {2002}, 1963 petsc_uses = {KSP} 1964} 1965 1966% LiteralHTML: <a name="biology:cardiology"> 1967% LiteralHTML: <td width="100%" colspan="2"><hr size="4" color="#FF5B5B"> </td> 1968% LiteralHTML: <center><img alt="" 1969% LiteralHTML: src="images/heart.jpg"> 1970% LiteralHTML: <img alt="" 1971% LiteralHTML: src="images/pump.jpg"></center></p> 1972% LiteralHTML: 1973% LiteralHTML:<font color="#FF0000"> 1974% LiteralHTML: Arrhythmias are disorders of the regular rhythmic beating of the 1975% LiteralHTML: heart; they are the cause of the majority of sudden cardiac 1976% LiteralHTML: deaths. The heart beat is controlled by electrical signals moving 1977% LiteralHTML: through the heart. PETSc has been used by several research groups to 1978% LiteralHTML: simulate the electronic behavior of the heart in an attempt to more 1979% LiteralHTML: fully understand the developments of arrhthmias.</p> 1980% LiteralHTML:</font> 1981@InProceedings{ oghattas2000, 1982 author = {J. Antaki and G. Belloch and O. Ghattas and I. Malcevic and G. Miller and N. 1983 Walkington}, 1984 title = {A Parallel Dynamic-Mesh {L}agrangian Method for Simulation of Flows with Dynamic 1985 Interfaces}, 1986 booktitle = {Procceedings of SC2000}, 1987 url = {http://www.cs.cmu.edu/\~{ }oghattas/papers/sc2000/sc2000.pdf}, 1988 note = {Blood flow modeling at the microscale including effects on individual blood 1989 cells, for designing heart assist pumps, etc.}, 1990 year = {2000}, 1991 petsc_uses = {KSP} 1992} 1993 1994@InBook{ cfps2006, 1995 author = {P. Colli Franzone and L. F. Pavarino and G. Savare}, 1996 editor = {A. Quarteroni et al.}, 1997 title = {Complex Systems in Biomedicine}, 1998 chapter = {Computational Electrocardiology: mathematical and numerical modeling}, 1999 publisher = {Springer-Verlag}, 2000 pages = {187--241}, 2001 year = {2006}, 2002 petsc_uses = {KSP} 2003} 2004 2005@InProceedings{ cfpst2007, 2006 author = {P. Colli Franzone and L. F. Pavarino and S. Scacchi and B. Taccardi}, 2007 title = {Determining recovery times from transmembrane action potentials and unipolar 2008 electrograms in normal heart tissue}, 2009 booktitle = {FIMH07}, 2010 publisher = {Springer-Verlag}, 2011 volume = {4466}, 2012 pages = {139--149}, 2013 year = {2007}, 2014 petsc_uses = {KSP} 2015} 2016 2017@Article{ seemann2010framework, 2018 title = {{Framework for Modular, Flexible and Efficient Solving the Cardiac Bidomain 2019 Equations Using PETSc}}, 2020 author = {Seemann, G. and Sachse, FB and Karl, M. and Weiss, DL and Heuveline, V. and 2021 D{\\"o}ssel, O.}, 2022 journal = {Progress in Industrial Mathematics at ECMI 2008}, 2023 pages = {363--369}, 2024 year = {2010}, 2025 publisher = {Springer}, 2026 petsc_uses = {KSP} 2027} 2028 2029@InProceedings{ pft2005, 2030 author = {Luca F. Pavarino and Piero Colli Franzone and Bruno Taccardi}, 2031 title = {Monodomain Simulations of Excitation and Recovery in Cardiac Blocks with 2032 Intramural Heterogeneity}, 2033 booktitle = {Functional Imaging and modeling of the Heart (FIMH05)}, 2034 pages = {267--277}, 2035 editors = {A. Frangi et al.}, 2036 publisher = {Springer, Lecture Notes in Computer Science (LNCS), v. 3504}, 2037 year = {2005}, 2038 petsc_uses = {KSP} 2039} 2040 2041@Article{ bgcp2005, 2042 author = {Boyce E. Griffith and Charles S. Peskin}, 2043 title = {On the order of accuracy of the immersed boundary method: Higher order 2044 convergence rates for sufficiently smooth problems}, 2045 journal = {Journal of Computational Physics}, 2046 year = {2005}, 2047 volume = {208}, 2048 pages = {75--105}, 2049 petsc_uses = {KSP} 2050} 2051 2052@Article{ griffith2007adaptive, 2053 title = {An adaptive, formally second order accurate version of the immersed boundary 2054 method}, 2055 author = {Griffith, B.E. and Hornung, R.D. and McQueen, D.M. and Peskin, C.S.}, 2056 journal = {Journal of Computational Physics}, 2057 volume = {223}, 2058 number = {1}, 2059 pages = {10--49}, 2060 year = {2007}, 2061 publisher = {Elsevier}, 2062 petsc_uses = {KSP} 2063} 2064 2065@PhDThesis{ griffith05, 2066 author = {Boyce Griffith}, 2067 title = {Simulating the blood-muscle-valve mechanics of the heart by an adaptive and 2068 parallel version of the immersed boundary method}, 2069 school = {New York University}, 2070 year = {2005}, 2071 petsc_uses = {KSP} 2072} 2073 2074@PhDThesis{ murillo, 2075 author = {Maria S. Murillo}, 2076 title = {Parallel Algorithms and Software for Time-Dependent System of Nonlinear Partial 2077 Differential Equations with an Application in Computational Biology}, 2078 school = {University of Colorado at Boulder}, 2079 year = {2002}, 2080 petsc_uses = {KSP} 2081} 2082 2083@Article{ spv2004, 2084 author = {Rodrigo Weber Dos Santos and G. Plank and S. Bauer}, 2085 title = {Parallel multigrid preconditioner for the cardiac bidomain model}, 2086 journal = {IEEE Trans. Biomed. Eng}, 2087 year = {2004}, 2088 volume = {51}, 2089 pages = {1960--1968}, 2090 petsc_uses = {KSP} 2091} 2092 2093@Article{ vphl2003, 2094 author = {E. J. Vigmond and M. Hughes and G. Plank, L.J. Leon}, 2095 title = { Computational Tools for Modeling Electrical Activity in Cardiac Tissue}, 2096 journal = {J. Electrocardiol.}, 2097 year = {2003}, 2098 volume = {36}, 2099 pages = {69--74}, 2100 petsc_uses = {KSP} 2101} 2102 2103@InProceedings{ spbv2003, 2104 author = {Rodrigo Weber Dos Santos and G. Plank and S. Bauer and E.J. Vigmond}, 2105 title = {Preconditioning Techniques for the Bidomain Equations}, 2106 booktitle = {Proceedings of the 15th International Conference on Domain Decomposition 2107 Methods}, 2108 pages = {571--580}, 2109 publisher = {Springer, Lecture Notes in Computational Science and Engineering (LNCSE).}, 2110 note = {}, 2111 url = {http://www.ddm.org/DD15/proceedings-dd15.html}, 2112 year = {2003}, 2113 petsc_uses = {KSP} 2114} 2115 2116@Article{ franz-pavir-04, 2117 author = {P. Colli Franzone and L.~F. Pavarino}, 2118 title = {A parallel solver for reaction-diffusion systems in computational 2119 electrocardiology}, 2120 journal = {Mathematical Models and Methods in Applied Sciences}, 2121 year = {2004}, 2122 volume = {14}, 2123 number = {6}, 2124 pages = {883--912}, 2125 petsc_uses = {KSP} 2126} 2127 2128@Article{ franz-pavir-05, 2129 author = {P. Colli Franzone and L.~F. Pavarino and B. Taccardi}, 2130 title = {Simulating patterns of excitation, repolarization and action potential 2131 durationwith cardiac Bidomain and Monodomain models}, 2132 journal = {Mathematical Biosciences}, 2133 year = {2005}, 2134 volume = {197}, 2135 number = {1}, 2136 pages = {35--66}, 2137 petsc_uses = {KSP} 2138} 2139 2140@Article{ franz-pavir-06, 2141 author = {P. Colli Franzone and L.~F. Pavarino and B. Taccardi}, 2142 title = {Effects of transmural electrical heterogeneities and electrotonic interactions on 2143 the dispersion of cardiac repolarization and action potential duration: a 2144 simulation study}, 2145 journal = {Mathematical Biosciences}, 2146 year = {2006}, 2147 volume = {204}, 2148 number = {1}, 2149 pages = {132--165}, 2150 petsc_uses = {KSP} 2151} 2152 2153@InProceedings{ colli-franz-sim, 2154 author = {P. Colli-Franzone and L.F. Pavarino and B. Taccardi}, 2155 title = {MODELING ANISOTROPIC AND HETEROGENEOUS CARDIAC MODELS: PARALLEL SIMULATIONS}, 2156 booktitle = {MEDICON and HEALTH TELEMATICS 2004, Health in the Information Society, X 2157 Mediterranean Conference on Medical and Biological Engineering}, 2158 url = {http://cluster.mat.unimi.it/doc/Progetti/Pavarino-LF.pdf}, 2159 year = {2004}, 2160 petsc_uses = {KSP} 2161} 2162 2163@InProceedings{ pf2003, 2164 author = {Luca F. Pavarino and Piero Colli Franzone}, 2165 title = {Parallel Solution of Cardiac Reaction-Diffusion Models}, 2166 booktitle = {Proceedings of the 15th International Conference on Domain Decomposition 2167 Methods}, 2168 pages = {669--776}, 2169 publisher = {Springer, Lecture Notes in Computational Science and Engineering (LNCSE).}, 2170 note = {}, 2171 url = {http://www.ddm.org/DD15/proceedings-dd15.html}, 2172 year = {2003}, 2173 petsc_uses = {KSP} 2174} 2175 2176@Article{ maria-is04, 2177 author = {Maria Murillo and Xiao-Chuan Cai}, 2178 title = {A fully implicit parallel algorithm for simulating the non-linear electrical 2179 activity of the heart}, 2180 journal = {Numerical Linear Algebra with Applications}, 2181 year = {2004}, 2182 volume = {11}, 2183 pages = {261 - 277}, 2184 url = {http://www3.interscience.wiley.com/cgi-bin/abstract/107632540/ABSTRACT}, 2185 petsc_uses = {KSP} 2186} 2187 2188@Article{ murli2007monitoring, 2189 title = {{Monitoring and Migration of a PETSc-based Parallel Application for Medical 2190 Imaging in a Grid computing PSE}}, 2191 author = {Murli, A. and Boccia, V. and Carracciuolo, L. and D’Amore, L. and Laccetti, G. 2192 and Lapegna, M.}, 2193 journal = {Grid-Based Problem Solving Environments}, 2194 pages = {421--432}, 2195 year = {2007}, 2196 publisher = {Springer}, 2197 petsc_uses = {KSP} 2198} 2199 2200@Article{ carracciuolo:2006:tpc, 2201 author = {Carracciuolo, L. and D'Amore, L. and Murli, A.}, 2202 title = {Towards a parallel component for imaging in {PETSc} programming environment: a case 2203 study in {3-D} echocardiography}, 2204 journal = {Parallel Comput.}, 2205 volume = {32}, 2206 issue = {1}, 2207 month = jan, 2208 year = {2006}, 2209 issn = {0167-8191}, 2210 pages = {67--83}, 2211 numpages = {17}, 2212 doi = {10.1016/j.parco.2005.09.001}, 2213 acmid = {1141218}, 2214 publisher = {Elsevier Science Publishers B. V.}, 2215 address = {Amsterdam, The Netherlands, The Netherlands}, 2216 keywords = {Distributed software environment, Image denoising, Non linear PDE, Parallel 2217 component}, 2218 petsc_uses = {KSP} 2219} 2220 2221@Article{ damore2011integration, 2222 title = {Integration of emerging computer technologies for an efficient image sequences 2223 analysis}, 2224 journal = {Integrated Computer-Aided Engineering }, 2225 volume = {18}, 2226 number = {4}, 2227 pages = {365 - 378}, 2228 year = {2011}, 2229 note = {}, 2230 issn = {1875-8835}, 2231 doi = {10.3233/ICA-2011-0382}, 2232 url = {http://iospress.metapress.com/content/KM614806M50TKVP7}, 2233 author = {L. D'Amore and D. Casaburi and A. Galletti and L. Marcellino and A. Murli}, 2234 keywords = {Image sequence, pipe and filters, parallel computing, multicore processors}, 2235 petsc_uses = {KSP} 2236} 2237 2238@InProceedings{ eth_biwi_00721, 2239 author = {K. Burckhardt and D. Szczerba and J. Brown and K. Muralidhar and G. 2240 Székely}, 2241 title = {Fast Implicit Simulation of Oscillatory Flow in Human Abdominal Bifurcation using 2242 a {S}chur Complement Preconditioner}, 2243 booktitle = {Euro-Par 2009 Parallel Processing}, 2244 year = {2009}, 2245 month = aug, 2246 pages = {747-759}, 2247 volume = {5704}, 2248 editor = {H. Sips and D. Epema and H.-X. Lin}, 2249 series = {Lecture Notes in Computer Science}, 2250 publisher = {Springer}, 2251 keywords = {Aortic aneurysm, flow simulation, streamline diffusion FEM, indefinite matrix, 2252 parallel Krylov solver}, 2253 petsc_uses = {KSP} 2254} 2255 2256% LiteralHTML: <a name="biology:imagingandsurgery"> 2257% LiteralHTML: <td width="100%" colspan="2"><hr size="4" color="#FF5B5B"> </td> 2258% LiteralHTML: <center><img alt="" 2259% LiteralHTML: src="images/brain.jpg"></center> 2260@Article{ ganser2004deformable, 2261 title = {A deformable digital brain atlas system according to Talairach and Tournoux}, 2262 author = {Ganser, K.A. and Dickhaus, H. and Metzner, R. and Wirtz, C.R.}, 2263 journal = {Medical Image Analysis}, 2264 volume = {8}, 2265 number = {1}, 2266 pages = {3--22}, 2267 year = {2004}, 2268 publisher = {Elsevier}, 2269 petsc_uses = {KSP} 2270} 2271 2272@Unpublished{ taccsurgery, 2273 title = {{TACC} supercomputer performs laser cancer surgery on canine}, 2274 url = {http://www.tacc.utexas.edu/research/users/features/dynamic.php?m_b_c=laser}, 2275 note = {In April, the Lonestar supercomputer at the Texas Advanced Computing Center in 2276 Austin performed laser surgery on a dog in Houston without the intervention of a 2277 surgeon. The treatment was developed collaboratively by computational experts from 2278 the Institute for Computational Engineering and Sciences (ICES) at UT-Austin, 2279 leading technologists from the M.D. Anderson Cancer Center in Houston, and 2280 cyberinfrastructure specialists and systems from TACC. Using precise lasers, 2281 state-of-the-art thermal imaging technology, and advanced computational methods, 2282 dynamic, data-driven treatments are being pursued as a minimally invasive 2283 alternative to the standard treatment of cancer.}, 2284 petsc_uses = {KSP} 2285} 2286 2287@Article{ ffhbresso2008, 2288 author = {Yusheng Feng and David Fuentes and Andrea Hawkins and Jon Bass and Marissa 2289 Nichole Rylander and Andrew Elliott and Anil Shetty and R. Jason Stafford and J. 2290 Tinsley Oden}, 2291 title = {Nanoshell-Mediated Laser Surgery Simulation for Prostate Cancer Treatment}, 2292 journal = {Engineering with Computers}, 2293 note = {Special issue on Computational Bioengineering}, 2294 year = {2008}, 2295 url = {http://www.tacc.utexas.edu/research/users/features/laser_surgery.pdf}, 2296 petsc_uses = {KSP} 2297} 2298 2299@TechReport{ dobbhbbbdeffghkkps2008, 2300 author = {K. R. Diller and J. T. Oden and C. Bajaj and J. C. Browne and J. Hazle and I. 2301 Babu{\v{s}}ka and J. Bass and L. Bidaut and L. Demkowicz and A. Elliott and Y. 2302 Feng and D. Fuentes and S. Goswami and A. Hawkins and S. Khoshnevis and B. Kwon 2303 and S. Prudhomme and R. J. Stafford}, 2304 title = {Computational Infrastructure for the Real-Time Patient-Specific Treatment of 2305 Cancer}, 2306 year = {2008}, 2307 institution = {University of Texas at Austin}, 2308 url = {http://www.tacc.utexas.edu/research/users/features/cancer.pdf}, 2309 petsc_uses = {KSP} 2310} 2311 2312@Article{ ogdb2004, 2313 author = {A.A. Oberai and N.H. Gokhale and M.M. Doyley and J.C.Bamber}, 2314 title = {Evaluation of the Adjoint Equation Based Algorithm for Elasticity Imaging}, 2315 journal = {Physics in Medicine and Biology}, 2316 year = {2004}, 2317 volume = {49}, 2318 pages = {2955--2947}, 2319 petsc_uses = {KSP} 2320} 2321 2322@InProceedings{ majumdar11, 2323 author = {A. Majumdar and A. Birnbaum and D. Choi and A. Trivedi and S. K. Warfield and K. 2324 Baldridge and P. Krysl}, 2325 title = {A Dynamic Data Driven Grid System for Intra-Operative Image Guided Neurosurgery}, 2326 booktitle = {ICCS 2005}, 2327 pages = {672--679}, 2328 editor = {V.S. Sunderam et al.}, 2329 year = {2005}, 2330 petsc_uses = {KSP} 2331} 2332 2333@Conference{ sermesant-etal:03, 2334 author = {Sermesant, M. and Clatz, O. and Li, Z. and Lanteri, S. and Delingette, H. and 2335 Ayache, H.}, 2336 title = {A parallel implementation of non-rigid registration using a volumetric 2337 biomechanical model}, 2338 booktitle = {Second International Workshop on Biomedical Image Registration {WBIR'03}}, 2339 address = {Philadelphia, PA, USA}, 2340 publisher = {Springer-Verlag}, 2341 editor = {Gee, J.C. and Maintz, J.B.A. and Vannier, M.W.}, 2342 series = {Lecture Notes in Computer Science}, 2343 volume = {2717}, 2344 pages = {398-407}, 2345 date = {june 23-24}, 2346 year = {2003}, 2347 url = {ftp://ftp-sop.inria.fr/epidaure/Publications/Sermesant/WBIR2003Sermesant.pdf}, 2348 petsc_uses = {KSP} 2349} 2350 2351@Conference{ sermesant-etal:04, 2352 author = {J. Rexilius and S.K. Warfield and C.R.G. Guttmann and X. Wei and R. Benson and L. 2353 Wolfson and M. Shenton and H. Handels and R. Kikinis}, 2354 title = {A Novel Nonrigid Registration Algorithm And Applications}, 2355 booktitle = {Medical Image Computing and Computer-Assisted Intervention - MICCAI 2001}, 2356 address = {Philadelphia, PA, USA}, 2357 publisher = {Springer-Verlag}, 2358 editor = {Gee, J.C. and Maintz, J.B.A. and Vannier, M.W.}, 2359 series = {Lecture Notes in Computer Science}, 2360 volume = {2208}, 2361 pages = {923}, 2362 year = {2003}, 2363 url = {http://www.springerlink.com/app/home/contribution.asp?wasp=6pgwnvthup0amt7g9j4k&referrer=parent&backto=issue,105,251;journal,1191,1949;linkingpublicationresults,1:105633,1}, 2364 petsc_uses = {KSP} 2365} 2366 2367@Article{ warfield-haker-talos-05, 2368 author = {Simon K. Warfield and Steven J. Haker and Ion-Florin Talos and Corey A. Kemper 2369 and Neil Weisenfeld and Andrea U.J. Mewes and Daniel Goldberg-Zimring and Kelly H. 2370 Zou and Carl-Fredrik Westin and William M. Wells and Clare M.C. Tempany and 2371 Alexandra Golby and Peter M. Black and Ferenc A. Jolesz and Ron Kikinis}, 2372 title = {Capturing intraoperative deformations: research experience at {B}righam and {W}omen's 2373 hospital}, 2374 journal = {Medical Image Analysis}, 2375 url = {http://splweb.bwh.harvard.edu:8000/pages/papers/warfield/capturing-intraoperative-deformations-MIA2005.pdf}, 2376 year = {2005}, 2377 petsc_uses = {KSP} 2378} 2379 2380@Article{ brain3, 2381 author = {Simon K. Warfield and Florin Talos and Alida Tei and Arya Nabavi and Matthieu 2382 Ferrant and Peter McL. Black and Ferenc A. Jolesz and Ron Kikinis}, 2383 title = {Real-Time Registration of Volumetic Brain {MRI} by Biomechanical Simulation of 2384 Deformation during Image Guided Neurosurgery}, 2385 journal = {Computing and Visualization in Science}, 2386 url = {http://splweb.bwh.harvard.edu:8000/pages/ppl/warfield/papers/2002/warfield-2002-cvs-appeared.pdf}, 2387 year = {2002}, 2388 petsc_uses = {KSP} 2389} 2390 2391@Article{ brain2, 2392 author = {Matthieu Ferrant and Arya Nabavi and Benoit Macq and Ferenc A. Jolesz and Ron 2393 Kikinis and Simon K. Warfield}, 2394 title = {Registration of {3D} Intraoperative {MR} Images of the Brain using a Finite 2395 Element Biomechanical Model}, 2396 journal = {IEEE Transactions on Medical Imaging}, 2397 url = {http://splweb.bwh.harvard.edu:8000/pages/papers/ferrant/tmi2001.pdf}, 2398 year = {2001}, 2399 petsc_uses = {KSP} 2400} 2401 2402@InProceedings{ brain1, 2403 author = {Simon K. Warfield and Matthieu Ferrant and Xavier Gallez and Arya Nabavi and 2404 Ferenc A. Jolesz and Ron Kikinis}, 2405 title = {Real-Time Biomechanical Simulation of Volumetric Brain Deformation for Image 2406 Guided Neurosurgery}, 2407 booktitle = {Proceedings of SC2000}, 2408 url = {http://www.sc2000.org/techpapr/papers/pap.pap230.pdf}, 2409 year = {2000}, 2410 petsc_uses = {KSP} 2411} 2412 2413@Article{ vanne06, 2414 author = {V. Kolehmainen and A. Vanne and S. Siltanen and S. Jarvenpaa and J.P. Kaipio and 2415 M. Lassas and M. Kalke}, 2416 title = {Parallelized {B}ayesian inversion for three-dimensional dental {X}-ray imaging}, 2417 journal = {IEEE Transactions on Medical Imaging}, 2418 volume = {25}, 2419 number = {2}, 2420 month = feb, 2421 year = {2006}, 2422 pages = {218--228}, 2423 petsc_uses = {KSP} 2424} 2425 2426@InProceedings{ knepleybardhan2015, 2427 title = {Work/Precision Tradeoffs in Continuum Models of Biomolecular Electrostatics}, 2428 author = {Matthew G. Knepley and Jaydeep P. Bardhan}, 2429 booktitle = {Proceedings of ASME 2015 International Mechanical Engineering Congress \& 2430 Exposition}, 2431 volume = {9}, 2432 pages = {V009T12A04}, 2433 doi = {10.1115/IMECE2015-53579}, 2434 year = {2015}, 2435 petsc_uses = {KSP} 2436} 2437 2438@InProceedings{ bardhanknepley2015, 2439 title = {Multiscale models and approximation algorithms for protein electrostatics}, 2440 author = {Jaydeep P. Bardhan and Matthew G. Knepley}, 2441 booktitle = {Boundary Elements and Other Mesh Reduction Methods XXXVIII}, 2442 volume = {61}, 2443 pages = {163--174}, 2444 url = {http://www.witpress.com/Secure/elibrary/papers/BEM38/BEM38013FU1.pdf}, 2445 doi = {10.2495/BEM380131}, 2446 publisher = {WIT Press}, 2447 year = {2015}, 2448 petsc_uses = {KSP} 2449} 2450 2451% LiteralHTML: 2452% LiteralHTML: <a name="fusion"><H3><center>Fusion</center></H3> 2453% LiteralHTML: 2454@InProceedings{ adamsbrennanknepleywang2022, 2455 title = {{Landau} collision operator in the {CUDA} programming model applied to thermal 2456 quench plasmas}, 2457 author = {Mark. F. Adams and Dylan P. Brennan and Matthew G. Knepley and Peng Wang}, 2458 booktitle = {36th IEEE International Parallel \& Distributed Processing Symposium Conference 2459 (IPDPS '22)}, 2460 doi = {10.1109/IPDPS53621.2022.00020}, 2461 year = {2022}, 2462 petsc_uses = {DMPlex} 2463} 2464 2465@Misc{ adamsknepleybrennan2021, 2466 title = {Runaway Electron Generation with High-Performance, Structure Preserving 2467 Discretization of {F}okker--{P}lank--{L}andau}, 2468 author = {Mark F. Adams and Matthew G. Knepley and Dylan Brennan}, 2469 year = {2021}, 2470 petsc_uses = {KSP} 2471} 2472 2473@Article{ adamshirvijokiknepleybrownisaacmills2017, 2474 title = {{Landau} Collision Integral Solver with Adaptive Mesh Refinement on Emerging 2475 Architectures}, 2476 author = {Mark F. Adams and Eero Hirvijoki and Matthew G. Knepley and Jed Brown and Tobin 2477 Isaac and Richard Mills}, 2478 journal = {SIAM Journal on Scientific Computing}, 2479 volume = {39}, 2480 number = {6}, 2481 pages = {C452--C465}, 2482 doi = {10.1137/17M1118828}, 2483 eprint = {1702.08880}, 2484 year = {2017}, 2485 petsc_uses = {KSP} 2486} 2487 2488@Article{ pusztayknepleyadams2022, 2489 title = {Conservative Projection Between {FEM} and Particle Bases}, 2490 author = {Joseph V. Pusztay and Matthew G. Knepley and Mark F. Adams}, 2491 journal = {SIAM Journal on Scientific Computing}, 2492 volume = {44}, 2493 number = {4}, 2494 pages = {C310--C319}, 2495 doi = {10.1137/21M145407}, 2496 year = {2022} 2497} 2498 2499@Article{ hirvijoki2017, 2500 author = {Eero Hirvijoki and Mark F. Adams}, 2501 title = {Conservative discretization of the {Landau} collision integral}, 2502 journal = {Physics of Plasmas}, 2503 volume = {24}, 2504 number = {3}, 2505 pages = {032121}, 2506 doi = {10.1063/1.4979122}, 2507 year = {2017}, 2508 petsc_uses = {KSP} 2509} 2510 2511@Article{ mollenadamsknepleyhagerchang2021, 2512 title = {Implementation of higher-order velocity mapping between marker particles and grid 2513 in the particle-in-cell code {XGC}}, 2514 author = {Albert Moll\'en and Mark F. Adams and Matthew G. Knepley and Robert Hager and C. 2515 S. Chang}, 2516 journal = {Journal of Plasma Physics}, 2517 volume = {87}, 2518 number = {2}, 2519 pages = {905870229}, 2520 eprint = {2012.11764}, 2521 doi = {10.1017/S0022377821000441}, 2522 year = {2021}, 2523 petsc_uses = {KSP} 2524} 2525 2526@Article{ lsmh2014, 2527 author = {M. Landreman and H. M. Smith and A. Mollen and P. Helander}, 2528 title = {Comparison of particle trajectories and collision operators for collisional 2529 transport in nonaxisymmetric plasmas}, 2530 journal = { Physics of Plasmas}, 2531 volume = {21}, 2532 year = {2014}, 2533 petsc_uses = {KSP} 2534} 2535 2536@Article{ lpcep2014, 2537 author = {M. Landreman and F. I Parra and P. J. Catto and D. Ernst and I. Pusztai}, 2538 title = {Radially global delta-f computation of neoclassical phenomena in a tokamak 2539 pedestal}, 2540 journal = {Plasma Physics and Controlled Fusion}, 2541 volume = {56}, 2542 year = {2014}, 2543 petsc_uses = {KSP} 2544} 2545 2546@Article{ facets-scidac08, 2547 title = {First Results from Core-Edge Parallel Composition in the {FACETS} Project}, 2548 author = {J. Cary and J. Candy and R. Cohen and S. Krasheninnikov and D. McCune and D. 2549 Estep and J. Larson and A. Malony and A. Pankin and P. Worley and J. Carlsson and 2550 A. Hakim and P. Hamill and S. Kruger and M. Miah and S. Muzsala and A. Pletzer and 2551 S. Shasharina and D. Wade-Stein and N. Wang and S. Balay and L. McInnes and H. 2552 Zhang and T. Casper and L. Diachin and T. Epperly and T. Rognlien and M. Fahey and 2553 J. Cobb and A. Morris and S. Shende and G. Hammett and K. Indireshkumar and D. 2554 Stotler and A. Pigarov}, 2555 journal = {J. Phys.: Conf. Ser.}, 2556 volume = {125}, 2557 year = {2008}, 2558 pages = {012040}, 2559 url = {http://www.iop.org/EJ/abstract/1742-6596/125/1/012040}, 2560 petsc_uses = {KSP} 2561} 2562 2563@Article{ facets-scidac09, 2564 title = {Concurrent, Parallel, Multiphysics Coupling in the {FACETS} Project}, 2565 author = {J. Cary and J. Candy and J. Cobb and R. H. Cohen and T. Epperly and D. Estep and 2566 S. Krasheninnikov and A. Malony and D. McCune and L. McInnes and A. Pankin and S. 2567 Balay and J. Carlsson and M. R. Fahey and R. Groebner and A. Hakim and S. Kruger 2568 and M. Miah and A. Pletzer and S. Shasharina and S. Vadlamani and D. Wade-Stein 2569 and T. Rognlien and A. Morris and S. Shende and G. W. Hammett and K. Indireshkumar 2570 and A. Pigarov and H. Zhang}, 2571 journal = {J. Phys.: Conf. Ser.}, 2572 volume = {180}, 2573 year = {2009}, 2574 pages = {012056}, 2575 url = {http://iopscience.iop.org/1742-6596/180/1/012056}, 2576 petsc_uses = {KSP} 2577} 2578 2579@InProceedings{ facets-scidac10, 2580 title = {Coupled Whole Device Simulations of Plasma Transport in Tokamaks with the 2581 {FACETS} Code}, 2582 author = {A. Hakim and J. Cary and J. Candy and J. Cobb and R. Cohen and T. Epperly and D. 2583 Estep and S. Krasheninnikov and A. Malony and D McCune and L.C. McInnes and A. 2584 Pankin and S. Balay J. Carlsson and M. Fahey and R. Groebner and S. Kruger and M. 2585 Miah and A. Pletzer and S. Shasharina and S. Vadlamani and D. Wade-Stein and T. 2586 Rognlein and A. Morris and S. Shende and G. Hammett and K. Indareshkumar and A. 2587 Pigarov and H. Zhang}, 2588 booktitle = {Proceedings of SciDAC 2010 Conference}, 2589 year = {2010}, 2590 url = {http://computing.ornl.gov/workshops/scidac2010/papers/fusion_a_hakim.pdf}, 2591 petsc_uses = {KSP} 2592} 2593 2594@InProceedings{ facets-fec2010, 2595 title = {Concurrent, Parallel, Coupled Core-Edge Simulations of Pedestal Formation Using 2596 the {FACETS} Framework}, 2597 author = {J. Cary and A. Hakim and A. Pletzer and M. Miah and S. Kruger and S. Shasharina 2598 and S. Vadlamani and J. Carlsson and A. Pankin and T. Rognlien and R. Cohen and D. 2599 McCune and K. Indireshkumar and A. Pigarov and L.C. McInnes and H. Zhang}, 2600 booktitle = {Proceedings of the 23rd annual IAEA Fusion Energy Conference (FEC 2010), Daejon, 2601 Republic of Korea}, 2602 year = {2010}, 2603 petsc_uses = {KSP} 2604} 2605 2606@InProceedings{ facets-epdp2010, 2607 title = {{FACETS}: A Framework for Parallel Coupling of Fusion Components}, 2608 author = {J. Cary and A. Hakim and M. Miah and S. Kruger and A. Pletzer and S. Shasharina 2609 and S. Vadlamani and A. Pankin and R. Cohen and T. Epperly and T. Rognlien and R. 2610 Groebner and S. Balay and L. McInnes and H. Zhang}, 2611 booktitle = {Proceedings of Euromicro PDP 2010 (The 18th Euromicro International Conference on 2612 Parallel, Distributed and Network-Based Computing), Pisa, Italy}, 2613 year = {2010}, 2614 petsc_uses = {KSP} 2615} 2616 2617@Article{ carlssoncary09, 2618 author = {Johan Carlsson, John R. Cary}, 2619 title = {The hypersecant {J}acobian approximation for quasi-{N}ewton solves of sparse 2620 nonlinear systems}, 2621 journal = {arXiv}, 2622 year = {2009}, 2623 note = {http://arxiv.org/abs/0905.1054}, 2624 url = {http://arxiv.org/pdf/0905.1054v1}, 2625 petsc_uses = {KSP} 2626} 2627 2628@InProceedings{ oshahjs2006, 2629 author = {F. Ogando and A. Signell and J.A. Heikkinen and M. Aspn\"as and S. Henriksson and 2630 S.J. Janhunen and T.P. Kiviniemi}, 2631 title = {Performance enhancements to {ELMFIRE} gyrokinetic code leading to new ranges of 2632 application}, 2633 booktitle = {33rd EPS Conference on Plasma Phys.}, 2634 year = {2006}, 2635 url = {http://epsppd.epfl.ch/Roma/pdf/P4_153.pdf}, 2636 note = {European fusion code}, 2637 petsc_uses = {KSP} 2638} 2639 2640@Article{ zhu2006, 2641 author = {P. Zhu and A. Bhattacharjee and K. Germaschewski}, 2642 title = {Intermediate nonlinear evolution of the {P}arker instability: Formation of 2643 convection-induced discontinuities and absence of finite-time singularities}, 2644 journal = {Phys. Rev. Lett.}, 2645 volume = {96}, 2646 number = {065001}, 2647 year = {2006}, 2648 doi = {10.1103/PhysRevLett.96.065001}, 2649 petsc_uses = {KSP} 2650} 2651 2652@InProceedings{ ppc2005, 2653 author = {B. Philip and M. Pernice and L.Chacon}, 2654 title = {Solution of Reduced Resistive Magnetohydrodynamics using Implicit Adaptive Mesh 2655 Refinement}, 2656 booktitle = {Proceedings of the 16th International Conference on Domain Decomposition 2657 methods}, 2658 year = {2005}, 2659 lab = {LANL}, 2660 petsc_uses = {KSP} 2661} 2662 2663@Article{ pp2005, 2664 author = {M. Pernice and B. Philip}, 2665 title = {Solution of Equilibrium Radiation Diffusion Problems using Adaptive Mesh 2666 Refinement}, 2667 year = {2005}, 2668 journal = {SIAM J. of Sci. Comput.}, 2669 lab = {LANL}, 2670 petsc_uses = {KSP} 2671} 2672 2673@Article{ gt2004, 2674 author = {A. H. Glasser and X. Z. Tang}, 2675 title = {The {SEL} macroscopic modeling code}, 2676 year = {2004}, 2677 journal = {Computer Physics Communications}, 2678 pages = {237--243}, 2679 volume = {164}, 2680 lab = {LANL}, 2681 petsc_uses = {KSP} 2682} 2683 2684@Article{ nl2006, 2685 author = {Y. Nishimura and Z.Lin}, 2686 title = {A finite element mesh in a tokamak edge geometry}, 2687 year = {2006}, 2688 journal = {Contributions to Plasma Physics}, 2689 volume = {22}, 2690 lab = {PPPL}, 2691 petsc_uses = {KSP} 2692} 2693 2694@Article{ nlle2004, 2695 author = {Y. Nishimura and Z.Lin and J.Lewandowski and S.Ethier}, 2696 title = {A finite element {P}oisson solver for gyrokinetic particle simulations in a global 2697 field aligned mesh}, 2698 year = {2006}, 2699 journal = {J. Comput. Phys.}, 2700 volume = {214}, 2701 pages = {657}, 2702 lab = {PPPL}, 2703 petsc_uses = {KSP} 2704} 2705 2706@InProceedings{ lnlle2004, 2707 author = {J.L.V Lewandowski and Y.Nishimura and W.W.Lee and Z.Lin and S. Ethier}, 2708 title = {Global gyrokinetic Particle-in-cell Simulations with Trapped Electrons}, 2709 booktitle = {Sherwood Fusion Theory Conference, Missoula, MT}, 2710 year = {2004}, 2711 url = {http://www.sherwoodtheory.org/sherwood04/program/1e15.pdf}, 2712 lab = {PPPL}, 2713 petsc_uses = {KSP} 2714} 2715 2716@InProceedings{ nlclew2004, 2717 author = {Y. Nishimura and Z.Lin and L.Chen and J.Lewandowski and S.Ethier and W. Wang}, 2718 title = {Electromagnetic gyrokinetic simulation with a fluid-kinetic hybrid electron 2719 model}, 2720 booktitle = {Sherwood Fusion Theory Conference, Missoula, MT}, 2721 year = {2004}, 2722 url = {http://www.sherwoodtheory.org/sherwood04/program/1C32.pdf}, 2723 lab = {PPPL}, 2724 petsc_uses = {KSP} 2725} 2726 2727@Article{ tb1, 2728 author = {X.~Z.~Tang and A.~H.~Boozer}, 2729 title = {Numerical studies of a steady state axisymmetric co-axial helicity injection 2730 plasma}, 2731 journal = {Physics of Plasmas}, 2732 year = {2004}, 2733 pages = {171--185}, 2734 volume = {11}, 2735 lab = {LANL}, 2736 petsc_uses = {KSP} 2737} 2738 2739@Unpublished{ nlcw, 2740 title = {Inclusion of electromagnetic effects into gyrokinetic particle simulations}, 2741 author = {Y. Nishimura and Z.Lin and L.Chen and W. Wang}, 2742 note = {American Physical Society 45th Annual Meeting Division of Plasma Physics, 2743 Albuquerque, New Mexico, October 2003}, 2744 year = {2003}, 2745 petsc_uses = {KSP} 2746} 2747 2748@TechReport{ tang2001, 2749 author = {X. Z. Tang and G. Y. Fu and S. C. Jardin and L. L. Lowe and W. Park and H. R. 2750 Strauss}, 2751 title = {Resistive Magnetohydrodynamics Simulation of Fusion Plasmas}, 2752 year = {2001}, 2753 institution = {Princeton Plasma Physics Laboratory}, 2754 number = {PPPL-3532}, 2755 url = {http://www.pppl.gov/pub_report/2001/PPPL-3532.pdf}, 2756 note = {Presented at 10th Society for Industrial and Applied Mathematics (SIAM) 2757 Conference on Parallel Processing for Scientific Computing, Portsmouth, Virginia, 2758 March 12-14, 2001.}, 2759 lab = {PPPL}, 2760 petsc_uses = {KSP} 2761} 2762 2763% LiteralHTML: 2764% LiteralHTML: <a name="geosciences"><H3><center>Geosciences</center></H3> 2765% LiteralHTML: 2766@Article{ valerathomasgarciacastillo2019, 2767 author = {Manuel Valera and Mary P. Thomas and Mariangel Garcia and Jose E. Castillo}, 2768 title = {Parallel Implementation of a {PETSc-Based} Framework for the General Curvilinear 2769 Coastal Ocean Model}, 2770 journal = {Journal of Marine Science and Engineering}, 2771 volume = {7}, 2772 number = {6}, 2773 article-number= {185}, 2774 url = {https://www.mdpi.com/2077-1312/7/6/185}, 2775 issn = {2077-1312}, 2776 doi = {10.3390/jmse7060185}, 2777 year = {2019}, 2778 petsc_uses = {KSP} 2779} 2780 2781@Article{ furuichimat2015, 2782 title = {Implicit solution of the material transport in Stokes flow simulation: Toward 2783 thermal convection simulation surrounded by free surface}, 2784 author = {Mikito Furuichi and Dave A May}, 2785 journal = {Computer Physics Communications}, 2786 volume = {192}, 2787 pages = {1--11}, 2788 year = {2015}, 2789 petsc_uses = {KSP} 2790} 2791 2792@Article{ sharplesmoresivelicjadamecmay2016, 2793 title = {Simulating faults and plate boundaries with a transversely isotropic plasticity 2794 model}, 2795 author = {Wendy Sharples and Louis N Moresi and Mirko Velic and Margarete A Jadamec and 2796 Dave A May}, 2797 journal = {Physics of the Earth and Planetary Interiors}, 2798 volume = {252}, 2799 pages = {77--90}, 2800 year = {2016}, 2801 petsc_uses = {KSP} 2802} 2803 2804@Article{ spiegelmanmaywilson2016, 2805 title = {On the solvability of incompressible {S}tokes with viscoplastic rheologies in 2806 geodynamics}, 2807 author = {Marc Spiegelman and Dave A May and Cian R Wilson}, 2808 journal = {Geochemistry, Geophysics, Geosystems}, 2809 volume = {17}, 2810 number = {6}, 2811 pages = {2213--2238}, 2812 year = {2016}, 2813 petsc_uses = {KSP} 2814} 2815 2816@Article{ buiteretal2016, 2817 title = {Benchmarking numerical models of brittle thrust wedges}, 2818 author = {Susanne JH Buiter and Guido Schreurs and Markus Albertz and Taras V Gerya and 2819 Boris Kaus and Walter Landry and Laetitia {Le Pourhiet} and Yury Mishin and David 2820 L Egholm and Michele Cooke and Bertrand Maillot and Cedric Thieulot and Tony Crook 2821 and Dave May and Pauline Souloumiac and Christopher Beaumont}, 2822 journal = {Journal of structural geology}, 2823 volume = {92}, 2824 pages = {140--177}, 2825 year = {2016}, 2826 petsc_uses = {KSP} 2827} 2828 2829@Article{ afanasievboehmdrielkrischerrietmannmayknepleyfichtner2019, 2830 title = {Modular and flexible spectral-element waveform modelling in two and three 2831 dimensions}, 2832 author = {Michael Afanasiev and Christian Boehm and Martin van Driel and Lion Krischer and 2833 Max Rietmann and Dave A. May and Matthew G. Knepley and Andreas Fichtner}, 2834 journal = {Geophysical Journal International}, 2835 volume = {216}, 2836 number = {3}, 2837 pages = {1675--1692}, 2838 doi = {10.1093/gji/ggy469}, 2839 year = {2019}, 2840 petsc_uses = {KSP} 2841} 2842 2843@Article{ haplaknepleyafanasievboehmdrielkrischerfichtner2020, 2844 title = {Fully Parallel Mesh {I/O} using {PETSc} {DMPlex} with an Application to Waveform 2845 Modeling}, 2846 author = {Vaclav Hapla and Matthew G. Knepley and Michael Afanasiev and Christian Boehm and 2847 Martin van Driel and Lion Krischer and Andreas Fichtner}, 2848 journal = {SIAM Journal on Scientific Computing}, 2849 volume = {43}, 2850 number = {2}, 2851 pages = {C127--C153}, 2852 eprint = {http://arxiv.org/abs/2004.08729}, 2853 doi = {10.1137/20M1332748}, 2854 year = {2021}, 2855 petsc_uses = {KSP} 2856} 2857 2858@Article{ parsani2021, 2859 title = {High-order accurate entropy-stable discontinuous collocated {G}alerkin methods with 2860 the summation-by-parts property for compressible {CFD} frameworks: Scalable {SSDC} 2861 algorithms and flow solver}, 2862 author = {Matteo Parsani and Radouan Boukharfane and Irving Reyna Nolasco and David C. {Del 2863 Rey Fernández} and Stefano Zampini and Bilel Hadri and Lisandro Dalcin}, 2864 journal = {Journal of Computational Physics}, 2865 volume = {424}, 2866 pages = {109844}, 2867 issn = {0021-9991}, 2868 doi = {https://doi.org/10.1016/j.jcp.2020.109844}, 2869 url = {http://www.sciencedirect.com/science/article/pii/S0021999120306185}, 2870 year = {2021}, 2871 petsc_uses = {KSP} 2872} 2873 2874@Article{ ambartsumyanbouakaramthanhghattaskeyesstadlerturkiyyahzampini2020, 2875 title = {Hierarchical matrix approximations of {Hessians} arising in inverse problems 2876 governed by {PDEs}}, 2877 author = {I. Ambartsumyan and W. Bouakaram and Than Bui-Thanh and Omar Ghattas and David 2878 Keyes and Georg Stadler and George Turkiyyah and Stefano Zampini}, 2879 journal = {SIAM Journal of Scientific Computing}, 2880 volume = {42}, 2881 number = {5}, 2882 pages = {A3397--A3426}, 2883 year = {2020} 2884} 2885 2886@Article{ zampinibouakaramturkiyyahkniokeyes2022, 2887 title = {H2Opus: a distributed memory {multi-GPU} software for non-local operators}, 2888 author = {Stefano Zampini and W. Bouakaram and George Turkiyyah and O. Knio and David E. 2889 Keyes}, 2890 journal = {Advances on Computational Mathematics}, 2891 note = {In press}, 2892 year = {2022} 2893} 2894 2895@Article{ dassizampiniscacchi2022, 2896 title = {Robust and scalable adaptive {BDDC} preconditioners for virtual element 2897 discretizations of elliptic equations in mixed form}, 2898 author = {F. Dassi and Stefano Zampini and S. Scacchi}, 2899 journal = {Computer Methods in Applied Mechanics and Engineering}, 2900 volume = {391}, 2901 pages = {114620}, 2902 year = {2022} 2903} 2904 2905@Article{ youngoppenheimdimant2017, 2906 author = {Matthew A. Young and Meers M. Oppenheim and Yakov S. Dimant}, 2907 title = {Hybrid simulations of coupled {F}arley-{B}uneman/gradient drift instabilities in the 2908 equatorial E region ionosphere}, 2909 journal = {Journal of Geophysical Research: Space Physics}, 2910 volume = {122}, 2911 number = {5}, 2912 issn = {2169-9402}, 2913 doi = {10.1002/2017JA024161}, 2914 pages = {5768--5781}, 2915 year = {2017}, 2916 petsc_uses = {KSP} 2917} 2918 2919@Article{ rioussetpatylillisfillingimenglandwithershale2013, 2920 title = {Three-dimensional multifluid modeling of atmospheric electrodynamics in {M}ars' 2921 dynamo region}, 2922 author = {Jeremy A Riousset and Carol S Paty and Robert J Lillis and Matthew O Fillingim 2923 and Scott L England and Paul G Withers and John P M Hale}, 2924 journal = {Journal of Geophysical Research: Space Physics}, 2925 volume = {118}, 2926 number = {6}, 2927 pages = {3647--3659}, 2928 year = {2013}, 2929 publisher = {Wiley Online Library}, 2930 petsc_uses = {KSP} 2931} 2932 2933@Article{ chien2016representation, 2934 title = {Representation of topography by partial steps using the immersed boundary method 2935 in a vector vorticity equation model (VVM)}, 2936 author = {Chien, Mu-Hua and Wu, Chien-Ming}, 2937 journal = {Journal of Advances in Modeling Earth Systems}, 2938 year = {2016}, 2939 publisher = {Wiley Online Library}, 2940 petsc_uses = {KSP} 2941} 2942 2943@Article{ berger2015parallel, 2944 title = {Parallel preconditioners for monolithic solution of shear bands}, 2945 author = {Berger-Vergiat, Luc and McAuliffe, Colin and Waisman, Haim}, 2946 journal = {Journal of Computational Physics}, 2947 year = {2015}, 2948 publisher = {Elsevier}, 2949 petsc_uses = {KSP} 2950} 2951 2952@Article{ may2015496, 2953 title = {A scalable, matrix-free multigrid preconditioner for finite element 2954 discretizations of heterogeneous {S}tokes flow }, 2955 journal = {Computer Methods in Applied Mechanics and Engineering }, 2956 volume = {290}, 2957 number = {0}, 2958 pages = {496--523}, 2959 year = {2015}, 2960 issn = {0045-7825}, 2961 doi = {10.1016/j.cma.2015.03.014}, 2962 author = {D.A. May and J. Brown and L. {Le Pourhiet}}, 2963 petsc_uses = {KSP} 2964} 2965 2966@Article{ isaacknepley2017, 2967 title = {Support for Non-conformal Meshes in {PETSc}'s {DMPlex} Interface}, 2968 author = {Tobin Isaac and Matthew G. Knepley}, 2969 journal = {ArXiv e-prints}, 2970 eprint = {1508.02470}, 2971 year = {2017}, 2972 note = {\url{http://arxiv.org/abs/1508.02470}}, 2973 petsc_uses = {DMPlex} 2974} 2975 2976@Article{ knepleylangegorman2017, 2977 title = {Unstructured Overlapping Mesh Distribution in Parallel}, 2978 author = {Matthew G. Knepley and Michael Lange and Gerard J. Gorman}, 2979 journal = {ArXiv e-prints}, 2980 eprint = {1506.06194}, 2981 year = {2017}, 2982 note = {\url{http://arxiv.org/abs/1506.06194}}, 2983 petsc_uses = {DMPlex} 2984} 2985 2986@Article{ langemitchellknepleygorman2015, 2987 title = {Efficient mesh management in {Firedrake} using {PETSc-DMPlex}}, 2988 author = {Michael Lange and Lawrence Mitchell and Matthew G. Knepley and Gerard J. Gorman}, 2989 journal = {SIAM Journal on Scientific Computing}, 2990 volume = {38}, 2991 number = {5}, 2992 pages = {S143--S155}, 2993 eprint = {http://arxiv.org/abs/1506.07749}, 2994 doi = {10.1137/15M1026092}, 2995 year = {2016}, 2996 petsc_uses = {DMPlex} 2997} 2998 2999@InProceedings{ langeknepleygorman2015, 3000 title = {Flexible, Scalable Mesh and Data Management using {PETSc DMPlex}}, 3001 author = {Michael Lange and Matthew G. Knepley and Gerard J. Gorman}, 3002 booktitle = {Proceedings of the Exascale Applications and Software Conference}, 3003 month = apr, 3004 url = {http://www.easc2015.ed.ac.uk/sites/default/files/attachments/EASC15Proceedings.pdf}, 3005 year = {2015}, 3006 petsc_uses = {DMPlex} 3007} 3008 3009@InProceedings{ wallworkknepleybarralpiggott2022, 3010 title = {Parallel Metric-Based Mesh Adaptation in {PETSc} using {ParMmg}}, 3011 author = {Joseph G. Wallwork and Matthew G. Knepley and Nicolas Barral and Matthew D. 3012 Piggott}, 3013 booktitle = {SIAM International Meshing Roundtable Workshop 2022}, 3014 editor = {Trevor Robinson}, 3015 month = jan, 3016 address = {Seattle, WA}, 3017 pages = {1--5}, 3018 url = {http://imr.sandia.gov/papers/imr31/2026_imr31RJ_Wallwork.pdf}, 3019 year = {2022}, 3020 petsc_uses = {DMPlex} 3021} 3022 3023@InProceedings{ timalsinaknepley2023, 3024 title = {Tetrahedralization of a Hexahedral Mesh}, 3025 author = {Aman Timalsina and Matthew G. Knepley}, 3026 booktitle = {SIAM International Meshing Roundtable Workshop 2023}, 3027 year = {2023}, 3028 petsc_uses = {DMPlex} 3029} 3030 3031@Article{ farrellknepleywechsungmitchell2020, 3032 title = {{PCPATCH}: software for the topological construction of multigrid relaxation 3033 methods}, 3034 author = {Patrick E Farrell and Matthew G Knepley and Lawrence Mitchell and Florian 3035 Wechsung}, 3036 journal = {ACM Transaction on Mathematical Software}, 3037 eprint = {http://arxiv.org/abs/1912.08516}, 3038 volume = {47}, 3039 number = {3}, 3040 pages = {1--22}, 3041 issn = {0098-3500}, 3042 doi = {10.1145/3445791}, 3043 publisher = {Association for Computing Machinery}, 3044 issue_date = {September 2021}, 3045 year = {2021}, 3046 petsc_uses = {KSP,DMPlex} 3047} 3048 3049@Article{ laakmann2022augmented, 3050 title = {An augmented Lagrangian preconditioner for the magnetohydrodynamics equations at high Reynolds and coupling numbers}, 3051 author = {Fabian Laakmann and Patrick E Farrell and Lawrence Mitchell}, 3052 journal = {SIAM Journal on Scientific Computing}, 3053 volume = {44}, 3054 number = {4}, 3055 pages = {B1018--B1044}, 3056 year = {2022} 3057} 3058 3059@Article{ papadopoulosfarrellsurowiec2021, 3060 title = {Computing multiple solutions of topology optimization problems}, 3061 author = {Papadopoulos, Ioannis PA and Farrell, Patrick E and Surowiec, Thomas M}, 3062 journal = {SIAM Journal on Scientific Computing}, 3063 volume = {43}, 3064 number = {3}, 3065 pages = {A1555--A1582}, 3066 year = {2021} 3067} 3068 3069@Article{ jiangzhanghuschneiderzorinpanozzo2021, 3070 title = {Bijective and coarse high-order tetrahedral meshes}, 3071 author = {Jiang, Zhongshi and Zhang, Ziyi and Hu, Yixin and Schneider, Teseo and Zorin, Denis and Panozzo, Daniele}, 3072 journal = {ACM Transactions on Graphics (TOG)}, 3073 volume = {40}, 3074 number = {4}, 3075 pages = {1--16}, 3076 year = {2021} 3077} 3078 3079@Article{ abumaclachlanfarrell2023, 3080 title = {Monolithic multigrid for implicit {Runge--Kutta} discretizations of incompressible fluid flow}, 3081 author = {Abu-Labdeh, Razan and MacLachlan, Scott and Farrell, Patrick E}, 3082 journal = {Journal of Computational Physics}, 3083 volume = {478}, 3084 pages = {111961}, 3085 year = {2023} 3086} 3087 3088@Article{ farrellkirbymarchena2021, 3089 title = {{Irksome}: Automating {Runge--Kutta} time-stepping for finite element methods}, 3090 author = {Farrell, Patrick E and Kirby, Robert C and Marchena-Menendez, Jorge}, 3091 journal = {ACM Transactions on Mathematical Software (TOMS)}, 3092 volume = {47}, 3093 number = {4}, 3094 pages = {1--26}, 3095 year = {2021} 3096} 3097 3098@Article{ farrellgazca2020, 3099 title = {An augmented Lagrangian preconditioner for implicitly constituted non-Newtonian incompressible flow}, 3100 author = {Farrell, Patrick E and Gazca-Orozco, Pablo Alexei}, 3101 journal = {SIAM Journal on Scientific Computing}, 3102 volume = {42}, 3103 number = {6}, 3104 pages = {B1329--B1349}, 3105 year = {2020} 3106} 3107 3108@Article{ farrellmitchellscottwechsung2022, 3109 title = {Robust multigrid methods for nearly incompressible elasticity using macro elements}, 3110 author = {Farrell, Patrick E and Mitchell, Lawrence and Scott, L Ridgway and Wechsung, Florian}, 3111 journal = {IMA Journal of Numerical Analysis}, 3112 volume = {42}, 3113 number = {4}, 3114 pages = {3306--3329}, 3115 year = {2022} 3116} 3117 3118@Article{ shihstadlerwechsung2022, 3119 title = {Robust multigrid techniques for augmented Lagrangian preconditioning of incompressible Stokes equations with extreme viscosity variations}, 3120 author = {Shih, Yu-hsuan and Stadler, Georg and Wechsung, Florian}, 3121 journal = {SIAM Journal on Scientific Computing}, 3122 volume = {45}, 3123 number = {3}, 3124 pages = {S27--S53}, 3125 year = {2022} 3126} 3127 3128@Article{ adlerhehumaclachlanohm2022, 3129 title = {Monolithic multigrid for a reduced-quadrature discretization of poroelasticity}, 3130 author = {Adler, James H and He, Yunhui and Hu, Xiaozhe and MacLachlan, Scott and Ohm, Peter}, 3131 journal = {SIAM Journal on Scientific Computing}, 3132 volume = {45}, 3133 number = {3}, 3134 pages = {S54--S81}, 3135 year = {2022} 3136} 3137 3138@Article{ xiafarrellwechsung2021, 3139 title = {Augmented Lagrangian preconditioners for the Oseen--Frank model of nematic and cholesteric liquid crystals}, 3140 author = {Xia, Jingmin and Farrell, Patrick E and Wechsung, Florian}, 3141 journal = {BIT Numerical Mathematics}, 3142 volume = {61}, 3143 pages = {607--644}, 3144 year = {2021} 3145} 3146 3147@Article{ budisahukuchtamardalzikatanov2023, 3148 title = {Algebraic multigrid methods for metric-perturbed coupled problems}, 3149 author = {Budisa, Ana and Hu, Xiaozhe and Kuchta, Miroslav and Mardal, Kent-Andre and Zikatanov, Ludmil Tomov}, 3150 journal = {arXiv preprint arXiv:2305.06073}, 3151 year = {2023} 3152} 3153 3154@Article{ laakmannhufarrell2023, 3155 title = {Structure-preserving and helicity-conserving finite element approximations and preconditioning for the Hall MHD equations}, 3156 author = {Laakmann, Fabian and Hu, Kaibo and Farrell, Patrick E}, 3157 journal = {Journal of Computational Physics}, 3158 volume = {492}, 3159 pages = {112410}, 3160 year = {2023} 3161} 3162 3163@Article{ hongkrauskuchtalymberymardalrognes2022, 3164 title = {Robust approximation of generalized Biot-Brinkman problems}, 3165 author = {Hong, Qingguo and Kraus, Johannes and Kuchta, Miroslav and Lymbery, Maria and Mardal, Kent-Andr{\'e} and Rognes, Marie E}, 3166 journal = {Journal of Scientific Computing}, 3167 volume = {93}, 3168 number = {3}, 3169 pages = {77}, 3170 year = {2022} 3171} 3172 3173@Article{ boonkuchtamardalruiz2021, 3174 title = {Robust preconditioners for perturbed saddle-point problems and conservative discretizations of {Biot's} equations utilizing total pressure}, 3175 author = {Boon, Wietse M and Kuchta, Miroslav and Mardal, Kent-Andre and Ruiz-Baier, Ricardo}, 3176 journal = {SIAM Journal on Scientific Computing}, 3177 volume = {43}, 3178 number = {4}, 3179 pages = {B961--B983}, 3180 year = {2021} 3181} 3182 3183@Article{ papadopoulosfarrell2023, 3184 title = {Preconditioners for computing multiple solutions in three-dimensional fluid topology optimization}, 3185 author = {Papadopoulos, Ioannis PA and Farrell, Patrick E}, 3186 journal = {SIAM Journal on Scientific Computing}, 3187 volume = {45}, 3188 number = {6}, 3189 pages = {B853--B883}, 3190 year = {2023} 3191} 3192 3193@Article{ farrellhamdanmaclachlan2022, 3194 title = {A new mixed finite-element method for H2 elliptic problems}, 3195 author = {Farrell, Patrick E and Hamdan, Abdalaziz and MacLachlan, Scott P}, 3196 journal = {Computers \& Mathematics with Applications}, 3197 volume = {128}, 3198 pages = {300--319}, 3199 year = {2022} 3200} 3201 3202@Article{ harpertuminaro2023, 3203 title = {Compression and Reduced Representation Techniques for Patch-Based Relaxation}, 3204 author = {Harper, Graham and Tuminaro, Ray}, 3205 journal = {arXiv preprint arXiv:2306.10025}, 3206 year = {2023} 3207} 3208 3209@Article{ kirbykernell2021, 3210 title = {Preconditioning mixed finite elements for tide models}, 3211 author = {Kirby, Robert C and Kernell, Tate}, 3212 journal = {Computers \& Mathematics with Applications}, 3213 volume = {82}, 3214 pages = {212--227}, 3215 year = {2021} 3216} 3217 3218@Book{ xia2023, 3219 title = {Computing and Analysing Energy Minimisation Problems in Liquid Crystals: Implementation Using Firedrake}, 3220 author = {Xia, Jingmin}, 3221 year = {2023}, 3222 publisher = {World Scientific} 3223} 3224 3225@PhDThesis{ leveque2022, 3226 title = {Preconditioned iterative methods for optimal control problems with time-dependent PDEs as constraints}, 3227 author = {Leveque, Santolo}, 3228 school = {The University of Edinburgh}, 3229 year = {2022} 3230} 3231 3232@PhDThesis{ brubeck2022, 3233 title = {Optimal-complexity and robust multigrid methods for high-order FEM}, 3234 author = {Pablo D. Brubeck}, 3235 school = {Oxford University}, 3236 year = {2022} 3237} 3238 3239@Misc{ firedrakeproject, 3240 title = {{The {F}iredrake project}}, 3241 author = {David A Ham and Firedrake Team}, 3242 url = {http://firedrakeproject.org}, 3243 year = {2022}, 3244 petsc_uses = {KSP} 3245} 3246 3247@Article{ rathgeberhammitchelllangeluporinimcraeberceamarkallkelly2016, 3248 title = {Firedrake: automating the finite element method by composing abstractions}, 3249 author = {Florian Rathgeber and David A Ham and Lawrence Mitchell and Michael Lange and 3250 Fabio Luporini and Andrew TT McRae and Gheorghe-Teodor Bercea and Graham R Markall 3251 and Paul HJ Kelly}, 3252 journal = {ACM Transactions on Mathematical Software (TOMS)}, 3253 volume = {43}, 3254 number = {3}, 3255 pages = {24}, 3256 year = {2016}, 3257 petsc_uses = {KSP} 3258} 3259 3260@Article{ mitchellmuller2016, 3261 title = {High level implementation of geometric multigrid solvers for finite element 3262 problems: Applications in atmospheric modelling}, 3263 author = {Lawrence Mitchell and Eike Hermann M{\"u}ller}, 3264 journal = {Journal of Computational Physics}, 3265 volume = {327}, 3266 pages = {1--18}, 3267 year = {2016}, 3268 petsc_uses = {KSP} 3269} 3270 3271@Article{ mcraeberceamitchellhamcotter2016, 3272 title = {Automated generation and symbolic manipulation of tensor product finite 3273 elements}, 3274 author = {Andrew TT McRae and Gheorghe-Teodor Bercea and Lawrence Mitchell and David A Ham 3275 and Colin J Cotter}, 3276 journal = {SIAM Journal on Scientific Computing}, 3277 volume = {38}, 3278 number = {5}, 3279 pages = {S25--S47}, 3280 year = {2016}, 3281 petsc_uses = {KSP} 3282} 3283 3284@Article{ berceamcraehammitchellrathgebernardiluporinikelly2016, 3285 title = {A structure-exploiting numbering algorithm for finite elements on extruded 3286 meshes, and its performance evaluation in {Firedrake}}, 3287 author = {Gheorghe-Teodor Bercea and Andrew TT McRae and David A Ham and Lawrence Mitchell 3288 and Florian Rathgeber and L. Nardi and Fabio Luporini and Paul HJ Kelly}, 3289 journal = {Geoscientific Model Development}, 3290 volume = {9}, 3291 number = {10}, 3292 pages = {3803--3815}, 3293 doi = {10.5194/gmd-9-3803-2016}, 3294 year = {2016}, 3295 petsc_uses = {KSP} 3296} 3297 3298@InProceedings{ markallrathgebermitchellloriantbertollihamkelly2013, 3299 author = {Graham R. Markall and Florian Rathgeber and Lawrence Mitchell and Nicolas Loriant 3300 and Carlo Bertolli and David A. Ham and Paul HJ Kelly}, 3301 editor = {Julian Martin Kunkel and Thomas Ludwig and Hans Werner Meuer}, 3302 title = {Performance-Portable Finite Element Assembly Using {PyOP2} and {FEniCS}}, 3303 booktitle = {Proceedings of 28th International Supercomputing Conference, ISC 2013}, 3304 publisher = {Springer Berlin Heidelberg}, 3305 pages = {279--289}, 3306 isbn = {978-3-642-38750-0}, 3307 doi = {10.1007/978-3-642-38750-0_21}, 3308 year = {2013}, 3309 petsc_uses = {KSP} 3310} 3311 3312@Article{ kirbymitchell2017, 3313 title = {Solver composition across the {PDE}/linear algebra barrier}, 3314 author = {Robert C Kirby and Lawrence Mitchell}, 3315 journal = {arXiv preprint arXiv:1706.01346}, 3316 year = {2017}, 3317 petsc_uses = {KSP} 3318} 3319 3320@Article{ saibaba2012application, 3321 title = {Application of hierarchical matrices to linear inverse problems in 3322 geostatistics}, 3323 author = {Saibaba, Arvind Krishna and Ambikasaran, Sivaram and Yue Li, J and Kitanidis, 3324 Peter K and Darve, Eric F}, 3325 journal = {Oil and Gas Science and Technology-Revue de l'IFP-Institut Francais du Petrole}, 3326 volume = {67}, 3327 number = {5}, 3328 pages = {857}, 3329 year = {2012}, 3330 petsc_uses = {KSP} 3331} 3332 3333@Article{ collignonkausmayfernandez14, 3334 author = {Collignon, M. and Kaus, B. and May, D.A. and Fern\'andez, N.}, 3335 title = {Influences of surface processes on fold growth during {3-D} detachment folding}, 3336 journal = {Geochem Geophy Geosy}, 3337 year = {2014}, 3338 petsc_uses = {KSP} 3339} 3340 3341@Article{ fernandezkaus14, 3342 author = {Fern\'andez, N. and Kaus, B.}, 3343 title = {Fold interaction and wavelength selection in {3D} models of multilayer detachment 3344 folding}, 3345 journal = {Tectonophysics}, 3346 year = {2014}, 3347 petsc_uses = {KSP} 3348} 3349 3350@Article{ baumannkauspopov14, 3351 author = {Baumann, T. and Kaus, B. J. P. and Popov, A.}, 3352 title = {Constraining effective rheology through parallel joint geodynamic inversion}, 3353 journal = {Tectonophysics}, 3354 year = {2014}, 3355 petsc_uses = {KSP} 3356} 3357 3358@Article{ lechmannschmalholzhetenyimaykaus14, 3359 author = {Lechmann, S. M. and Schmalholz, S. M. and Hetenyi, G. and May, D. A. and Kaus, B. 3360 J. P.}, 3361 title = {Quantifying the impact of mechanical layering and underthrusting on the dynamics 3362 of the modern {India-Asia} collisional system with {3-D} numerical models}, 3363 journal = { Journal of Geophysical Research - Solid Earth}, 3364 year = {2014}, 3365 petsc_uses = {KSP} 3366} 3367 3368@InBook{ fernandezkaus14b, 3369 author = {Fern\'andez N. and Kaus B.J.P.}, 3370 title = {Analytical and numerical investigation of {3D} multilayer detachment}, 3371 booktitle = {Mathematics of Planet Earth}, 3372 editor = {Pardo-Ig\'uzquiza E. and Guardiola-Albert C. and Heredia J. and Moreno-Merino L. 3373 and Dur\'an J.J. and Vargas-Guzman J.A.}, 3374 publisher = {Springer}, 3375 year = {2014}, 3376 petsc_uses = {KSP} 3377} 3378 3379@Article{ hossein-hsueh-etal-2014a, 3380 author = {Hossein, M.Z. and Hsueh, C.-J. and Bourdin, B. and Bhattacharya, K.}, 3381 journal = {J. Mech. Phys. Solids}, 3382 pages = {320--348}, 3383 title = {Effective toughness of heterogeneous media}, 3384 volume = {71}, 3385 year = {2014}, 3386 petsc_uses = {KSP} 3387} 3388 3389@Unpublished{ leon-baldelli-bourdin-2014a, 3390 author = {Le\'{o}n Baldelli, A.A. and Bourdin, B.}, 3391 month = aug, 3392 note = {Submitted.}, 3393 title = {On the asymptotic derivation of Winkler-type energies from {3D} elasticity}, 3394 year = {2014}, 3395 petsc_uses = {KSP} 3396} 3397 3398@Article{ leon-baldelli-babadjian-etal-2013a, 3399 author = {Leòn-Baldelli, A. A. and Babadjian, J.-F. and Bourdin, B. and Henao, D. and 3400 Maurini, C.}, 3401 journal = {J. Mech. Phys. Solids}, 3402 pages = {15-32}, 3403 title = {A Variational Model For Fracture And Delamination Of Thin Films}, 3404 volume = {70}, 3405 year = {2014}, 3406 petsc_uses = {KSP} 3407} 3408 3409@Article{ mesgarnejad-bourdin-etal-2014a, 3410 author = {Mesgarnejad, A. and Bourdin, B. and Khonsari, M. M.}, 3411 journal = {Comp. Methods Appl. Mech. Engng.}, 3412 title = {Validation simulations for the variational approach to fracture}, 3413 volume = {Submitted}, 3414 year = {2014}, 3415 petsc_uses = {KSP} 3416} 3417 3418@InProceedings{ bourdin-chukwudozie-etal-2013a, 3419 author = {Bourdin, B. and Chukwudozie, C. and Yoshioka, K.}, 3420 booktitle = {Proceedings of the 38th Workshop on Geothermal Reservoir Engineering Stanford 3421 University, Stanford, CA}, 3422 title = {A Variational Approach To The Modeling And Numerical Simulation Of Hydraulic 3423 Fracturing Under In-Situ Stresses}, 3424 year = {2013}, 3425 petsc_uses = {KSP} 3426} 3427 3428@Article{ maurini-bourdin-etal-2012a, 3429 author = {Maurini, C. and Bourdin, B. and Gauthier, G. and Lazarus, V.}, 3430 journal = {Int. J. Fracture}, 3431 number = {1-2}, 3432 pages = {75-91}, 3433 title = {Crack patterns obtained by unidirectional drying of a colloidal suspension in a 3434 capillary tube: experiments and numerical simulations using a two-dimensional 3435 variational approach}, 3436 volume = {184}, 3437 year = {2013}, 3438 petsc_uses = {KSP} 3439} 3440 3441@Article{ mesgarnejad-bourdin-etal-2013a, 3442 author = {Mesgarnejad, A. and Bourdin, B. and Khonsari, M.M.}, 3443 journal = {J. Mech. Phys Solids}, 3444 number = {11}, 3445 pages = {2360--2379}, 3446 title = {A variational approach to the fracture of brittle thin films under out of plane 3447 loading}, 3448 volume = {61}, 3449 year = {2013}, 3450 petsc_uses = {KSP} 3451} 3452 3453@InProceedings{ bourdin-chukwudozie-etal-2012a, 3454 author = {Bourdin, B. and Chukwudozie, C. and Yoshioka, K.}, 3455 booktitle = {Proceedings of the 2012 SPE Annual Technical Conference and Exhibition}, 3456 title = {A Variational Approach to the Numerical Simulation of Hydraulic Fracturing}, 3457 volume = {SPE 159154}, 3458 year = {2012}, 3459 petsc_uses = {KSP} 3460} 3461 3462@Article{ millerdawsonfarthinghouhuangkeeskelleylangtangen13, 3463 author = {Cass T. Miller and Clint N. Dawson and Matthew W. Farthing and Thomas Y. Hou and 3464 Jingfang Huang and Christopher E. Kees and C.T. Kelley and Hans Petter 3465 Langtangen}, 3466 title = {Numerical simulation of water resources problems: Models, methods, and trends}, 3467 journal = {Advances in Water Resources}, 3468 volume = {51}, 3469 number = {0}, 3470 pages = {405--437}, 3471 year = {2013}, 3472 note = {35th Year Anniversary Issue}, 3473 issn = {0309-1708}, 3474 doi = {10.1016/j.advwatres.2012.05.008}, 3475 petsc_uses = {KSP} 3476} 3477 3478@Article{ scheltingamyerspietrzak10, 3479 author = {Terwisscha van Scheltinga, ArjenD. and Myers, PaulG. and Pietrzak, JulieD.}, 3480 title = {A finite element sea ice model of the {C}anadian Arctic Archipelago}, 3481 journal = {Ocean Dynamics}, 3482 volume = {60}, 3483 number = {6}, 3484 pages = {1539-1558}, 3485 year = {2010}, 3486 issn = {1616-7341}, 3487 doi = {10.1007/s10236-010-0356-5}, 3488 publisher = {Springer-Verlag}, 3489 keywords = {Ocean modelling; Unstructured meshes; Sea ice; Arctic Ocean; Canadian Arctic 3490 Archipelago; Freshwater flux}, 3491 language = {English}, 3492 petsc_uses = {KSP} 3493} 3494 3495@InBook{ destefanoandreasisecchi13, 3496 author = {M. De Stefano and F. Golfré Andreasi and A. Secchi}, 3497 title = {Towards preconditioned nonlinear conjugate gradients for generic geophysical 3498 inversions}, 3499 booktitle = {SEG Technical Program Expanded Abstracts 2013}, 3500 chapter = {626}, 3501 pages = {3226--3230}, 3502 doi = {10.1190/segam2013-0244.1}, 3503 url = {http://library.seg.org/doi/abs/10.1190/segam2013-0244.1}, 3504 eprint = {http://library.seg.org/doi/pdf/10.1190/segam2013-0244.1}, 3505 petsc_uses = {KSP} 3506} 3507 3508@Article{ pourhiethuetmaylabroussejolivet12, 3509 author = {L. {Le Pourhiet} and B. Huet and D. A. May and L. Labrousse and L. Jolivet}, 3510 title = {Kinematic interpretation of the {3D} shapes of metamorphic core complexes}, 3511 journal = {Geochem. Geophys. Geosyst.}, 3512 volume = {13}, 3513 pages = {Q09002}, 3514 year = {2012}, 3515 doi = {10.1029/2012GC004271}, 3516 petsc_uses = {KSP} 3517} 3518 3519@Article{ lechmannmaykausschmalholz11, 3520 author = {S. M. Lechmann and D. A. May and B. J. P. Kaus and S. M. Schmalholz}, 3521 title = {Comparing thin-sheet models with {3-D} multilayer models for continental 3522 collision}, 3523 journal = {Geophysical Journal International}, 3524 volume = {187}, 3525 pages = {10--33}, 3526 year = {2011}, 3527 doi = {10.1111/j.1365-246X.2011.05164.x}, 3528 petsc_uses = {KSP} 3529} 3530 3531@Article{ stefano:r69, 3532 author = {Michele De Stefano and Federico Golfr\'{e} Andreasi and Simone Re and Massimo 3533 Virgilio and Fred F. Snyder}, 3534 collaboration = {}, 3535 title = {Multiple-domain, simultaneous joint inversion of geophysical data with 3536 application to subsalt imaging}, 3537 publisher = {SEG}, 3538 year = {2011}, 3539 journal = {Geophysics}, 3540 volume = {76}, 3541 number = {3}, 3542 pages = {R69-R80}, 3543 keywords = {geophysical image processing; inverse problems; seismology}, 3544 doi = {10.1190/1.3554652}, 3545 petsc_uses = {KSP} 3546} 3547 3548@Article{ stefano:806, 3549 author = {Michele De Stefano}, 3550 collaboration = {}, 3551 title = {Simultaneous joint inversion for susceptibility and velocity}, 3552 publisher = {SEG}, 3553 year = {2011}, 3554 journal = {SEG Technical Program Expanded Abstracts}, 3555 volume = {30}, 3556 number = {1}, 3557 pages = {806-810}, 3558 keywords = {3D; imaging; inversion; magnetics; multiparameter}, 3559 doi = {10.1190/1.3628198}, 3560 petsc_uses = {KSP} 3561} 3562 3563@Article{ mayknepley2011, 3564 author = {Dave A. May and Matthew G. Knepley}, 3565 title = {Optimal, scalable forward models for computing gravity anomalies}, 3566 journal = {Geophysical Journal International}, 3567 volume = {187}, 3568 number = {1}, 3569 pages = {161--177}, 3570 url = {http://arxiv.org/abs/1107.5951}, 3571 note = {\url{http://arxiv.org/abs/1107.5951}}, 3572 year = {2011}, 3573 petsc_uses = {KSP} 3574} 3575 3576@InProceedings{ bourdinknepleymaurini2010, 3577 author = {Blaise Bourdin and Matthew G. Knepley and C. Maurini}, 3578 title = {Numerical Simulation of Reservoir Stimulation - A Variational Approach}, 3579 booktitle = {Proceedings of the 37th Stanford Geothermal Workshop}, 3580 url = {https://es.stanford.edu/ERE/pdf/IGAstandard/SGW/2011/bourdin.pdf}, 3581 note = {\url{https://es.stanford.edu/ERE/pdf/IGAstandard/SGW/2011/bourdin.pdf}}, 3582 address = {Stanford, CA}, 3583 year = {2010}, 3584 petsc_uses = {KSP} 3585} 3586 3587@InProceedings{ bourdinknepleymaurini2010b, 3588 author = {Blaise Bourdin and Matthew G. Knepley and C. Maurini}, 3589 title = {Secondary Thermal Cracks in {EGS}: a Variational Approach}, 3590 booktitle = {Proceedings of the 34th Annual Meeting of the Geothermal Resources Council}, 3591 url = {https://www.math.lsu.edu/~bourdin/Biography_assets/Bourdin-Knepley-Maurini-2010.pdf}, 3592 note = {\url{https://www.math.lsu.edu/~bourdin/Biography_assets/Bourdin-Knepley-Maurini-2010.pdf}}, 3593 address = {Sacramento, CA}, 3594 year = {2010}, 3595 petsc_uses = {KSP} 3596} 3597 3598@Article{ chen2007full, 3599 title = {Full {3D} tomography for the crustal structure of the {Los Angeles} region}, 3600 author = {Chen, P. and Zhao, L. and Jordan, T.H.}, 3601 journal = {Bulletin of the Seismological Society of America}, 3602 volume = {97}, 3603 number = {4}, 3604 pages = {1094}, 3605 year = {2007}, 3606 publisher = {Seismol Soc America}, 3607 petsc_uses = {KSP} 3608} 3609 3610@Article{ brown2010ens, 3611 author = {Brown, Jed}, 3612 affiliation = {Versuchsanstalt für Wasserbau, Hydrologie und Glaziologie (VAW), ETH Zürich, 3613 Zürich, Switzerland}, 3614 title = {Efficient Nonlinear Solvers for Nodal High-Order Finite Elements in {3D}}, 3615 journal = {Journal of Scientific Computing}, 3616 publisher = {Springer Netherlands}, 3617 issn = {0885-7474}, 3618 keyword = {Mathematics and Statistics}, 3619 pages = {48-63}, 3620 volume = {45}, 3621 issue = {1}, 3622 doi = {10.1007/s10915-010-9396-8}, 3623 year = {2010}, 3624 petsc_uses = {KSP} 3625} 3626 3627@PhDThesis{ brown2011, 3628 title = {Computational methods for ice flow simulation}, 3629 author = {Jed Brown}, 3630 school = {ETH Z{\"u}rich}, 3631 year = {2011}, 3632 petsc_uses = {KSP} 3633} 3634 3635@Article{ brown2013tmeice, 3636 title = {Achieving textbook multigrid efficiency for hydrostatic ice flow}, 3637 author = {Jed Brown and Barry F. Smith and Aron Ahmadia}, 3638 journal = {SIAM Journal on Scientific Computing}, 3639 volume = {35}, 3640 number = {2}, 3641 year = {2013}, 3642 pages = {359--375}, 3643 doi = {10.1137/110834512}, 3644 note = {Also preprint ANL/MCS-P743-1298}, 3645 petsc_uses = {KSP} 3646} 3647 3648@InProceedings{ brown2013quasinewton, 3649 author = {Jed Brown and Peter Brune}, 3650 title = {Low-rank quasi-{N}ewton updates for robust {J}acobian lagging in {N}ewton-type 3651 methods}, 3652 year = {2013}, 3653 booktitle = {International Conference on Mathematics and Computational Methods Applied to 3654 Nuclear Science and Engineering}, 3655 pages = {2554--2565}, 3656 petsc_uses = {KSP} 3657} 3658 3659@Misc{ spiegelman-siampp10, 3660 title = {Block Preconditioners and Advanced Software for Multiphysics Problems in Solid 3661 Earth Geodynamics}, 3662 author = {Marc Spiegelman}, 3663 note = {presentation at the 2010 SIAM Conference on Parallel Processing for Scientific 3664 Computing}, 3665 year = {2010}, 3666 petsc_uses = {KSP} 3667} 3668 3669@Article{ schauer2011a, 3670 author = {Marco Schauer and Sabine Langer and Jose E. Roman and Enrique S. 3671 Quintana-Ort\'{\i}}, 3672 title = {Large scale simulation of wave propagation in soils interacting with structures 3673 using {FEM} and {SBFEM}}, 3674 journal = {Journal of Computational Acoustics}, 3675 volume = {19}, 3676 number = {1}, 3677 pages = {75--93}, 3678 year = {2011}, 3679 doi = {10.1142/S0218396X11004316}, 3680 petsc_uses = {KSP} 3681} 3682 3683@Misc{ bsa2010, 3684 author = {J. Brown and B. Smith and A. Ahmadia}, 3685 title = {Achieving textbook multigrid efficiency for hydrostatic ice sheet flow}, 3686 note = {submitted to SIAM Journal on Scientific Computing}, 3687 year = {2012}, 3688 petsc_uses = {KSP} 3689} 3690 3691@Article{ kellerkatz2016, 3692 title = {The Role of Volatiles in Reactive Melt Transport in the Asthenosphere}, 3693 author = {Tobias Keller and Richard F. Katz}, 3694 journal = {Journal of Petrology}, 3695 doi = {10.1093/petrology/egw030}, 3696 url = {http://petrology.oxfordjournals.org/content/early/2016/07/15/petrology.egw030.abstract}, 3697 eprint = {http://petrology.oxfordjournals.org/content/early/2016/07/15/petrology.egw030.full.pdf+html}, 3698 year = {2016}, 3699 petsc_uses = {KSP} 3700} 3701 3702@Article{ weatherley12, 3703 author = {S. Weatherley and R.F. Katz}, 3704 title = {Melting and channelized magmatic flow in chemically heterogeneous, upwelling 3705 mantle}, 3706 journal = {Geochem.\ Geophys.\ Geosys.}, 3707 year = {2012}, 3708 volume = {13}, 3709 number = {1}, 3710 pages = {Q0AC18}, 3711 doi = {10.1029/2011GC003989}, 3712 petsc_uses = {KSP} 3713} 3714 3715@Article{ katz12, 3716 author = {R.F. Katz and S. Weatherley}, 3717 title = {Consequences of mantle heterogeneity for melt extraction at mid-ocean ridges}, 3718 journal = {Earth\ Planet.\ Sci.\ Lett.}, 3719 year = {2012}, 3720 doi = {10.1016/j.epsl.2012.04.042}, 3721 volume = {335-336}, 3722 pages = {226-237}, 3723 petsc_uses = {KSP} 3724} 3725 3726@Article{ katz10b, 3727 author = {R.F. Katz}, 3728 title = {Porosity-driven convection and asymmetry beneath mid-ocean ridges}, 3729 journal = {Geochem.\ Geophys.\ Geosys.}, 3730 volume = {10}, 3731 number = {Q0AC07}, 3732 year = {2010}, 3733 doi = {10.1029/2010GC003282}, 3734 petsc_uses = {KSP} 3735} 3736 3737@Article{ england10, 3738 author = {P.C. England and R.F. Katz}, 3739 title = {Melting above the anhydrous solidus controls the location of volcanic arcs}, 3740 journal = {Nature}, 3741 year = {2010}, 3742 volume = {467}, 3743 pages = {700--703}, 3744 doi = {10.1038/nature09417}, 3745 petsc_uses = {KSP} 3746} 3747 3748@Article{ weatherley10, 3749 author = {S. Weatherley and R.F. Katz}, 3750 title = {Plate-Driven Mantle Dynamics and Global Patterns of Mid-Ocean Ridge Bathymetry}, 3751 journal = {Geochem.\ Geophys.\ Geosys.}, 3752 year = {2010}, 3753 volume = {11}, 3754 number = {10}, 3755 doi = {10.1029/2010GC003192}, 3756 petsc_uses = {KSP} 3757} 3758 3759@Article{ katz10, 3760 author = {R.F. Katz and M.G. Worster}, 3761 title = {The stability of ice-sheet grounding lines}, 3762 journal = {Proc.~Roy.~Soc.~A}, 3763 year = {2010}, 3764 volume = {466}, 3765 pages = {1597--1620}, 3766 doi = {10.1098/rspa.2009.0434}, 3767 url = {http://www.earth.ox.ac.uk/~richardk/publications/Katz_Worster_PRSA10.pdf}, 3768 petsc_uses = {KSP} 3769} 3770 3771@Article{ kyrkesmith2013stress, 3772 title = {Stress balances of ice streams in a vertically integrated, higher-order 3773 formulation}, 3774 author = {Kyrke-Smith, T.M. and Katz, R.F. and Fowler, A.C.}, 3775 journal = {Journal of Glaciology}, 3776 volume = {59}, 3777 number = {215}, 3778 pages = {449--466}, 3779 year = {2013}, 3780 doi = {10.3189/2013JoG12J140}, 3781 petsc_uses = {KSP} 3782} 3783 3784@Article{ takei2013anisotropy1, 3785 author = {Takei Y. and R.F. Katz}, 3786 title = {{Consequences of viscous anisotropy in a deforming, two-phase aggregate: 1. 3787 Governing equations and linearised analysis}}, 3788 journal = {J.\ Fluid\ Mech.}, 3789 year = {2013}, 3790 volume = {734}, 3791 pages = {424-455}, 3792 doi = {10.1017/jfm.2013.482}, 3793 petsc_uses = {KSP} 3794} 3795 3796@Article{ katz2013anisotropy2, 3797 author = {Katz R.F. and Y. Takei}, 3798 title = {{Consequences of viscous anisotropy in a deforming, two-phase aggregate: 2. 3799 Numerical solutions of the full equations}}, 3800 journal = {J.\ Fluid\ Mech.}, 3801 year = {2013}, 3802 volume = {734}, 3803 pages = {456-485}, 3804 doi = {10.1017/jfm.2013.483}, 3805 petsc_uses = {KSP} 3806} 3807 3808@Article{ kyrke-smith2014subglacial, 3809 author = {Kyrke-Smith, T.M. and R.F. Katz and A.C. Fowler}, 3810 title = {Subglacial hydrology and the formation of ice streams}, 3811 journal = {Proc.\ Roy.\ Soc.\ A}, 3812 year = {2014}, 3813 volume = {470}, 3814 number = {2161}, 3815 doi = {10.1098/rspa.2013.0494}, 3816 petsc_uses = {KSP} 3817} 3818 3819@Article{ spiegelmanwilsonvankeken2013, 3820 author = {{Spiegelman}, M.~W. and {Wilson}, C.~R. and {Van Keken}, P.~E. }, 3821 title = {{TerraFERMA: The Transparent Finite Element Rapid Model Assembler for 3822 multi-physics problems in the solid Earth sciences}}, 3823 journal = {AGU Fall Meeting Abstracts}, 3824 keywords = {0560 COMPUTATIONAL GEOPHYSICS Numerical solutions, 1902 INFORMATICS Community 3825 modeling frameworks, 1906 INFORMATICS Computational models, algorithms}, 3826 year = {2013}, 3827 month = dec, 3828 pages = {A2208}, 3829 adsurl = {http://adsabs.harvard.edu/abs/2013AGUFMDI31A2208S}, 3830 adsnote = {Provided by the SAO/NASA Astrophysics Data System}, 3831 petsc_uses = {KSP} 3832} 3833 3834@Article{ bueler2009shallow, 3835 title = {{Shallow shelf approximation as a ``sliding law'' in a thermomechanically coupled 3836 ice sheet model}}, 3837 author = {Ed Bueler and Jed Brown}, 3838 journal = {Journal of Geophysical Research-Earth Surface}, 3839 volume = {114}, 3840 number = {F3}, 3841 pages = {F03008}, 3842 year = {2009}, 3843 publisher = {American Geophysical Union}, 3844 petsc_uses = {KSP} 3845} 3846 3847@Article{ bueler2007est, 3848 title = {{Exact solutions to the thermomechanically coupled shallow ice approximation: 3849 effective tools for verification}}, 3850 author = {Ed Bueler and Jed Brown and Craig Lingle}, 3851 journal = {J. Glaciol}, 3852 volume = {53}, 3853 pages = {499--516}, 3854 year = {2007}, 3855 petsc_uses = {KSP} 3856} 3857 3858@Article{ bueler2007fcv, 3859 title = {{Fast computation of a viscoelastic deformable Earth model for ice-sheet 3860 simulations}}, 3861 author = {Ed Bueler and Craig S. Lingle and Jed Brown}, 3862 journal = {Ann. Glaciol}, 3863 volume = {46}, 3864 pages = {97--105}, 3865 year = {2007}, 3866 petsc_uses = {KSP} 3867} 3868 3869@Article{ bueler2005iso, 3870 author = {Ed Bueler and Craig S. Lingle and Jed A. Kallen-Brown and David N. Covey and 3871 Latrice N. Bowman}, 3872 title = {Exact solutions and numerical verification for isothermal ice sheets}, 3873 journal = {J. Glaciol.}, 3874 volume = {51}, 3875 number = {173}, 3876 pages = {291--306}, 3877 year = {2005}, 3878 petsc_uses = {KSP} 3879} 3880 3881@Article{ chao2008programming, 3882 title = {{Programming on Numerical Simulation of Tsunami with PETSc and FEPG}}, 3883 author = {Chao-fan, Z. and Yao-lin, S.}, 3884 journal = {Earthquake}, 3885 year = {2008}, 3886 petsc_uses = {KSP} 3887} 3888 3889@Article{ marti2014, 3890 author = {Marti, P. and Schaeffer, N. and Hollerbach, R. and Cébron, D. and Nore, C. and 3891 Luddens, F. and Guermond, J.-L. and Aubert, J. and Takehiro, S. and Sasaki, Y. and 3892 Hayashi, Y.-Y. and Simitev, R. and Busse, F. and Vantieghem, S. and Jackson, A.}, 3893 title = {Full sphere hydrodynamic and dynamo benchmarks}, 3894 journal = {Geophysical Journal International}, 3895 year = {2014}, 3896 doi = {10.1093/gji/ggt518}, 3897 url = {http://gji.oxfordjournals.org/content/early/2014/01/26/gji.ggt518.abstract}, 3898 petsc_uses = {KSP} 3899} 3900 3901@InProceedings{ ganfulukyangxueyang2013, 3902 author = {Gan, Lin and Fu, Haohuan and Luk, Wayne and Yang, Chao and Xue, Wei and Yang, 3903 Guangwen}, 3904 title = {Global Atmospheric Simulation on a Reconfigurable Platform}, 3905 booktitle = {Proceedings of the 2013 IEEE 21st Annual International Symposium on 3906 Field-Programmable Custom Computing Machines}, 3907 series = {FCCM '13}, 3908 pages = {230--}, 3909 year = {2013}, 3910 isbn = {978-0-7695-4969-9}, 3911 doi = {10.1109/FCCM.2013.26}, 3912 acmid = {2495688}, 3913 publisher = {IEEE Computer Society}, 3914 petsc_uses = {KSP} 3915} 3916 3917@InProceedings{ ganfuchaolukxuemencerhuangyang2014, 3918 author = {Lin Gan and Haohuan Fu and Chao Yang and Luk, W. and Wei Xue and Mencer, O. and 3919 Xiaomeng Huang and Guangwen Yang}, 3920 booktitle = {Field Programmable Logic and Applications (FPL), 2014 24th International 3921 Conference on}, 3922 title = {A highly-efficient and green data flow engine for solving {E}uler atmospheric 3923 equations}, 3924 year = {2014}, 3925 month = sep, 3926 pages = {1-6}, 3927 doi = {10.1109/FPL.2014.6927462}, 3928 petsc_uses = {KSP} 3929} 3930 3931%Aagaard, B., Williams, C., Knepley, M. (2011). PyLith: A finite-element code for modeling quasi-static and dynamic crustal deformation (abstract), EarthScope National Meeting, Austin, Texas, May 17–20. 3932%Aagaard, B., Williams, C., and Knepley, M. (2011). PyLith: A finite-element code for modeling quasi-static and dynamic crustal deformation (abstract), Southern California Earthquake Center Annual Meeting, Palm Springs, California, September 11–14. 3933%Aagaard, B., Williams, C., and Knepley, M. (2012). PyLith: A Finite-Element Code for Modeling Quasi-Static and Dynamic Crustal Deformation (abstract), Seismological Society of America Annual Meeting, San Diego, California, April 17-19. 3934@Article{ aagaardknepleywilliams13, 3935 title = {A Domain Decomposition Approach to Implementing Fault Slip in Finite-Element 3936 Models of Quasi-static and Dynamic Crustal Deformation}, 3937 author = {Brad T. Aagaard and Matthew G. Knepley and Charles A. Williams}, 3938 journal = {Journal of Geophysical Research: Solid Earth}, 3939 volume = {118}, 3940 number = {6}, 3941 pages = {3059--3079}, 3942 issn = {2169-9356}, 3943 doi = {10.1002/jgrb.50217}, 3944 keywords = {fault slip, finite-element modeling, crustal deformation, earthquake physics}, 3945 year = {2013}, 3946 petsc_uses = {KSP} 3947} 3948 3949@InProceedings{ aagaardknepleywilliams11, 3950 author = {Charles A. Williams and Brad Aagaard and Matthew G. Knepley}, 3951 title = {{PyLith}: A Finite-Element Code for Modeling Quasi-Static and Dynamic Crustal 3952 Deformation}, 3953 booktitle = {Eos Transactions of the AGU}, 3954 organization = {American Geophysical Union}, 3955 note = {Fall Meeting Supplemental, Abstract DI14A-08}, 3956 year = {2011}, 3957 petsc_uses = {KSP} 3958} 3959 3960@InProceedings{ knepley10b, 3961 author = {Matthew G. {Knepley}}, 3962 title = {Acceleration of low order finite element computation with {GPUs} (Invited)}, 3963 booktitle = {Eos Transactions of the AGU}, 3964 organization = {American Geophysical Union}, 3965 note = {Fall Meeting Supplemental, Abstract IN44A-01}, 3966 year = {2010}, 3967 petsc_uses = {KSP} 3968} 3969 3970@InProceedings{ mayknepleygurnis09, 3971 author = {Dave A. May and Matthew G. Knepley and Michael Gurnis}, 3972 title = {{CitcomSX}: Robust preconditioning in {CitcomS} via {PETSc}}, 3973 booktitle = {Eos Transactions of the AGU}, 3974 organization = {American Geophysical Union}, 3975 note = {Fall Meeting Supplemental, Abstract P31A-A1241}, 3976 year = {2009}, 3977 petsc_uses = {KSP} 3978} 3979 3980@InProceedings{ yuenknepleyerlebacherwright09, 3981 author = {David A. Yuen and Matthew G. Knepley and Gordon Erlebacher and Grady B. Wright}, 3982 title = {The Coming Role of {GPU} in Computational Geodynamics}, 3983 booktitle = {Eos Transactions of the AGU}, 3984 organization = {American Geophysical Union}, 3985 note = {Fall Meeting Supplemental, Abstract DI22A-05}, 3986 year = {2009}, 3987 petsc_uses = {KSP} 3988} 3989 3990@InProceedings{ aagaardknepleywilliams08, 3991 author = {Brad Aagaard and Charles A. Williams and Matthew G. Knepley}, 3992 title = {{PyLith}: A Finite-Element Code for Modeling Quasi-Static and Dynamic Crustal 3993 Deformation}, 3994 booktitle = {Eos Transactions of the AGU}, 3995 organization = {American Geophysical Union}, 3996 volume = {89}, 3997 number = {53}, 3998 note = {Fall Meeting Supplemental, Abstract T41A-1925}, 3999 year = {2007}, 4000 petsc_uses = {KSP} 4001} 4002 4003@InProceedings{ aagaardknepleywilliams07, 4004 author = {Charles A. Williams and Brad Aagaard and Matthew G. Knepley}, 4005 title = {{PyLith}: A Finite-Element Code for Modeling Quasi-Static and Dynamic Crustal 4006 Deformation}, 4007 booktitle = {Eos Transactions of the AGU}, 4008 organization = {American Geophysical Union}, 4009 volume = {88}, 4010 number = {52}, 4011 note = {Fall Meeting Supplemental, Abstract T21B-1798}, 4012 year = {2007}, 4013 petsc_uses = {KSP} 4014} 4015 4016@InProceedings{ aagaardknepleywilliams05, 4017 author = {Charles A. Williams and Brad Aagaard and Matthew G. Knepley}, 4018 title = {Development of software for studying earthquakes across multiple spatial and 4019 temporal scales by coupling quasi-static and dynamic simulations}, 4020 booktitle = {Eos Transactions of the AGU}, 4021 organization = {American Geophysical Union}, 4022 volume = {86}, 4023 number = {52}, 4024 note = {Fall Meeting Supplemental, Abstract S53A-1072}, 4025 year = {2005}, 4026 petsc_uses = {KSP} 4027} 4028 4029@InProceedings{ williamsgablehagermeadeaagaardknepley08, 4030 author = {Charles A. Williams and Carl Gable and Bradford H. Hager and Brendan Meade and 4031 Brad Aagaard and Matthew G. Knepley}, 4032 title = {Modeling of Multiple Earthquake Cycles in {S}outhern {C}alifornia Using the {SCEC} 4033 Community Fault Model}, 4034 booktitle = {Proceedings of Geosciences '08}, 4035 address = {Wellington, NZ}, 4036 month = nov, 4037 year = {2008}, 4038 petsc_uses = {KSP} 4039} 4040 4041@TechReport{ zhang07, 4042 title = {Two New Approaches in Solving the Nonlinear Shallow Water Equations for 4043 Tsunamis}, 4044 author = {C. Zhang and M. G. Knepley and D. A. Yuen and Y. Shi}, 4045 type = {Preprint}, 4046 number = {ANL/MCS-P1459-0907}, 4047 institution = {ANL}, 4048 month = sep, 4049 year = {2007}, 4050 petsc_uses = {KSP} 4051} 4052 4053@Article{ katz08b, 4054 author = {Richard F. Katz}, 4055 title = {Magma dynamics with the enthalpy method: {B}enchmark solutions and magmatic 4056 focusing at mid-ocean ridges}, 4057 journal = {J. Petrology}, 4058 year = {2008}, 4059 volume = {49}, 4060 pages = {2099--2121}, 4061 doi = {10.1093/petrology/egn058}, 4062 petsc_uses = {KSP} 4063} 4064 4065@Article{ hgrhkjvv2008, 4066 title = {On preconditioning for a parallel solution of the {R}ichards equation}, 4067 author = {Michael Herbst and Swen Gottschalk and Martin Reissel and Horst Hardelauf and Roy 4068 Kasteel and Matthieu Javaux and Jan Vanderborght and Harry Vereeckena}, 4069 journal = {Computers and Geosciences}, 4070 volume = {34}, 4071 pages = {1958--1963}, 4072 year = {2008}, 4073 petsc_uses = {KSP} 4074} 4075 4076@Article{ maymoresi2008, 4077 title = {Preconditioned iterative methods for {Stokes} flow problems arising in 4078 computational geodynamics}, 4079 journal = {Physics of the Earth and Planetary Interiors}, 4080 volume = {171}, 4081 number = {1-4}, 4082 pages = {33--47}, 4083 year = {2008}, 4084 note = {{R}ecent Advances in Computational Geodynamics: Theory, Numerics and 4085 Applications}, 4086 issn = {0031-9201}, 4087 doi = {10.1016/j.pepi.2008.07.036}, 4088 author = {Dave A. May and Louis Moresi}, 4089 keywords = {Stokes flow, Krylov, Preconditioner, Schur complement, BFBt}, 4090 petsc_uses = {KSP} 4091} 4092 4093@Article{ kausmuhlhausmay2010, 4094 title = {A stabilization algorithm for geodynamic numerical simulations with a free 4095 surface}, 4096 author = {Boris JP Kaus and Hans M{\"u}hlhaus and Dave A May}, 4097 journal = {Physics of the Earth and Planetary Interiors}, 4098 volume = {181}, 4099 number = {1}, 4100 pages = {12--20}, 4101 year = {2010}, 4102 petsc_uses = {KSP} 4103} 4104 4105@Article{ duretzmaygeryatackley2011, 4106 title = {Discretization errors and free surface stabilization in the finite difference and 4107 marker-in-cell method for applied geodynamics: A numerical study}, 4108 author = {Thibault Duretz and David Alexander May and Taras V Gerya and Paul J Tackley}, 4109 journal = {Geochemistry, Geophysics, Geosystems}, 4110 volume = {12}, 4111 number = {7}, 4112 year = {2011}, 4113 petsc_uses = {KSP} 4114} 4115 4116@Article{ furuichimaytackley2011, 4117 title = {Development of a {Stokes} flow solver robust to large viscosity jumps using a 4118 {Schur} complement approach with mixed precision arithmetic}, 4119 author = {Mikito Furuichi and Dave A May and Paul J Tackley}, 4120 journal = {Journal of Computational Physics}, 4121 volume = {230}, 4122 number = {24}, 4123 pages = {8835--8851}, 4124 year = {2011}, 4125 petsc_uses = {KSP} 4126} 4127 4128@Article{ kellermaykaus2013, 4129 title = {Numerical modelling of magma dynamics coupled to tectonic deformation of 4130 lithosphere and crust}, 4131 author = {Tobias Keller and Dave A May and Boris JP Kaus}, 4132 journal = {Geophysical Journal International}, 4133 volume = {195}, 4134 number = {3}, 4135 pages = {1406--1442}, 4136 year = {2013}, 4137 petsc_uses = {KSP} 4138} 4139 4140@Article{ schellartfreemanstegmanmoresimay2007, 4141 title = {Evolution and diversity of subduction zones controlled by slab width}, 4142 author = {WP Schellart and Justin Freeman and David R Stegman and Louis Moresi and David A 4143 May}, 4144 journal = {Nature}, 4145 volume = {446}, 4146 number = {7133}, 4147 pages = {308--311}, 4148 year = {2007}, 4149 petsc_uses = {KSP} 4150} 4151 4152@Article{ cramerischmelinggolabekduretzorendtbuitermaykausgeryatackley2012, 4153 title = {A comparison of numerical surface topography calculations in geodynamic 4154 modelling: an evaluation of the sticky air method}, 4155 author = {F Crameri and H Schmeling and GJ Golabek and T Duretz and R Orendt and SJH Buiter 4156 and David A May and Boris JP Kaus and Taras V Gerya and Paul J Tackley}, 4157 journal = {Geophysical Journal International}, 4158 volume = {189}, 4159 number = {1}, 4160 pages = {38--54}, 4161 year = {2012}, 4162 petsc_uses = {KSP} 4163} 4164 4165@Article{ stegmanfreemanschellartmoresimay2006, 4166 title = {Influence of trench width on subduction hinge retreat rates in {3-D} models of slab 4167 rollback}, 4168 author = {David R Stegman and Justin Freeman and WP Schellart and Louis Moresi and David A 4169 May}, 4170 journal = {Geochemistry, Geophysics, Geosystems}, 4171 volume = {7}, 4172 number = {3}, 4173 year = {2006}, 4174 petsc_uses = {KSP} 4175} 4176 4177@InProceedings{ may2014ptatin, 4178 title = {{pTatin3D}: {H}igh-performance methods for long-term lithospheric dynamics}, 4179 author = {Dave A May and Jed Brown and Laetitia {Le Pourhiet}}, 4180 booktitle = {Proceedings of {SC14}: The {International Conference for High Performance 4181 Computing, Networking, Storage and Analysis}}, 4182 organization = {ACM}, 4183 pages = {274--284}, 4184 year = {2014}, 4185 doi = {10.1109/SC.2014.28}, 4186 petsc_uses = {KSP} 4187} 4188 4189@Article{ maybrownpourhiet2015, 4190 title = {A scalable, matrix-free multigrid preconditioner for finite element 4191 discretizations of heterogeneous {Stokes} flow}, 4192 author = {David A May and Jed Brown and Laetitia {Le Pourhiet}}, 4193 journal = {Computer Methods in Applied Mechanics and Engineering}, 4194 volume = {290}, 4195 pages = {496--523}, 4196 year = {2015}, 4197 doi = {10.1016/j.cma.2015.03.014}, 4198 petsc_uses = {KSP} 4199} 4200 4201@Article{ duretzmayyamato2016, 4202 title = {A free surface capturing discretization for the staggered grid finite difference 4203 scheme}, 4204 author = {Thibault Duretz and Dave A May and Philippe Yamato}, 4205 journal = {Geophysical Journal International}, 4206 volume = {204}, 4207 number = {3}, 4208 pages = {1518--1530}, 4209 year = {2016}, 4210 petsc_uses = {KSP} 4211} 4212 4213@Article{ rhebergenwellskatzwathen2014, 4214 author = {Sander Rhebergen and Garth N. Wells and Richard F. Katz and Andrew J. Wathen}, 4215 title = {Analysis of block-preconditioners for models of coupled magma/mantle dynamics}, 4216 journal = {SIAM J. Sci. Comput.}, 4217 volume = {36}, 4218 pages = {A1960--A1977}, 4219 year = {2014}, 4220 petsc_uses = {KSP} 4221} 4222 4223@Article{ katz08a, 4224 author = {R.F. Katz and M.G. Worster}, 4225 title = {Simulation of directional solidification, thermochemical convection, and chimney 4226 formation in a {H}ele-{S}haw cell}, 4227 journal = {J. Comp. Phys.}, 4228 volume = {227}, 4229 pages = {9823-9840}, 4230 year = {2008}, 4231 doi = {10.1016/j.jcp.2008.06.039}, 4232 petsc_uses = {KSP} 4233} 4234 4235@Article{ aabg2007, 4236 author = {A. Askan and V. Akcelik and J. Bielak and O. Ghattas}, 4237 title = {Full waveform inversion for seismic velocity and anelastic losses in 4238 heterogeneous structures}, 4239 journal = {Bulletin of Seismological Society of America}, 4240 year = {2007}, 4241 volume = {97}, 4242 pages = {1990--2008}, 4243 petsc_uses = {KSP} 4244} 4245 4246@Article{ katz2006, 4247 author = {Richard F. Katz and Marc Spiegelman and Benjamin Holtzman}, 4248 title = {The dynamics of melt and shear localization in partially molten aggregates}, 4249 journal = {Nature}, 4250 year = {2006}, 4251 volume = {442}, 4252 pages = {676--679}, 4253 month = aug, 4254 day = {10}, 4255 url = {http://www.nature.com/nature/journal/v442/n7103/abs/nature05039.html}, 4256 petsc_uses = {KSP} 4257} 4258 4259@InProceedings{ mqrs2003, 4260 author = {Roland Masson and Philippe Quandalle and Stephane Requena and Robert Scheichl}, 4261 year = {2003}, 4262 title = {Parallel Preconditioning for Sedimentary Basin Simulations}, 4263 booktitle = {Large-Scale Scientific Computing: 4th International Conference, LSSC 2003, 4264 Sozopol, Bulgaria, June 4-8, 2003}, 4265 petsc_uses = {KSP} 4266} 4267 4268@InProceedings{ lichtner1, 4269 author = {Chuan Lu and Peter C. Lichtner}, 4270 year = {2005}, 4271 title = {{PFLOTRAN}: Massively Parallel {3-D} Simulator for {CO2} Sequestration in 4272 Geologic Media}, 4273 booktitle = {Fourth Annual Conference on Carbon Capture and Sequestration DOE/NETL}, 4274 lab = {LANL}, 4275 petsc_uses = {KSP} 4276} 4277 4278@Article{ hammondlichtnermills2014, 4279 title = {Evaluating the Performance of Parallel Subsurface Simulators: An Illustrative 4280 Example with {PFLOTRAN}}, 4281 author = {Glenn E. Hammond and Peter C. Lichtner and Richard Tran Mills}, 4282 journal = {Water Resources Research}, 4283 volume = {50}, 4284 number = {1}, 4285 pages = {208--228}, 4286 doi = {10.1002/2012WR013483}, 4287 year = {2014}, 4288 petsc_uses = {KSP} 4289} 4290 4291@Article{ smw2003, 4292 author = {R. Scheichl and R. Masson and J. Wendebourg}, 4293 title = {Decoupling and Block Preconditioning for Sedimentary Basin Simulations}, 4294 journal = {Computational Geosciences}, 4295 year = {2003}, 4296 volume = {7}, 4297 pages = {295--318}, 4298 url = {http://www.maths.bath.ac.uk/MATHEMATICS/preprints.html}, 4299 petsc_uses = {KSP} 4300} 4301 4302@Article{ kees-miller-03, 4303 author = {C. E. Kees and C.T. Miller and E.W. Jenkins and C.T. Kelley}, 4304 title = {Versatile multilevel Schwarz preconditioners for multiphase flow}, 4305 journal = {Computational Geosciences}, 4306 year = {2003}, 4307 volume = {7}, 4308 pages = {91--114}, 4309 petsc_uses = {KSP} 4310} 4311 4312@Article{ bk2003, 4313 author = {JN Buur and T Kuehnel}, 4314 title = {Improving depth imaging by automated model updating}, 4315 journal = {The Leading Edge}, 4316 year = {2003}, 4317 volume = {22}, 4318 pages = {310-318}, 4319 petsc_uses = {KSP} 4320} 4321 4322@Article{ frederickbuffett2016, 4323 title = {Submarine groundwater discharge as a possible formation mechanism for 4324 permafrost-associated gas hydrate on the circum-Arctic continental shelf}, 4325 author = {Jennifer M. Frederick and Bruce A. Buffett}, 4326 journal = {Journal of Geophysical Research: Solid Earth}, 4327 volume = {121}, 4328 number = {3}, 4329 pages = {1383--1404}, 4330 issn = {2169-9356}, 4331 doi = {10.1002/2015JB012627}, 4332 year = {2016}, 4333 petsc_uses = {KSP} 4334} 4335 4336% LiteralHTML: <td width="100%" colspan="2"><hr size="4" color="#FF5B5B"> </td> 4337% LiteralHTML:<font color="#FF0000"> 4338% LiteralHTML:Simulation of the earth's mantle and crust is valuable to 4339% LiteralHTML:understanding earthquakes, volcanos, etc. PETSc has been used for a 4340% LiteralHTML:variety of these simulations.</p> 4341% LiteralHTML:</font> 4342% LiteralHTML: 4343@InProceedings{ appelbe1, 4344 author = {B. Appelbe and D. May and S. Quenette and S. Tang and F. Wang and L. Moresi}, 4345 year = {2003}, 4346 title = {Mantle convection modeling with viscoelastic/brittle lithosphere: Numerical and 4347 computational methodology}, 4348 page = {781}, 4349 booktitle = {Lecture Notes in Computer Science, volume 2659, part of the ICCS Conference 4350 Proceedings}, 4351 publisher = {Springer-Verlag}, 4352 url = {http://vpac.org/VDT/SNARK/Presentations/RD0201-paper-20030602-ICCS03_ACES03_LNCS-mantle_convection_modelling.pdf}, 4353 petsc_uses = {KSP} 4354} 4355 4356% LiteralHTML:<a name="katz"> 4357@InProceedings{ gd1, 4358 author = {Guillaume Dumont and Michel Kern}, 4359 title = {Parallelization of a {3D} Seismic Migration Code with {PETSc}}, 4360 year = {1999}, 4361 booktitle = {Proceedings of the Ninth SIAM Conference on Parallel Processing for Scientific 4362 Computing}, 4363 petsc_uses = {KSP} 4364} 4365 4366% LiteralHTML: <center><img alt="" src="images/katz1.jpg"> <img alt="" src="images/katz3.jpg"> 4367% LiteralHTML: <img alt="" src="images/katz2.jpg"></center></p> 4368% LiteralHTML:<font color="#FF0000"> 4369% LiteralHTML: Figures from the work of Richard Katz 4370@PhDThesis{ katzthesis, 4371 author = {R.F. Katz}, 4372 title = {The deep roots of volcanoes: models of magma dynamics with applications to 4373 subduction zones}, 4374 school = {Columbia University}, 4375 year = {2005}, 4376 url = {http://www.ldeo.columbia.edu/\~{ }katz/thesis/Katz_Dissertation_Columbia05.pdf}, 4377 petsc_uses = {KSP} 4378} 4379 4380@InCollection{ knepleykatzsmith06, 4381 author = {Knepley, Matthew G. and Katz, Richard F. and Smith, Barry}, 4382 affiliation = {Argonne National Laboratory Mathematics and Computer Science Division Argonne IL 4383 USA}, 4384 title = {Developing a Geodynamics Simulator with {PETSc}}, 4385 booktitle = {Numerical Solution of Partial Differential Equations on Parallel Computers}, 4386 series = {Lecture Notes in Computational Science and Engineering}, 4387 editor = {Bruaset, Are Magnus and Tveito, Aslak}, 4388 publisher = {Springer Berlin Heidelberg}, 4389 isbn = {978-3-540-31619-0}, 4390 keyword = {Mathematics and Statistics}, 4391 pages = {413-438}, 4392 volume = {51}, 4393 doi = {10.1007/3-540-31619-1_12}, 4394 year = {2006}, 4395 petsc_uses = {KSP} 4396} 4397 4398@Article{ katz04, 4399 author = {Richard F. Katz and Marc Spiegelman and S.M. Carbotte}, 4400 title = {Ridge migration, asthenospheric flow and the origin of magmatic segmentation in 4401 the global mid-ocean ridge system}, 4402 journal = {Geophys.\ Res.\ Letts.}, 4403 year = {2004}, 4404 volume = {31}, 4405 pages = {L15605}, 4406 petsc_uses = {KSP} 4407} 4408 4409@Article{ katz07, 4410 author = {Richard F. Katz and Matthew G. Knepley and Barry Smith and Marc Spiegelman and 4411 Ethan Coon}, 4412 title = {Numerical simulation of geodynamic processes with the {Portable Extensible 4413 Toolkit for Scientific Computation}}, 4414 journal = {Phys. Earth Planet. In.}, 4415 volume = {163}, 4416 pages = {52--68}, 4417 year = {2007}, 4418 petsc_uses = {KSP} 4419} 4420 4421@Article{ williams2006development, 4422 title = {{Development of a package for modeling stress in the lithosphere}}, 4423 author = {Williams, CA}, 4424 journal = {Eos Trans. AGU}, 4425 volume = {87}, 4426 pages = {36}, 4427 year = {2006}, 4428 petsc_uses = {KSP} 4429} 4430 4431@Article{ goverswortel05, 4432 author = {R. Govers and M.J.R. Wortel}, 4433 title = {Lithosphere tearing at STEP faults: response to edges of subduction zones}, 4434 journal = {Earth and Planetary Science Letters}, 4435 volume = {236/1-2}, 4436 pages = {505-523}, 4437 year = {2005}, 4438 petsc_uses = {KSP} 4439} 4440 4441@InProceedings{ snark2, 4442 author = {B. Appelbe and D. May and S. Quenette and S. Tang and F. Wang and L. Moresi}, 4443 year = {2002}, 4444 title = {Towards Rapid Geoscience Model Development - The {Snark} Project}, 4445 booktitle = {Proceedings of 3rd ACES (APEC Cooperation for Earthquake Simulation) Workshop}, 4446 petsc_uses = {KSP} 4447} 4448 4449@Article{ snark1, 4450 author = {Bill Appelbe and David May and Louis Moresi and Steve Quenette and Siew-Chiang 4451 Tan and Feng Wang}, 4452 title = {Snark - A Reusable Framwork for Geoscience Computational Models}, 4453 journal = {Submitted to Pure and Applied Geosciences}, 4454 petsc_uses = {KSP} 4455} 4456 4457@InProceedings{ earthquake2003, 4458 author = {Volkan Akcelik and Jacobo Bielak and George Biros and Ioannis Epanomeritakis and 4459 Antonio Fernandez and Omar Ghattas and Eui Joong Kim and David O'Hallaron and 4460 Tiankai Tu}, 4461 year = {2003}, 4462 title = {High Resolution Forward and Inverse Earthquake Modeling on Terascale Computers}, 4463 booktitle = {Proceedings of SC2003}, 4464 note = {A winner of the Gordon Bell Prize for special achievement at SC2003}, 4465 petsc_uses = {KSP} 4466} 4467 4468@InProceedings{ stefano12, 4469 author = {Michele De Stefano}, 4470 title = {Simultaneous Joint Inversion of Refraction Tomography and Magnetic Data}, 4471 booktitle = {PIERS Proceedings}, 4472 month = aug, 4473 address = {Moscow, RUSSIA}, 4474 pages = {491--495}, 4475 year = {2012}, 4476 petsc_uses = {KSP} 4477} 4478 4479%http://www.piers.org/piersproceedings/download.php?file=cGllcnMyMDEyTW9zY293fDJBN18wNDkxLnBkZnwxMjAzMTUwNDE2MDY= 4480 4481% LiteralHTML: <td width="100%" colspan="2"><hr size="4" color="#FF5B5B"> </td> 4482% LiteralHTML: <center><img alt="" 4483% LiteralHTML: src="images/ocean.jpg"></center></p> 4484@Article{ khatiwala07, 4485 author = {Khatiwala, S.}, 4486 title = {A computational framework for simulation of biogeochemical tracers in the ocean}, 4487 journal = {Glob. Biogeochem. Cycles}, 4488 volume = {21}, 4489 doi = {10.1029/2007GB002923}, 4490 year = {2007}, 4491 url = { http://www.ldeo.columbia.edu/\~{ }spk/Papers/KhatiwalaMatrixBiogeochemGBC07.pdf} 4492} 4493 4494@Article{ dks2004, 4495 author = {Sergey Danilov, Gennady Kivman and Jens Schroeter}, 4496 journal = {Ocean Modelling}, 4497 year = {2004}, 4498 volume = {6(2)}, 4499 pages = {125-150}, 4500 title = {A finite-element Ocean Model: Principles and Evaluation}, 4501 url = {http://www.sciencedirect.com/science?_ob=IssueURL&_tockey=%23TOC%236214%232004%23999939997%231%23FLA%23Volume_6,_Issue_2,_Pages_101-190_(2004)&_auth=y&view=c&_acct=C000007278&_version=1&_urlVersion=0&_userid=97338&md5=c3a50a31c599d8d38c8ce1f29117f267}, 4502 petsc_uses = {KSP} 4503} 4504 4505@Article{ danilov1, 4506 author = {S. Danilov and G. Kivman and J. Schroter}, 4507 year = {2004}, 4508 title = {Evaluation of an eddy-permitting finite-element ocean model in the {N}orth 4509 {A}tlantic}, 4510 journal = {Ocean Modelling}, 4511 petsc_uses = {KSP} 4512} 4513 4514@Article{ nerger1, 4515 author = {L. Nerger and S. Danilov and G. Kivman and W. Hiller and J. Schroter}, 4516 year = {2004}, 4517 title = {Data Assimilation with the Ensemble {K}alman Filter and the {SEIK} Filter applied to 4518 a Finite Element Model of the {N}orth {A}tlantic}, 4519 journal = {Journal of marine systems}, 4520 petsc_uses = {KSP} 4521} 4522 4523@Conference{ rakowsky2003self, 4524 title = {{A self-adaptive finite element model of the atmosphere}}, 4525 author = {Rakowsky, N. and Frickenhaus, S. and Hiller, W. and L{\\"a}uter, M. and Handorf, 4526 D. and Dethloff, K. and Zwieflhofer, W. and Kreitz, N.}, 4527 booktitle = {Realizing teracomputing: proceedings of the tenth ECMWF Workshop on the Use of 4528 High Performance Computing in Meteorology: Reading, UK, 4-8 November, 2002}, 4529 pages = {279}, 4530 isbn = {981238376X}, 4531 year = {2003}, 4532 organization = {World Scientific Pub Co}, 4533 petsc_uses = {KSP} 4534} 4535 4536@Article{ lauter3, 4537 author = {M. Lauter}, 4538 year = {2004}, 4539 title = {GrossrAumige Zirkulationsstrukturen in einem nichtlinearen adaptiven 4540 AtmosphArenmodell}, 4541 journal = {Berichte zur Polar- und Meeresforschung}, 4542 petsc_uses = {KSP} 4543} 4544 4545@Article{ lauter2, 4546 author = {M. Lauter and D. Handorf and K. Dethloff}, 4547 year = {2004}, 4548 title = {Unsteady analytical solutions of the spherical shallow water equations}, 4549 journal = {Journal of computational physics}, 4550 petsc_uses = {KSP} 4551} 4552 4553@PhDThesis{ lauter1, 4554 author = {M. Lauter}, 4555 year = {2004}, 4556 title = {GrossAumige Zirkulationsstrukturen in einem nichtlinearen adaptiven 4557 AtmosphArenmodell}, 4558 institution = {UniversitAt Potsdam, 134 P., UniversitAt Potsdam}, 4559 petsc_uses = {KSP} 4560} 4561 4562@Article{ frickenhaus1, 4563 author = {S. Frickenhaus and W. Hiller and M. Best}, 4564 year = {2005}, 4565 title = {FoSSI : The Family of Simplified Solver Interfaces for the rapid development of 4566 parallel numerical atmosphere and ocean models}, 4567 journal = {Ocean Modelling}, 4568 volume = {10}, 4569 pages = {185--191}, 4570 petsc_uses = {KSP} 4571} 4572 4573@Article{ 0266-5611-24-3-034015, 4574 author = {I Epanomeritakis and V Ak\c{c}elik and O Ghattas and J Bielak}, 4575 title = {A {N}ewton-{CG} method for large-scale three-dimensional elastic full-waveform 4576 seismic inversion}, 4577 journal = {Inverse Problems}, 4578 volume = {24}, 4579 number = {3}, 4580 pages = {034015 (26pp)}, 4581 url = {http://stacks.iop.org/0266-5611/24/034015}, 4582 year = {2008}, 4583 abstract = {We present a nonlinear optimization method for large-scale 3D elastic 4584 full-waveform seismic inversion. The method combines outer Gauss-Newton nonlinear 4585 iterations with inner conjugate gradient linear iterations, globalized by an 4586 Armijo backtracking line search, solved on a sequence of finer grids and higher 4587 frequencies to remain in the vicinity of the global optimum, inexactly terminated 4588 to prevent oversolving, preconditioned by L-BFGS/Frankel, regularized by a total 4589 variation operator to capture sharp interfaces, finely discretized by finite 4590 elements in the Lam\'{e} parameter space to provide flexibility and avoid bias, 4591 implemented in matrix-free fashion with adjoint-based computation of reduced 4592 gradient and reduced Hessian-vector products, checkpointed to avoid full spacetime 4593 waveform storage, and partitioned spatially across processors to parallelize the 4594 solutions of the forward and adjoint wave equations and the evaluation of 4595 gradient-like information. Several numerical examples demonstrate the grid 4596 independence of linear and nonlinear iterations, the effectiveness of the 4597 preconditioner, the ability to solve inverse problems with up to 17 million 4598 inversion parameters on up to 2048 processors, the effectiveness of multiscale 4599 continuation in keeping iterates in the basin of attraction of the global minimum, 4600 and the ability to fit the observational data while reconstructing the model with 4601 reasonable resolution and capturing sharp interfaces.}, 4602 petsc_uses = {KSP} 4603} 4604 4605% LiteralHTML: 4606% LiteralHTML: <a name="environmental"><H3><center>Environmental -- Subsurface Flow</center></H3> 4607% LiteralHTML: 4608% LiteralHTML: <td width="100%" colspan="2"><hr size="4" color="#FF5B5B"> </td> 4609% LiteralHTML:<font color="#FF0000"> 4610% LiteralHTML:Modeling surface flow of water is valuable for both flood control and 4611% LiteralHTML:agricultural and environmental reasons. For example, regenerating the 4612% LiteralHTML:Florida Everglades requires extensive understanding of the surface water 4613% LiteralHTML:characteristics over thousands of square miles. PETSc has been used 4614% LiteralHTML:for a variety of these simulations.</p> 4615% LiteralHTML:</font> 4616% LiteralHTML: 4617@Article{ mills2009modeling, 4618 title = {Modeling subsurface reactive flows using leadership-class computing}, 4619 author = {Mills, R.T. and Hammond, G.E. and Lichtner, P.C. and Sripathi, V. and 4620 Mahinthakumar, G.K. and Smith, B.F.}, 4621 journal = {Journal of Physics: Conference Series}, 4622 volume = {180}, 4623 pages = {012062}, 4624 year = {2009}, 4625 publisher = {IOP Publishing}, 4626 petsc_uses = {KSP} 4627} 4628 4629@Conference{ mills2007simulating, 4630 title = {{Simulating subsurface flow and transport on ultrascale computers using 4631 PFLOTRAN}}, 4632 author = {Mills, R.T. and Lu, C. and Lichtner, P.C. and Hammond, G.E.}, 4633 booktitle = {Journal of Physics: Conference Series}, 4634 volume = {78}, 4635 pages = {012051}, 4636 year = {2007}, 4637 organization = {IOP Publishing}, 4638 petsc_uses = {KSP} 4639} 4640 4641@InProceedings{ mills2009, 4642 title = {Modeling subsurface reactive flows using leadership-class computing}, 4643 author = {Mills, R.T. and Hammond, G.E. and Lichtner, P.C. and Sripathi, V. and 4644 Mahinthakmuar, G. and Smith, B.}, 4645 booktitle = {Journal of Physics: Conference Series}, 4646 volume = {180}, 4647 pages = {102062}, 4648 year = {2009}, 4649 organization = {IOP Publishing}, 4650 petsc_uses = {KSP} 4651} 4652 4653@Article{ guo2013parallel, 4654 title = {A parallel, fully coupled, fully implicit solution to reactive transport in 4655 porous media using the preconditioned {J}acobian-{F}ree {N}ewton-{K}rylov Method 4656 }, 4657 journal = {Advances in Water Resources }, 4658 volume = {53}, 4659 number = {0}, 4660 pages = {101 - 108}, 4661 year = {2013}, 4662 note = {}, 4663 issn = {0309-1708}, 4664 doi = {10.1016/j.advwatres.2012.10.010}, 4665 author = {Luanjing Guo and Hai Huang and Derek R. Gaston and Cody J. Permann and David 4666 Andrs and George D. Redden and Chuan Lu and Don T. Fox and Yoshiko Fujita}, 4667 keywords = {Reactive transport, Jacobian-Free Newton-Krylov, Physics-based block 4668 preconditioner}, 4669 petsc_uses = {KSP} 4670} 4671 4672@Unpublished{ stomp, 4673 title = {STOMP (Subsurface Transport Over Multiple Phases) webpage}, 4674 url = {http://stomp.pnl.gov/}, 4675 petsc_uses = {KSP} 4676} 4677 4678@InProceedings{ htfc2003, 4679 author = {L. Hluchy and V.D. Tran and D.Froehlich and W.Castaings}, 4680 title = {Methods and Experiences For Parallelizing Flood Models}, 4681 year = {2003}, 4682 booktitle = {Recent Advances in Parallel Virtual Machine and Message Passing Interface: 10th 4683 European PVM/MPI User's Group Meeting}, 4684 note = {Springer Lecture Notes in Computer Science, Volume 2840}, 4685 url = {http://www.springerlink.com/app/home/contribution.asp?wasp=2e9afcba8f614cd9a6f94a5294d1cbb0&referrer=parent&backto=issue,93,95;journal,588,1972;linkingpublicationresults,1:105633,1}, 4686 petsc_uses = {KSP} 4687} 4688 4689@InProceedings{ hulchy-tran-astalos-fmsip, 4690 author = {L. Hluchy and V.D. Tran and J. Astalos and M. Dobrucky and G. T. Nguyen and 4691 D.Froehlich}, 4692 title = {Flood Modeling System and Its Parallelization}, 4693 year = {2002}, 4694 booktitle = {Proceedings of the International Conference on Parallel Computing in Electrical 4695 Engineering}, 4696 url = {http://portal.acm.org/citation.cfm?id=824476.825951}, 4697 petsc_uses = {KSP} 4698} 4699 4700@InProceedings{ gy1, 4701 author = {J. P. Gwo and G. T. Yeh}, 4702 title = {High-Performance Simulation of Surface-Subsurface Coupled Flow and Reactive 4703 Transport at Watershed Scale}, 4704 year = {2004}, 4705 booktitle = {The International Conference on Computational Methods}, 4706 url = {http://www.sfwmd.gov/org/era/uncertainty_wkshp/GwoYeh.pdf}, 4707 petsc_uses = {KSP} 4708} 4709 4710@Conference{ cheng2009efficient, 4711 title = {{An efficient parallel method for large-scale groundwater flow equation based on 4712 PETSc}}, 4713 author = {Cheng, T. and Ji, X. and Wang, Q.}, 4714 booktitle = {Information, Computing and Telecommunication, 2009. YC-ICT'09. IEEE Youth 4715 Conference on}, 4716 pages = {190--193}, 4717 organization = {IEEE}, 4718 petsc_uses = {KSP} 4719} 4720 4721@Unpublished{ sfrsm, 4722 title = {The South Florida Regional Simulation Model and Hydrologic Simulation Engine}, 4723 url = {http://www.sfwmd.gov/org/pld/hsm/cerp_pres/hse_num.pdf}, 4724 note = {Simulates overland, groundwater and canal flows for south Florida. Uses PETSc for 4725 its linear solves}, 4726 petsc_uses = {KSP} 4727} 4728 4729% LiteralHTML: <td width="100%" colspan="2"><hr size="4" color="#FF5B5B"> </td> 4730@InProceedings{ bart_omar:sc05, 4731 author = {Volkan Ak{\c c}elik and George Biros and Andrei Dr{\u{a}}g{\u{a}}nescu and Omar 4732 Ghattas and Judith~C. Hill and Gart~G. van Bloemen Waanders}, 4733 title = {Dynamic data driven inversion for terascale simulations: real-time 4734 indentification of airborne contaminants}, 4735 booktitle = {Proceedings of SC2005}, 4736 organization = {IEEE/ACM}, 4737 address = {Seattle, WA}, 4738 year = {2005}, 4739 month = nov, 4740 url = {http://www.cs.cmu.edu/\~{ }oghattas/papers/sc05-inverse.pdf}, 4741 lab = {SNL}, 4742 petsc_uses = {KSP} 4743} 4744 4745@InProceedings{ anton-krassimir-lscc, 4746 author = {Anton Antonov and Krassimir Georgiev and Emilia Komsalova and Zahari Zlatev}, 4747 title = {Comparison of Two Local Refinement Methods for Large Scale Air Pollution 4748 Simulations}, 4749 booktitle = {Large-Scale Scientific Computing: 4th International Conference, LSSC 2003}, 4750 volume = {2907}, 4751 year = {2003}, 4752 publisher = {Springer-Verlag}, 4753 url = {http://www.springerlink.com/app/home/contribution.asp?wasp=65dfaebc36f6453d9120b8f9f86fecc5&referrer=parent&backto=issue,32,55;journal,618,2072;linkingpublicationresults,1:105633,1}, 4754 petsc_uses = {KSP} 4755} 4756 4757@InProceedings{ aa2001, 4758 author = {Anton Antonov}, 4759 title = {Object-Oriented Framework for Large Scale Air Pollution Modeling}, 4760 year = {2001}, 4761 booktitle = {Large-Scale Scientific Computing : Third International Conference, LSSC 2001, 4762 Sozopol, Bulgaria}, 4763 note = {Springer Lecture Notes in Computer Science, Volume 2179}, 4764 url = {http://www.springerlink.com/app/home/contribution.asp?wasp=3699c48fdb764bc7a3aa0539c7bf9f1d&referrer=parent&backto=issue,25,52;journal,1243,1972;linkingpublicationresults,1:105633,1}, 4765 petsc_uses = {KSP} 4766} 4767 4768% LiteralHTML: <td width="100%" colspan="2"><hr size="4" color="#FF5B5B"> </td> 4769@Article{ grassley-simmons-kercher-00, 4770 author = {William E. Glassley and Ardyth M. Simmons and James R. Kercher}, 4771 year = {2000}, 4772 title = {Mineralogical heterogeneity in fractured, porous media and its representation in 4773 reactive transport models}, 4774 journal = {Applied Geochemistry}, 4775 volume = {17}, 4776 pages = {699--708}, 4777 lab = {LLNL} 4778} 4779 4780@Article{ glassey-nitao-03, 4781 author = {William E. Glassley and John J. Nitao and Charles W. Grant and James W. Johnson 4782 and Carl I. Steefel and James R. Kercher}, 4783 year = {2003}, 4784 title = {The impact of climate change on vadose zone pore waters and its implication for 4785 long-term monitoring}, 4786 journal = {Computers and Geosciences}, 4787 volume = {29}, 4788 pages = {399-411}, 4789 lab = {LLNL}, 4790 petsc_uses = {KSP} 4791} 4792 4793@Article{ steefel-depaolo-lichtner-05, 4794 author = {Carl I. Steefel and Donald J. DePaolo and Peter C. Lichtner}, 4795 year = {2005}, 4796 title = {Reactive transport modeling: An essential tool and a new research approach for 4797 the Earth sciences}, 4798 journal = {Earth and Planetary Science Letters}, 4799 lab = {LLNL,LANL}, 4800 petsc_uses = {KSP} 4801} 4802 4803% LiteralHTML:<a name="scalinglarge"> 4804% LiteralHTML: <td width="100%" colspan="2"><hr size="4" color="#FF5B5B"> </td> 4805% LiteralHTML: <center><img alt="" 4806% LiteralHTML: src="images/scalinglarge.jpg"></center></p> 4807% LiteralHTML:<font color="#FF0000"> 4808% LiteralHTML: Sample <strong>strong scaling</strong> for the LANL PFLOTRAN flow and geochemical transport suite. (Courtesy of Richard Mills, ORNL) 4809@InProceedings{ kongstognergastonpetersonpermannslaughtermartineau2018, 4810 title = {A General-Purpose Hierarchical Mesh Partitioning Method with Node Balancing 4811 Strategies for Large-Scale Numerical Simulations}, 4812 author = {Fande Kong and Roy H. Stogner and Derek R. Gaston and John W. Peterson and Cody 4813 J. Permann and Andrew E. Slaughter and Richard C. Martineau}, 4814 booktitle = {2018 IEEE/ACM 9th Workshop on Latest Advances in Scalable Algorithms for 4815 Large-Scale Systems (scalA)}, 4816 pages = {65-72}, 4817 doi = {10.1109/ScalA.2018.00012}, 4818 month = nov, 4819 year = {2018}, 4820 petsc_uses = {KSP} 4821} 4822 4823@Article{ km2004, 4824 author = {A. Keese and H. G. Matthies}, 4825 journal = {Computers and Structures}, 4826 year = {2005}, 4827 volume = {83}, 4828 pages = {1033--1047}, 4829 title = {Hierarchical parallelisation for the solution of stochastic finite element 4830 equations}, 4831 url = {http://www.sciencedirect.com/science?_ob=ArticleURL&_udi=B6V28-4FPDPWM-1&_user=1722207&_rdoc=1&_fmt=&_orig=search&_sort=d&_docanchor=&view=c&_acct=C000053990&_version=1&_urlVersion=0&_userid=1722207&md5=89d48cd6fd5e80989372246d8dda400f}, 4832 petsc_uses = {KSP} 4833} 4834 4835@Unpublished{ hvl2002, 4836 title = {Numerical Modeling of {NAPL} Source Zone Treatment}, 4837 author = {Hammond, G.E., A.J. Valocchi and P.C. Lichtner}, 4838 note = {Poster at American Geophysical Union Fall 2002 Meeting, San Francisco, CA.}, 4839 url = {http://cee.uiuc.edu/transport/hammond/agu_2002.pdf}, 4840 year = {2002}, 4841 lab = {LANL}, 4842 petsc_uses = {KSP} 4843} 4844 4845@PhDThesis{ hammond2003, 4846 author = {Glenn E. Hammond}, 4847 title = {Innovative Methods for Solving Multicomponent Biogeochemical Groundwater 4848 Transport on Supercomputers}, 4849 school = {University of Illinois at Urbana-Champaign}, 4850 year = {2003}, 4851 url = {http://cee.uiuc.edu/transport/hammond/dissertation.pdf}, 4852 petsc_uses = {KSP} 4853} 4854 4855@Unpublished{ uk, 4856 title = {Parallel Least-Squares Finite Element Method for Large Eddy Simulation of Large 4857 Scale Environmental Flows and Transport Processes}, 4858 url = {http://es.epa.gov/ncer/progress/grants/96/high/tsang99.html}, 4859 note = {EPA funded work to simulate turbulent dispersion of toxic chemicals around 4860 buildings and in Green Bay. Used PETSc for its linear solvers}, 4861 year = {1999}, 4862 petsc_uses = {KSP} 4863} 4864 4865@InProceedings{ hammond2002, 4866 author = {Glenn E. Hammond and Albert J. Valocchi and Peter C. Lichtner}, 4867 title = {Modeling Multicomponent Reactive Transport on Parallel Computers Using 4868 {J}acobian-Free {N}ewton {K}rylov with Operator-Split Preconditioners}, 4869 year = {2002}, 4870 url = {http://www.cee.uiuc.edu/transport/publications/hammond/CMWR_2002.pdf}, 4871 booktitle = {Proceedings of the XIV International Conference on Computational Methods in Water 4872 Resources, Delft, The Netherlands.}, 4873 lab = {LANL}, 4874 petsc_uses = {KSP} 4875} 4876 4877@TechReport{ steefel1, 4878 author = {C. I. Steefel}, 4879 title = {Software for modeling multicomponent, multidimensional reactive transport}, 4880 year = {2001}, 4881 institution = {Lawrence Livermore National Laboratory}, 4882 number = {UCRL-MA-143182}, 4883 lab = {LLNL}, 4884 petsc_uses = {KSP} 4885} 4886 4887@Article{ steefel2, 4888 author = {C. I. Steefel and A. C. Lasaga}, 4889 title = {A coupled model for transport of multiple chemical-species and kinetic 4890 precipitation dissolution reactions with application to reactive flow in 4891 single-phase hydrothermal systems}, 4892 journal = {Americal Journal of Science}, 4893 year = {1994}, 4894 pages = {529-592}, 4895 volume = {294}, 4896 number = {5}, 4897 petsc_uses = {KSP} 4898} 4899 4900@TechReport{ steefel3, 4901 author = {C. I. Steefel and S. B. Yabusaki}, 4902 title = {{OS3D/GIMRT}, Software for Multicomponent-Multidimensional reactive transport: 4903 User's manual and programmer's guide}, 4904 year = {1996}, 4905 institution = {Pacific Northwest National Laboratory}, 4906 number = {PNNL-11166}, 4907 lab = {PNNL}, 4908 petsc_uses = {KSP} 4909} 4910 4911@Article{ 2005hvl, 4912 author = {G. E. Hammond and A.J. Valocchi and P.C. Lichtner}, 4913 title = {Application of {J}acobian-free {N}ewton-{K}rylov with physics-based 4914 preconditioning to biogeochemical transport}, 4915 journal = {Advances in Water Resources}, 4916 year = {2005}, 4917 pages = {359--376}, 4918 volume = {28}, 4919 url = { 4920 http://www.sciencedirect.com/science?_ob=IssueURL&_tockey=%23TOC%235953%232005%23999719995%23576651%23FLA%23Volume_28,_Issue_4,_Pages_315-427_(April_2005)&_auth=y&view=c&_acct=C000059129&_version=1&_urlVersion=0&_userid=2914253&md5=0d485527443c6192356cc508e1621002}, 4921 lab = {LANL}, 4922 petsc_uses = {KSP} 4923} 4924 4925@Article{ wang-zabar-05, 4926 author = {J Wang and N Zabaras}, 4927 journal = {Int. J. Heat and Mass Transfer}, 4928 title = {A Markov random field model of contamination source identification in porous 4929 media flow}, 4930 year = {2005}, 4931 petsc_uses = {KSP} 4932} 4933 4934@InBook{ kp1, 4935 author = {Jong G. Kim and Hyoung W. Park}, 4936 chapter = {Advanced Simulation Technique for Modeling Multiphase Fluid Flow in Porous 4937 Media}, 4938 url = {http://www.springerlink.com/app/home/contribution.asp?wasp=m5uc84pqrh1qrg8clyuh&referrer=parent&backto=issue,1,117;journal,206,1787;linkingpublicationresults,1:105633,1}, 4939 title = {Lecture Notes in Computer Science}, 4940 publisher = {Springer-Verlag}, 4941 volume = {3044}, 4942 year = {2004}, 4943 petsc_uses = {KSP} 4944} 4945 4946@Article{ 2001agusm...h32a06k, 4947 author = {{Kim}, J.~G. and {Kim}, J.}, 4948 title = {Parallel Implementation of Finite Element Groundwater Flow Model}, 4949 journal = {AGU Spring Meeting Abstracts}, 4950 year = {2001}, 4951 pages = {32-+}, 4952 petsc_uses = {KSP} 4953} 4954 4955@Article{ lzb2005, 4956 author = {A. M. Wasantha Lal and Randy Van Zee and Mark Belnap}, 4957 title = {CASE STUDY: A MODEL TO SIMULATE REGIONAL FLOW IN SOUTH FLORIDA}, 4958 journal = {Journal of Hydraulic Engineering}, 4959 year = {2005}, 4960 volume = {131}, 4961 number = {4}, 4962 pages = {247--258}, 4963 petsc_uses = {KSP} 4964} 4965 4966@Article{ rao2005, 4967 author = {Prasada Rao}, 4968 title = {A parallel {RMA2} model for simulating large-scale free surface flows}, 4969 journal = {Environmental Modelling and Software}, 4970 year = {2005}, 4971 pages = {47--53}, 4972 petsc_uses = {KSP} 4973} 4974 4975@InProceedings{ pr1, 4976 author = {Prasada Rao}, 4977 title = {An Efficient Scalable Finite Element Model for Simulating Large Scale 4978 Hydrodynamic Flows}, 4979 year = {2003}, 4980 booktitle = {Proceedings of the American Society of Civil Engineers 16th Engineering Mechanics 4981 Conference}, 4982 url = {http://www.ce.washington.edu/em03/proceedings/papers/477.pdf}, 4983 petsc_uses = {KSP} 4984} 4985 4986@InProceedings{ lichtner2004, 4987 author = {Peter C. Lichtner and Andrew Wolfsberg}, 4988 title = {Modeling Thermal-Hydrological-Chemical ({THC}) Coupled Processes with 4989 Applications to Underground Nuclear Tests at the Nevada Test Site; A Grand 4990 Challenge Supercomputing Problem}, 4991 year = {2004}, 4992 booktitle = {MPU Workshop: Conceptual Model Development for Subsurface Reactive Transport 4993 Modeling of Inorganic Contaminants, Radionuclides and Nutrients}, 4994 note = {Also Los Alamos National Laboratory report: LA-UR-04-1826}, 4995 lab = {LANL}, 4996 petsc_uses = {KSP} 4997} 4998 4999% LiteralHTML: <td width="100%" colspan="2"><hr size="4" color="#FF5B5B"> </td> 5000@Article{ aba01:petsc-app, 5001 author = {Jason Abate and Peng Wang and Kamy Sepehrnoori}, 5002 title = {Parallel Compositional Reservior Simulation on Clusters of {PC}s}, 5003 journal = {Int. J. High Performance Computing Applications}, 5004 year = {2001}, 5005 volume = {15}, 5006 number = {1}, 5007 pages = {13--21}, 5008 petsc_uses = {KSP} 5009} 5010 5011@PhDThesis{ tjb200, 5012 author = {Thomas James Byer}, 5013 title = {Preconditioned Newton Methods for Simulation of Reservoirs with Surface 5014 Facilities}, 5015 school = {Stanford}, 5016 year = {2000}, 5017 petsc_uses = {KSP} 5018} 5019 5020@InProceedings{ puchyr2006, 5021 author = {Peter J. Puchyr}, 5022 title = {Experience with Parallel Computing for Reservoir and Geomechanics Simulation on a 5023 {Win32} Cluster}, 5024 booktitle = {Proceedings of the Canadian International Petroleum Conference}, 5025 note = {Paper number CIPC2006-207}, 5026 year = {2006}, 5027 petsc_uses = {KSP} 5028} 5029 5030@InProceedings{ texas98, 5031 author = {P. Wang and S. Balay and K. Seperhrnoori and J. Wheeler and J. Abate and B. Smith 5032 and G. A. Pope}, 5033 title = {A Fully Implicit Parallel {EOS} Compositional Simulator for Large Scale Reservoir 5034 Simulation}, 5035 booktitle = {Proceedings of the 1999 Society of Petroleum Engineers 15th Reservoir Simulation 5036 Symposium}, 5037 note = {also available as Argonne preprint ANL/MCS-P743-1298}, 5038 url = {ftp://info.mcs.anl.gov/pub/tech_reports/reports/P743.pdf}, 5039 year = {1998}, 5040 petsc_uses = {KSP} 5041} 5042 5043% LiteralHTML: 5044% LiteralHTML: <a name="cfd"><H3><center>CFD</center></H3> 5045% LiteralHTML: 5046@Article{ farrellmitchellscottwechsung2021, 5047 title = {A {Reynolds-robust} preconditioner for the {Scott-Vogelius} discretization of the 5048 stationary incompressible {Navier-Stokes} equations}, 5049 author = {Patrick E Farrell and Lawrence Mitchell and L Ridgway Scott and Florian 5050 Wechsung}, 5051 journal = {The SMAI journal of computational mathematics}, 5052 volume = {7}, 5053 pages = {75--96}, 5054 year = {2021}, 5055 petsc_uses = {KSP} 5056} 5057 5058@Article{ adlerbensoncyrfarrellmaclachlantuminaro2021, 5059 title = {Monolithic Multigrid Methods for Magnetohydrodynamics}, 5060 author = {James H Adler and Thomas R Benson and Eric C Cyr and Patrick E Farrell and Scott 5061 P MacLachlan and Ray S Tuminaro}, 5062 journal = {SIAM Journal on Scientific Computing}, 5063 number = {0}, 5064 pages = {S70--S91}, 5065 year = {2021}, 5066 petsc_uses = {KSP} 5067} 5068 5069@Article{ farrellgaticalamichhaneoyarzuaruizbaier2021, 5070 title = {Mixed Kirchhoff stress–displacement–pressure formulations for incompressible 5071 hyperelasticity}, 5072 author = {Patrick E. Farrell and Luis F. Gatica and Bishnu P. Lamichhane and Ricardo 5073 Oyar\'ua and Ricardo Ruiz-Baier}, 5074 journal = {Computer Methods in Applied Mechanics and Engineering}, 5075 volume = {374}, 5076 pages = {113562}, 5077 issn = {0045-7825}, 5078 doi = {https://doi.org/10.1016/j.cma.2020.113562}, 5079 url = {https://www.sciencedirect.com/science/article/pii/S0045782520307477}, 5080 year = {2021}, 5081 petsc_uses = {KSP} 5082} 5083 5084@Article{ farrellmitchellwechsung2018, 5085 title = {An augmented {Lagrangian} preconditioner for the {3D} stationary incompressible 5086 {Navier-Stokes} equations at high {Reynolds} number}, 5087 author = {Patrick E Farrell and Lawrence Mitchell and Florian Wechsung}, 5088 journal = {SIAM Journal on Scientific Computing}, 5089 volume = {41}, 5090 number = {5}, 5091 eprint = {1810.03315}, 5092 pages = {A3073-A3096}, 5093 year = {2019}, 5094 petsc_uses = {KSP} 5095} 5096 5097@Article{ hevuikklaij2017, 5098 title = {Block-preconditioners for the incompressible {Navier}--{Stokes} equations 5099 discretized by a finite volume method}, 5100 author = {Xin He and Cornelis Vuik and Christiaan Klaij}, 5101 journal = {Journal of Numerical Mathematics}, 5102 volume = {25}, 5103 number = {2}, 5104 pages = {89--105}, 5105 year = {2017}, 5106 petsc_uses = {KSP} 5107} 5108 5109@InProceedings{ zou2015newton, 5110 title = {Newton--Krylov methods in applications of two-phase flow problems with phase 5111 appearance/disappearance}, 5112 author = {Zou, L and Zhao, H and Zhang, H}, 5113 booktitle = {ANS 2015 Annual Meeting, June}, 5114 volume = {7}, 5115 number = {11}, 5116 year = {2015}, 5117 petsc_uses = {KSP} 5118} 5119 5120@Article{ guermond2009nonlinear, 5121 title = {Nonlinear magnetohydrodynamics in axisymmetric heterogeneous domains using a 5122 Fourier/finite element technique and an interior penalty method}, 5123 author = {Guermond, J-L and Laguerre, Raphael and L{\'e}orat, Jacques and Nore, Caroline}, 5124 journal = {Journal of computational physics}, 5125 volume = {228}, 5126 number = {8}, 5127 pages = {2739--2757}, 5128 year = {2009}, 5129 publisher = {Elsevier}, 5130 petsc_uses = {KSP} 5131} 5132 5133@Article{ erzincanlisahin2015, 5134 title = {The numerical simulation of the wing kinematics effects on near wake topology and 5135 aerodynamic performance in hovering {D}rosophila flight}, 5136 author = {Belkis Erzincanli and Mehmet Sahin}, 5137 journal = {Computers \& Fluids}, 5138 volume = {122}, 5139 pages = {90--110}, 5140 year = {2015}, 5141 publisher = {Elsevier}, 5142 petsc_uses = {KSP} 5143} 5144 5145@Article{ ekensahin2015, 5146 title = {A parallel monolithic algorithm for the numerical simulation of large-scale fluid 5147 structure interaction problems}, 5148 author = {Ali Eken and Mehmet Sahin}, 5149 journal = {International Journal for Numerical Methods in Fluids}, 5150 year = {2015}, 5151 publisher = {Wiley Online Library}, 5152 petsc_uses = {KSP} 5153} 5154 5155@Article{ hwangsucai2015, 5156 title = {A parallel adaptive nonlinear elimination preconditioned inexact {Newton} method 5157 for transonic full potential equation}, 5158 author = {Feng-Nan Hwang and Yi-Cheng Su and Xiao-Chuan Cai}, 5159 journal = {Computers \& Fluids}, 5160 volume = {110}, 5161 number = {30}, 5162 pages = {96--107}, 5163 year = {2015}, 5164 doi = {10.1016/j.compfluid.2014.04.005}, 5165 petsc_uses = {KSP} 5166} 5167 5168@Article{ yanghwangcai2016, 5169 title = {Nonlinear Preconditioning Techniques for Full-Space {L}agrange--{N}ewton Solution of 5170 {PDE}-Constrained Optimization Problems}, 5171 author = {Haijian Yang and Feng-Nan Hwang and Xiao-Chuan Cai}, 5172 journal = {SIAM Journal on Scientific Computing}, 5173 volume = {38}, 5174 number = {5}, 5175 pages = {A2756--A2778}, 5176 year = {2016}, 5177 petsc_uses = {KSP} 5178} 5179 5180@Article{ khanaidun2011, 5181 author = {Irfan Khan and Cyrus K. Aidun}, 5182 title = {Direct numerical simulation of saturated deformable porous media using parallel 5183 hybrid Lattice-{B}oltzmann and finite element method}, 5184 journal = {Int. J. Numer. Meth. Eng.}, 5185 volume = {86}, 5186 pages = {1379--1395}, 5187 year = {2011}, 5188 petsc_uses = {KSP} 5189} 5190 5191@Article{ khanaidun2014, 5192 author = {Irfan Khan and Cyrus K. Aidun}, 5193 title = {Modeling the deformation of saturate porous media using direct numerical 5194 simulation}, 5195 journal = {Int. J. Multiphase Flow}, 5196 doi = {10.1016/j.ijmultiphaseflow.2014.12.003}, 5197 year = {2014}, 5198 petsc_uses = {KSP} 5199} 5200 5201@Article{ mofidi2014simulations, 5202 author = {A. Mofidi and P. M. Carrica}, 5203 title = {Simulations of Zigzag Maneuvers for a Container Ship with Direct Moving Rudder 5204 and Propeller}, 5205 journal = {Computers and Fluids}, 5206 pages = {191--203}, 5207 year = {2014}, 5208 petsc_uses = {KSP} 5209} 5210 5211@Article{ paik2014fluidstructure, 5212 author = {K. Paik and P. M. Carrica}, 5213 title = {Fluid-Structure Interaction for an Elastic Structure Interacting with Free 5214 Surface in a Rolling Tank}, 5215 journal = {Ocean Engineering}, 5216 pages = {201--212}, 5217 year = {2014}, 5218 petsc_uses = {KSP} 5219} 5220 5221@Article{ castro2013bubble, 5222 author = {A. M. Castro and P. M. Carrica}, 5223 title = {Bubble size distribution prediction for large-scale ship flows: {Model} 5224 evaluation and numerical issues}, 5225 journal = {International Journal of Multiphase Flow 57}, 5226 pages = {131--150}, 5227 year = {2013}, 5228 petsc_uses = {KSP} 5229} 5230 5231@Article{ carrica2013turn, 5232 author = {P. M. Carrica and F. Ismail and M. Hyman and S. Bhushan and F. Stern}, 5233 title = {Turn and Zigzag Maneuvers of a Surface Combatant Using a {URANS} Approach with 5234 Dynamic Overset Grids}, 5235 journal = {Journal of Marine Science and Technology}, 5236 pages = {166--181}, 5237 year = {2013}, 5238 petsc_uses = {KSP} 5239} 5240 5241@Article{ castro2013eulerian, 5242 author = {A. M. Castro and P. M. Carrica}, 5243 title = {Eulerian polydispersed modeling of bubbly flows around ships with application to 5244 {Athena} {R}/V,}, 5245 journal = {International Shipbuilding Progress}, 5246 pages = {403--433}, 5247 year = {2013}, 5248 petsc_uses = {KSP} 5249} 5250 5251@Article{ chase2013overset, 5252 author = {N. Chase and T. Michael and P. M. Carrica}, 5253 title = {Overset simulations of a {Submarine} in {Towed}, {Self}-{Propelled} and 5254 {Maneuvering} {Conditions}}, 5255 journal = {International Shipbuilding Progress}, 5256 pages = {171--205}, 5257 year = {2013}, 5258 petsc_uses = {KSP} 5259} 5260 5261@Article{ sadathosseini2013wu, 5262 author = {H. Sadat-Hosseini and P. -C. Wu and P. M. Carrica and H. Kim and Y. Toda and F. 5263 Stern}, 5264 title = {{CFD} Simulation and Validation of Added Resistance of {KVLCC}2 with Fixed and 5265 Free Surge Conditions in Short and Long Head Waves}, 5266 journal = {Ocean Engineering}, 5267 volume = {59}, 5268 pages = {240--273}, 5269 year = {2013}, 5270 petsc_uses = {KSP} 5271} 5272 5273@Article{ chase2013cfd, 5274 author = {N. Chase and P. M. Carrica}, 5275 title = {{CFD} Simulations of a Submarine Propeller and Application to Self-Propulsion of a 5276 Submarine}, 5277 journal = {Ocean Engineering}, 5278 pages = {68--80}, 5279 year = {2013}, 5280 petsc_uses = {KSP} 5281} 5282 5283@Article{ carrica2012cfd, 5284 author = {P. M. Carrica and H. Sadat-Hosseini and F. Stern}, 5285 title = {{CFD} Analysis of Broaching for a Model Surface Combatant with Explicit Simulation 5286 of Moving Rudders and Rotating Propellers}, 5287 journal = {Computers and Fluids 53}, 5288 pages = {117--132}, 5289 year = {2012}, 5290 petsc_uses = {KSP} 5291} 5292 5293@Article{ sakamoto2012urans, 5294 author = {N. Sakamoto and P. M. Carrica and F. Stern}, 5295 title = {{URANS} Simulations of Static and Dynamic Maneuvering for Surface Combatant-Part 1: 5296 Verification and Validation for Forces, Moment, and Hydrodynamic Derivatives}, 5297 publisher = {Journal of Marine Science and Technology}, 5298 pages = {422--445}, 5299 year = {2012}, 5300 petsc_uses = {KSP} 5301} 5302 5303@Article{ sakamoto2012uransb, 5304 author = {N. Sakamoto and P. M. Carrica and F. Stern}, 5305 title = {{URANS} Simulations of Static and Dynamic Maneuvering for Surface Combatant-Part 2: 5306 Analysis and Validation of Local Flow Characteristics}, 5307 journal = {Journal of Marine Science and Technology}, 5308 pages = {446--468}, 5309 year = {2012}, 5310 petsc_uses = {KSP} 5311} 5312 5313@Article{ li2012dynamic, 5314 author = {Y. Li and T. Xing and K. Paik and P. M. Carrica}, 5315 title = {Dynamic Overset {CFD} Simulations of Wind Turbine Aerodynamics}, 5316 journal = {Renewable Energy}, 5317 pages = {285--298}, 5318 year = {2012}, 5319 petsc_uses = {KSP} 5320} 5321 5322@Article{ huang2012a, 5323 author = {J. Huang and P. M. Carrica and F. Stern}, 5324 title = {A Method to Compute Ship Exhaust Plumes with Waves and Wind}, 5325 journal = {International Journal for Numerical Methods in Fluids}, 5326 pages = {160--180}, 5327 year = {2012}, 5328 petsc_uses = {KSP} 5329} 5330 5331@Article{ huang2012b, 5332 author = {J. Huang and P. M. Carrica and F. Stern}, 5333 title = {A geometry-based level set method for curvilinear overset grids with application 5334 to ship hydrodynamics}, 5335 journal = {International Journal for Numerical Methods in Fluids}, 5336 pages = {494--521}, 5337 year = {2012}, 5338 petsc_uses = {KSP} 5339} 5340 5341@Article{ carrica2011computations, 5342 author = {P. M. Carrica and H. Fu and F. Stern}, 5343 title = {Computations of self-propulsion free to sink and trim and of motions in head 5344 waves of the {KRISO} {Container} {Ship} ({KCS}) model}, 5345 journal = {Applied Ocean Research}, 5346 pages = {309--320}, 5347 year = {2011}, 5348 petsc_uses = {KSP} 5349} 5350 5351@Article{ bhushan2011scalability, 5352 author = {S. Bhushan and P. M. Carrica and J. Yang and F. Stern}, 5353 title = {Scalability and Validation Study for Large Scale Surface Combatant Computations 5354 Using {CFDShip}-Iowa}, 5355 journal = {International Journal of High Performance Computing Applications}, 5356 pages = {466--487}, 5357 year = {2011}, 5358 petsc_uses = {KSP} 5359} 5360 5361@Article{ castro2011full, 5362 author = {A. M. Castro and P. M. Carrica and F. Stern}, 5363 title = {Full scale self-propulsion computations using discretized propeller for the 5364 {KRISO} container ship {KCS}}, 5365 journal = {Computers and Fluids}, 5366 pages = {35--47}, 5367 year = {2011}, 5368 petsc_uses = {KSP} 5369} 5370 5371@Article{ kandasamy2011multifidelity, 5372 author = {M. Kandasamy and S. K. Ooi and P. M. Carrica and F. Stern and E. F. Campana and 5373 D. Peri and P. Osborne and J. Cote and N. Macdonald and N. de Waal}, 5374 title = {Multi-fidelity Optimization of a High-speed Foil-assisted Semi-planing {C}atamaran 5375 for Low Wake}, 5376 journal = {Journal of Marine Science and Technology}, 5377 pages = {143--156}, 5378 year = {2011}, 5379 petsc_uses = {KSP} 5380} 5381 5382@Article{ kandasamy2011cfd, 5383 author = {M. Kandasamy and S. K. Ooi and P. M. Carrica and F. Stern and E. F. Campana and 5384 D. Peri and P. Osborne and J. Cote and N. Macdonald and N. de Waal}, 5385 title = {{CFD} Validation Studies for a High-speed Foil-assisted Semi-planing {C}atamaran}, 5386 journal = {Journal of Marine Science and Technology}, 5387 pages = {157--167}, 5388 year = {2011}, 5389 petsc_uses = {KSP} 5390} 5391 5392@Article{ sadathosseini2011cfd, 5393 author = {H. Sadat-Hosseini and P. M. Carrica and F. Stern and N. Umeda and H. Hashimoto 5394 and S. Yamamura and A. Mastuda}, 5395 title = {{CFD} System-Based and {EFD} Study of Ship Dynamic Instability Events: Surf Riding, 5396 Periodic Motion and Broaching}, 5397 journal = {Ocean Engineering}, 5398 pages = {88--110}, 5399 year = {2011}, 5400 petsc_uses = {KSP} 5401} 5402 5403@Article{ mosaviraad2010development, 5404 author = {M. Mosaviraad and P. M. Carrica and F. Stern}, 5405 title = {Development and Validation of Harmonic Wave Group Single-Run Procedure for {RAO} 5406 with Comparison to Regular Wave and Transient Wave Group Procedures Using 5407 {URANS}}, 5408 journal = {Ocean Engineering}, 5409 pages = {653--666}, 5410 year = {2010}, 5411 petsc_uses = {KSP} 5412} 5413 5414@Article{ carrica2010largescale, 5415 author = {P. M. Carrica and J. Huang and R. Noack and D. Kaushik and B. Smith and F. 5416 Stern}, 5417 title = {Large-Scale {DES} Computations of the Forward Speed Diffraction and Pitch and 5418 Heave Problems for a Surface Combatant}, 5419 journal = {Computers and Fluids}, 5420 pages = {1095--1111}, 5421 year = {2010}, 5422 petsc_uses = {KSP} 5423} 5424 5425@Article{ carrica2010selfpropulsion, 5426 author = {P. M. Carrica and A. M. Castro and F. Stern}, 5427 title = {Self-Propulsion Computations Using Speed Controller and Discretized Propeller 5428 with Dynamic Overset Grids}, 5429 journal = {Journal of Marine Science and Technology}, 5430 pages = {316--330}, 5431 year = {2010}, 5432 petsc_uses = {KSP} 5433} 5434 5435@Article{ ismail2010evaluation, 5436 author = {F. Ismail and P. M. Carrica and T. Xing and F. Stern}, 5437 title = {Evaluation of Linear and Non-Linear Convection Schemes on Multidimensional 5438 Non-Orthogonal Grids with Applications to {KVLCC}2 Tanker}, 5439 journal = {International Journal of Numerical Methods in Fluids}, 5440 pages = {850--886}, 5441 year = {2010}, 5442 petsc_uses = {KSP} 5443} 5444 5445@Article{ kandasamy2010integral, 5446 author = {M. Kandasamy and S. K. Ooi and P. M. Carrica and F. Stern}, 5447 title = {Integral Force/Moment Waterjet Model for {CFD} Simulations}, 5448 journal = {Journal of Fluids Engineering}, 5449 pages = {101103}, 5450 year = {2010}, 5451 petsc_uses = {KSP} 5452} 5453 5454@Article{ kirk:2014de, 5455 author = {Kirk, Benjamin S and Stogner, Roy H and Bauman, Paul T and Oliver, Todd A}, 5456 title = {{Modeling hypersonic entry with the fully-implicit {N}avier--{S}tokes (FIN-S) 5457 stabilized finite element flow solver}}, 5458 journal = {Computers {\&} Fluids}, 5459 year = {2014}, 5460 volume = {92}, 5461 number = {0}, 5462 pages = {281--292}, 5463 month = mar, 5464 petsc_uses = {KSP} 5465} 5466 5467@Article{ carracciuolo20111382, 5468 title = {Computational simulations of {3D} large-scale time-dependent viscoelastic flows 5469 in high performance computing environment}, 5470 journal = {Journal of Non-Newtonian Fluid Mechanics }, 5471 volume = {166}, 5472 number = {23--24}, 5473 pages = {1382--1395}, 5474 year = {2011}, 5475 issn = {0377-0257}, 5476 doi = {10.1016/j.jnnfm.2011.08.014}, 5477 author = {L. Carracciuolo and D. Casaburi and L. D’Amore and G. D’Avino and P.L. 5478 Maffettone and A. Murli}, 5479 keywords = {Parallel computations, Viscoelastic flows, DEVSS-G, \{PETSc\}, Finite element 5480 method, High performance computing}, 5481 petsc_uses = {KSP} 5482} 5483 5484@Article{ bungartzgatzhammerliebmehlneckel11, 5485 author = {Bungartz, Hans-Joachim and Gatzhammer, Bernhard and Lieb, Michael and Mehl, 5486 Miriam and Neckel, Tobias}, 5487 title = {Towards multi-phase flow simulations in the PDE framework Peano}, 5488 journal = {Computational Mechanics}, 5489 volume = {48}, 5490 number = {3}, 5491 pages = {365-376}, 5492 year = {2011}, 5493 issn = {0178-7675}, 5494 doi = {10.1007/s00466-011-0626-1}, 5495 publisher = {Springer-Verlag}, 5496 keywords = {PDE framework; Octree-like Cartesian grids; Computational fluid dynamics; 5497 Thermohydraulics; Two-phase flow}, 5498 language = {English}, 5499 petsc_uses = {KSP} 5500} 5501 5502@Article{ bpr:cfl, 5503 author = {H.~M. B{\"u}cker and B. Pollul and A. Rasch}, 5504 title = {{On {CFL} Evolution Strategies for Implicit Upwind Methods in Linearized {E}uler 5505 Equations}}, 5506 journal = {International Journal for Numerical Methods in Fluids}, 5507 year = {2009}, 5508 volume = {59}, 5509 number = {1}, 5510 pages = {1--18}, 5511 doi = {10.1002/fld.1798}, 5512 petsc_uses = {KSP} 5513} 5514 5515@InBook{ bonfiglioli_campobasso_carpentieri_2010, 5516 author = {Bonfiglioli, A and Campobasso, M S and Carpentieri, B}, 5517 title = {Parallel unstructured three-dimensional turbulent flow analyses using efficiently 5518 preconditioned newton-krylov solver}, 5519 publisher = {Curran Associates}, 5520 year = {2010}, 5521 url = {http://www.proceedings.com/05932.html}, 5522 petsc_uses = {KSP} 5523} 5524 5525@Article{ bonfiglioli_rans_2005, 5526 author = {Paciorri, Renato and Bonfiglioli, Aldo and Di Mascio, Andrea and Favini, 5527 Bernardo}, 5528 title = {RANS simulations of a junction flow}, 5529 journal = {International Journal of Computational Fluid Dynamics}, 5530 volume = {19}, 5531 number = {2}, 5532 pages = {179-189}, 5533 year = {2005}, 5534 doi = {10.1080/10618560410001729126}, 5535 petsc_uses = {KSP} 5536} 5537 5538@InCollection{ bonfiglioli__carpentieri_rans_2008, 5539 author = {Bonfiglioli, A. and Carpentieri, B. and Sosonkina, M.}, 5540 affiliation = {University of Basilicata Dip.to di Ingegneria e Fisica dell’Ambiente Potenza 5541 Italy}, 5542 title = {Performance Analysis of Parallel Algebraic Preconditioners for Solving the RANS 5543 Equations Using Fluctuation Splitting Schemes}, 5544 booktitle = {Numerical Mathematics and Advanced Applications}, 5545 editor = {Kunisch, Karl and Of, Günther and Steinbach, Olaf}, 5546 publisher = {Springer Berlin Heidelberg}, 5547 isbn = {978-3-540-69777-0}, 5548 pages = {151-158}, 5549 doi = {10.1007/978-3-540-69777-0_17}, 5550 year = {2008}, 5551 petsc_uses = {KSP} 5552} 5553 5554@InCollection{ bonfiglioli__carpentieri_ens_2007, 5555 author = {Bonfiglioli, Aldo and Carpentieri, Bruno and Sosonkina, Masha}, 5556 affiliation = {Dip.to di Ingegneria e Fisica dell’Ambiente, University of Basilicata, Potenza, 5557 Italy}, 5558 title = {EulFS: A Parallel {CFD} Code for the Simulation of {Euler and Navier-Stokes} 5559 Problems on Unstructured Grids}, 5560 booktitle = {Applied Parallel Computing. State of the Art in Scientific Computing}, 5561 series = {Lecture Notes in Computer Science}, 5562 editor = {Kågström, Bo and Elmroth, Erik and Dongarra, Jack and Wasniewski, Jerzy}, 5563 publisher = {Springer Berlin / Heidelberg}, 5564 isbn = {978-3-540-75754-2}, 5565 pages = {676-685}, 5566 volume = {4699}, 5567 doi = {10.1007/978-3-540-75755-9_83}, 5568 year = {2007}, 5569 petsc_uses = {KSP} 5570} 5571 5572@Article{ terrelscottknepleykirby08, 5573 author = {Andy R. Terrel and L. Ridgway Scott and Matthew G. Knepley and Robert C. Kirby}, 5574 title = {Automated {FEM} Discretizations for the {Stokes} Equation}, 5575 journal = {BIT}, 5576 volume = {48}, 5577 number = {2}, 5578 year = {2008}, 5579 petsc_uses = {KSP} 5580} 5581 5582@Article{ martamadermartinsweidealonso07, 5583 author = {A. C. Marta and C. A. Mader and J. R. R. A. Martins and E. {Van der Weide} and J. 5584 J. Alonso}, 5585 title = {A methodology for the development of discrete adjoint solvers using automatic 5586 differentiation tools}, 5587 journal = {Computational Fluid Dyanmics}, 5588 volume = {21}, 5589 pages = {307--327}, 5590 year = {2007}, 5591 petsc_uses = {KSP} 5592} 5593 5594@TechReport{ avb2008, 5595 author = {V.R. Ambati and J.J.W. van der Vegt and O. Bokhove}, 5596 title = {Variational Space-time (Dis)continuous {G}alerkin Method for Linear Free Surface 5597 Waves}, 5598 year = {2008}, 5599 institution = {University of Twente, the Netherlands}, 5600 url = {http://eprints.eemcs.utwente.nl/11714/01/memo1863.pdf}, 5601 petsc_uses = {KSP} 5602} 5603 5604@InProceedings{ bdsm2005, 5605 author = {M. Bozkurttas and H. Dong and V. Seshadri and R. Mittal}, 5606 title = {Towards Numerical Simulation of Flapping Foils on Fixed Cartesian Grids}, 5607 booktitle = {43rd AIAA Aerospace Sciences Meeting and Exhibit}, 5608 year = {2005}, 5609 url = {http://project.seas.gwu.edu/~fsagmae/papers/AIAA_2005_0079.pdf}, 5610 petsc_uses = {KSP} 5611} 5612 5613@InProceedings{ ms2006, 5614 author = {S. Muller and Y. Stiriba}, 5615 title = {A MULTILEVEL FINITE VOLUME METHOD WITH MULTISCALE-BASED GRID ADAPTATION FOR 5616 STEADY COMPRESSIBLE FLOWS}, 5617 booktitle = {European Conference on Computational Fluid Dynamics: ECCOMAS CFD 2006}, 5618 year = {2006}, 5619 url = {http://www.numerical.rl.ac.uk/people/marioli/Archives/ECCOMAS-CFD-2006/documents/197.pdf}, 5620 petsc_uses = {KSP} 5621} 5622 5623@Article{ araujoteixeiracunhagroth08, 5624 author = {B. J. Ara\'ujo and J. C. F. Teixeira and A. M. Cunha and C. P. T. Groth}, 5625 title = {Parallel three-dimensional simulation of the injection molding process}, 5626 journal = {International Journal for Numerical Methods in Fluids}, 5627 year = {2008}, 5628 url = {http://www3.interscience.wiley.com/journal/119876958/abstract?CRETRY=1&SRETRY=0}, 5629 petsc_uses = {KSP} 5630} 5631 5632@PhDThesis{ a2008, 5633 author = {A. Cubero}, 5634 title = {a parallel coupled algorithm for collocated grids and its application to Large 5635 Eddy Simulation of a turbulent wake}, 5636 school = {University of Zaragoza (Spain)}, 5637 year = {2008}, 5638 petsc_uses = {KSP} 5639} 5640 5641@Article{ afa2007, 5642 author = {A. Cubero and N. Fueyo}, 5643 title = {A Compact Momentum Interpolation Method for unsteady flows and relaxation}, 5644 journal = {Numerical Heat Transfer, part B-Fundamentals}, 5645 volume = {56}, 5646 number = {6}, 5647 pages = {507--529}, 5648 year = {2007}, 5649 url = {http://www.informaworld.com/smpp/content~content=a782025305~db=all~order=page}, 5650 petsc_uses = {KSP} 5651} 5652 5653@TechReport{ af2007, 5654 title = {Preconditioning based on a partially implicit implementation of Momentum 5655 Interpolation for coupled solvers}, 5656 institution = {Fluid Mechanics Group of the University of Zaragoza (Spain)}, 5657 year = {2007}, 5658 author = {A. Cubero and N. Fueyo}, 5659 petsc_uses = {KSP} 5660} 5661 5662@InCollection{ dwight2004, 5663 author = {Richard Dwight}, 5664 title = {Robust Mesh Deformation using the Linear Elasticity Equations}, 5665 booktitle = {Computational Fluid Dynamics 2006}, 5666 editor = {H. Deconinck and E. Dick}, 5667 publisher = {Springer}, 5668 year = {2006}, 5669 url = {http://www.maths.man.ac.uk/\~{ 5670 }rdwight/pub/rdwight-ICCFD4-LinElastDeformation-2006.pdf}, 5671 petsc_uses = {KSP} 5672} 5673 5674@InProceedings{ dwight2006, 5675 author = {Richard Dwight and Joel Brezillon}, 5676 title = {Effect of Various Approximations of the Discrete Adjoint on Gradient-Based 5677 Optimization}, 5678 booktitle = {Proceedings of the 44th AIAA Aerospace Sciences Meeting and Exhibit, Reno NV. 5679 AIAA-2006-0690}, 5680 year = {2006}, 5681 url = {http://www.maths.man.ac.uk/\~{ }rdwight/pub/rdwight-AIAAReno-ApproxAdjoint.pdf}, 5682 petsc_uses = {KSP} 5683} 5684 5685@PhDThesis{ dwight2006a, 5686 author = {Richard Dwight}, 5687 title = {Efficiency Improvements of {RANS}-Based Analysis and Optimization using Implicit 5688 and Adjoint Methods on Unstructured Grids}, 5689 school = {School of Mathematics, University of Manchester}, 5690 year = {2006}, 5691 url = {http://www.maths.man.ac.uk/\~{ 5692 }rdwight/pub/rdwight-PhDThesis-ImplicitAndAdjoint.pdf}, 5693 petsc_uses = {KSP} 5694} 5695 5696@InProceedings{ lhdfrh, 5697 author = {M. Lauter and D. Handorf and K. Dethloff and S. Frickenhaus and N. Rakowsky and 5698 W. Hiller}, 5699 title = {An adaptive Lagrange-Galerkin shallow-water model on the sphere}, 5700 booktitle = {Workshop Proceedings Current Development in Shallow Water Models on the Sphere 5701 March, 10-14, 2003, Munich University of Technology, German}, 5702 year = {2003}, 5703 petsc_uses = {KSP} 5704} 5705 5706@InProceedings{ brios-ying-2002, 5707 author = {George Biros and Lexing Ying and Denis Zorin}, 5708 title = {The Embedded Boundary Integral Method (EBI) for the Incompressible 5709 {Navier-Stokes} equations}, 5710 booktitle = {IABEM 2002, International Association for Boundary Element Methods, UT Austin}, 5711 year = {2002}, 5712 petsc_uses = {KSP} 5713} 5714 5715@InProceedings{ mohsen-straatman-ins, 5716 author = {S.A. Mohsen Karimian and Anthony G. Straatman}, 5717 title = {Benchmarking of a {3D}, unstructured, finite volume code for incompressible 5718 {Navier-Stokes} equation on a cluster of distributed-memory computers}, 5719 booktitle = {Proceedings of the 19th International Symposium on High Performance Computing 5720 Systems and Applications}, 5721 pages = {11--16}, 5722 year = {2005}, 5723 url = { http://ieeexplore.ieee.org/search/wrapper.jsp?arnumber=1430046}, 5724 petsc_uses = {KSP} 5725} 5726 5727@TechReport{ bonglioli-icnmfd98, 5728 title = {Multidimensional Residual Distribution Schemes for the Pseudo-Compressible 5729 {Euler} and {Navier-Stokes} equations on Unstructured Meshes}, 5730 institution = {Universita della Basilicata via della Tecnica 3}, 5731 year = {1996}, 5732 author = {A. Bonglioli}, 5733 url = {http://www.unibas.it/utenti/bonfiglioli/icnmfd98.ps.gz}, 5734 petsc_uses = {KSP} 5735} 5736 5737@Article{ deng-piquet-ctf, 5738 author = {G. B. Deng and J. Piquet and X. Vasseur and M. Visonneau"}, 5739 title = {A new fully coupled method for computing turbulent flows}, 5740 journal = {Computers and Fluids}, 5741 volume = {30}, 5742 pages = {445--472}, 5743 year = {2001}, 5744 petsc_uses = {KSP} 5745} 5746 5747@InProceedings{ knepleysarinsameh99b, 5748 title = {Multilevel Preconditioning for Parallel {CFD}}, 5749 author = {Matthew G. Knepley and Vivek Sarin and Ahmed H. Sameh}, 5750 booktitle = {International Conference On Preconditioning Techniques For Large Sparse Matrix 5751 Problems In Industrial Applications}, 5752 address = {Minneapolis, MN}, 5753 year = {1999}, 5754 petsc_uses = {KSP} 5755} 5756 5757@InProceedings{ garbey1, 5758 author = {M. Garbey and B. Hadri and W. Shyy.}, 5759 title = {Fast Elliptic Solver for Incompressible {Navier Stokes} Flow and Heat Transfer 5760 Problems on the Grid}, 5761 booktitle = {Aerospace Sciences Meeting and Exhibit}, 5762 note = {Paper No. 2005-1386}, 5763 year = {2005}, 5764 petsc_uses = {KSP} 5765} 5766 5767@Article{ carrica2007unsteady, 5768 title = {An unsteady single-phase level set method for viscous free surface flows}, 5769 author = {Carrica, PM and Wilson, RV and Stern, F.}, 5770 journal = {International Journal for Numerical Methods in Fluids}, 5771 volume = {53}, 5772 number = {2}, 5773 pages = {229--256}, 5774 year = {2007}, 5775 publisher = {Chichester; New York: Wiley, c1981-}, 5776 petsc_uses = {KSP} 5777} 5778 5779@Article{ pctw2004, 5780 author = {M. S. Politano and P. M. Carrica and C. Turan and L. Weber}, 5781 title = {A Multidimensional Two-Phase Flow Model for the Total Dissolved Gas Downstream of 5782 Spillways}, 5783 journal = {Journal of Hydraulic Research}, 5784 note = {accepted for publication}, 5785 year = {2004}, 5786 petsc_uses = {KSP} 5787} 5788 5789@Article{ wcs2004, 5790 author = {R. V. Wilson and P. M. Carrica and F. Stern}, 5791 title = {Unsteady RANS Method for Ship Motions with Application to Roll for a Surface 5792 Combatant}, 5793 journal = {Computers and Fluids}, 5794 note = {in press}, 5795 year = {2004}, 5796 petsc_uses = {KSP} 5797} 5798 5799@Article{ cws2005, 5800 author = {P. M. Carrica and R. V. Wilson and F. Stern}, 5801 title = {Unsteady RANS Simulation of the Ship Forward Speed Diffraction Problem}, 5802 journal = {Computers and Fluids}, 5803 note = {accepted for publication}, 5804 year = {2005}, 5805 petsc_uses = {KSP} 5806} 5807 5808@Article{ chndss2010, 5809 author = {P. M. Carrica and J. Huang and R. Noack and D. Kaushik and B. Smith and F. 5810 Stern}, 5811 title = { Large-Scale {DES} Computations of the Forward Speed Diffraction and Pitch and 5812 Heave Problems for a Surface Combatant}, 5813 journal = {Computers and Fluids}, 5814 year = {2010}, 5815 volume = {39}, 5816 number = {7}, 5817 pages = {1095--1111}, 5818 petsc_uses = {KSP} 5819} 5820 5821@InProceedings{ chnkss2008, 5822 author = {P. M. Carrica and J. Huang and R. Noack and D. Kaushik and B. Smith and F. 5823 Stern}, 5824 title = {Toward Large-Scale Computations of Ship Motions with Dynamic Overset Curvilinear 5825 Grids}, 5826 booktitle = {Proceedings of the 27th Symposium on Naval Hydrodynamics, Seoul, Korea}, 5827 year = {2008}, 5828 petsc_uses = {KSP} 5829} 5830 5831@MastersThesis{ mtj, 5832 author = {M. T. Jozkowski}, 5833 title = {Application of Algebraic Multigrid Methods to the Solution of Stratified Flows 5834 About Submerged Bodies}, 5835 school = {The Pennsylvania State University}, 5836 year = {2005}, 5837 petsc_uses = {KSP} 5838} 5839 5840@Article{ pp, 5841 author = {E. G. Paterson and L. J. Peltier}, 5842 title = {Detached-Eddy Simulation of High Reynolds Number Beveled-Trailing-Edge Flows and 5843 Wakes}, 5844 journal = {ASME Journal of Fluids Engineering}, 5845 note = {In press}, 5846 year = {2005}, 5847 petsc_uses = {KSP} 5848} 5849 5850@Article{ eps, 5851 author = {B. A. Edge and E. G. Paterson and G. Settles}, 5852 title = {Computational Study of the Wake and Contaminant Transport of a Walking Human}, 5853 journal = {ASME Journal of Fluids Engineering}, 5854 note = {In press}, 5855 year = {2005}, 5856 petsc_uses = {KSP} 5857} 5858 5859@InProceedings{ rp, 5860 author = {B. Racine and E. G. Paterson}, 5861 title = {Computation of Maneuvering Coefficients for Non-Body-of-Revolution Submarines 5862 Using Unsteady {RANS} {CFD}}, 5863 booktitle = {35th AIAA Fluid Dynamics Conference and Exhibit}, 5864 year = {2005}, 5865 petsc_uses = {KSP} 5866} 5867 5868@InProceedings{ etpp, 5869 author = {B. A. Edge and M. F. Trujillo and E. G. Paterson and L. J. Peltier}, 5870 title = {Prediction of Forces and Moments on a Sonobuoy Configuration Using Overset Grids 5871 and DES}, 5872 booktitle = {7th Overset Composite Grid and Solution Technology Symposium}, 5873 year = {2004}, 5874 petsc_uses = {KSP} 5875} 5876 5877@InProceedings{ pp8, 5878 author = {E. G. Paterson and L. J. Peltier}, 5879 title = {Localized turbulence simulation for naval hydrodynamics: issues in using overset 5880 refinement grids and detached-eddy simulation}, 5881 booktitle = {7th Overset Composite Grid and Solution Technology Symposium}, 5882 year = {2004}, 5883 petsc_uses = {KSP} 5884} 5885 5886@InProceedings{ mzwp, 5887 author = {R. Meyer and F. J. Zajackowski and W. A. Straka,and E. G. Paterson}, 5888 title = {Experimental and Computational Study of Cavitation Inception on Co-Flow Nozzles}, 5889 booktitle = {25th Symposium on Naval Hydrodynamics}, 5890 year = {2004}, 5891 petsc_uses = {KSP} 5892} 5893 5894@InProceedings{ ppph, 5895 author = {E. G. Paterson and J. E. Poremba and L. J. Peltier and S. A. Hambric}, 5896 title = {A Physics-Based Simulation Methodology for Predicting Trailing-Edge Singing}, 5897 booktitle = {25th Symposium on Naval Hydrodynamics}, 5898 year = {2004}, 5899 petsc_uses = {KSP} 5900} 5901 5902@InProceedings{ ppd, 5903 author = {E. G. Paterson and L. J. Peltier}, 5904 title = {Detached-Eddy Simulation of High Reynolds Number Trailing-Edge Flows and Wakes}, 5905 booktitle = {Symposium on LES Advancements and Applications, ASME FED Summer Meeting}, 5906 year = {2004}, 5907 petsc_uses = {KSP} 5908} 5909 5910@InProceedings{ bp, 5911 author = {W. J. Baker and E. G. and Paterson}, 5912 title = {Simulation of Steady Circulation Control for the General Aviation Circulation 5913 Control Wing}, 5914 booktitle = {NASA/ONR Workshop on Circulation Control}, 5915 year = {2004}, 5916 petsc_uses = {KSP} 5917} 5918 5919@InProceedings{ pb, 5920 author = {E. G. Paterson and W. J. Baker}, 5921 title = {RANS and Detached-Eddy Simulation of the NCCR airfoil}, 5922 booktitle = {NASA/ONR Workshop on Circulation Control}, 5923 year = {2004}, 5924 petsc_uses = {KSP} 5925} 5926 5927@InProceedings{ pb3, 5928 author = {E. G. Paterson and W. J. Baker}, 5929 title = {Simulation of Steady and Pulsed Circulation Controlfor Marine-Vehicle Control 5930 Surfaces}, 5931 booktitle = {42nd AIAA Aerospace Sciences Meeting}, 5932 year = {2004}, 5933 petsc_uses = {KSP} 5934} 5935 5936@InProceedings{ gid1, 5937 author = {G. Frank and J. D'Elia}, 5938 title = {{CFD} Modelling of the Flow Around the {Ahmed} Vehicle Model}, 5939 year = {2004}, 5940 booktitle = {Proceedings of the 2nd Conference on Advances and Applications of GiD}, 5941 url = {http://www.gid.cimne.upc.es/2004/papers/p216.pdf}, 5942 petsc_uses = {KSP} 5943} 5944 5945@InBook{ b1, 5946 author = {A.Bonfiglioli}, 5947 chapter = {On the use of the PETSc library for unstructured {CFD} applications}, 5948 year = {2001}, 5949 title = {Science and Supercomputing at CINECA}, 5950 pages = {397--400}, 5951 petsc_uses = {KSP} 5952} 5953 5954@InProceedings{ b2004, 5955 author = {L. A. Barba}, 5956 title = {Computing high-Reynolds number vortical flows: a highly accurate method with a 5957 fully meshless formulation}, 5958 year = {2004}, 5959 booktitle = {International Conference on Parallel CFD, Grand Canary, May 2004}, 5960 note = {Submitted}, 5961 petsc_uses = {KSP} 5962} 5963 5964@InProceedings{ bl2004, 5965 author = {L. A. Barba and A. Leonard}, 5966 title = {Computation of Viscous Vortices with Fully Meshless Method}, 5967 year = {2004}, 5968 booktitle = {Proceedings of ICTAM meeting in Warsaw, August 2004}, 5969 note = {Submitted}, 5970 petsc_uses = {KSP} 5971} 5972 5973@Article{ vws1, 5974 author = {B. G. M. Van Wachem and J. C. Schouten}, 5975 title = {Experimental Validation of 3-D Lagrangian VOF Model: Bubble Shape and Rise 5976 Velocity}, 5977 institution = {Laboratory of Chemical Reactor Engineering, Department of Chemical Engineering 5978 and Chemistry, Eindhoven University of Technology, 5600 MB Eindhoven, The 5979 Netherlands}, 5980 journal = {AIChE}, 5981 volumne = {48}, 5982 number = {12}, 5983 month = dec, 5984 year = {2002}, 5985 petsc_uses = {KSP} 5986} 5987 5988@TechReport{ lbam1, 5989 author = {P. Leggiero and A. Bonfiglioli and P. Amodio and F. Mazzi}, 5990 title = {Precondizionatori paralleli per la fluidodinamica computazionale}, 5991 institution = {Dipartimento Interuniversitario di Matematica Universiti degli Studi-Politecnico 5992 di Bari Italy}, 5993 year = {2002}, 5994 number = {25/02}, 5995 petsc_uses = {KSP} 5996} 5997 5998@Article{ kees_miller_02, 5999 author = {C. E. Kees and C. T. Miller}, 6000 title = {Higher Order Time Integration Methods for Two-Phase Flow}, 6001 journal = {Advances in Water Resources}, 6002 year = {2002}, 6003 volume = {25}, 6004 number = {2}, 6005 pages = {159-177.}, 6006 petsc_uses = {KSP} 6007} 6008 6009@InProceedings{ lepotmeersessers2001, 6010 author = {I. Lepot and F. Meers and J.A. Essers}, 6011 title = {Multilevel Parallel High Order Schemes for Invisid Flow Computations on 3D 6012 Unstructured Meshes}, 6013 year = {2001}, 6014 booktitle = {ECCOMAS Computational Fluid Dynamics Conference 2001}, 6015 url = {http://www.ulg.ac.be/aerodyn}, 6016 petsc_uses = {KSP} 6017} 6018 6019@InProceedings{ knepley98, 6020 author = {Matthew Knepley and Denis Vanderstraeten}, 6021 title = {Parallel Building Blocks for Finite Element Simulations: Application to 6022 Solid-Liquid Mixture Flows}, 6023 booktitle = {Proceedings of Parallel CFD'97}, 6024 publisher = {Elsevier}, 6025 pages = {281--287}, 6026 year = {1998}, 6027 petsc_uses = {KSP} 6028} 6029 6030@InProceedings{ pcfd97, 6031 author = {William D. Gropp and David E. Keyes and Lois Curfman McInnes and M. D. Tidriri}, 6032 title = {Parallel Implicit {PDE} Computations: Algorithms and Software}, 6033 publisher = {Elsevier}, 6034 year = {1998}, 6035 booktitle = {Proceedings of Parallel CFD'97}, 6036 pages = {333-344}, 6037 petsc_uses = {KSP} 6038} 6039 6040@InProceedings{ knepleysamehsari98, 6041 author = {Matthew Knepley and Ahmed H. Sameh and Vivek Sarin}, 6042 title = {Parallel Simulation of Particulate Flows}, 6043 booktitle = {Solving Irregularly Structured Problems in Parallel}, 6044 editors = {A. Ferreira et al}, 6045 year = {1998}, 6046 series = {Lecture Notes in Computer Science}, 6047 volume = {1457}, 6048 pages = {226--237}, 6049 petsc_uses = {KSP} 6050} 6051 6052@Article{ gkmt98, 6053 author = {William D. Gropp and David E. Keyes and Lois Curfman McInnes and M. D. Tidriri}, 6054 title = {Globalized {N}ewton-{K}rylov-{S}chwarz Algorithms and Software for Parallel 6055 Implicit {CFD}}, 6056 journal = {Int. J. High Performance Computing Applications}, 6057 year = {2000}, 6058 volume = {14}, 6059 url = {ftp://info.mcs.anl.gov/pub/tech_reports/reports/P788.ps.Z}, 6060 pages = {102-136}, 6061 petsc_uses = {KSP} 6062} 6063 6064@InProceedings{ agkks-sc99, 6065 author = {W. K. Anderson and W. D. Gropp and D. K. Kaushik and D. E. Keyes and B. F. 6066 Smith}, 6067 title = {Achieving High Sustained Performance in an Unstructured Mesh {CFD} Application}, 6068 booktitle = {ACM/IEEE Proc. of SC 99: High Performance Networking and Computing}, 6069 editor = {}, 6070 publisher = {}, 6071 url = {ftp://info.mcs.anl.gov/pub/tech_reports/reports/P776.ps.Z}, 6072 year = {1999}, 6073 note = {Winner of Gordon Bell Special Prize at SC 99}, 6074 petsc_uses = {KSP} 6075} 6076 6077@Article{ gkks01, 6078 author = {W. D. Gropp and D. K. Kaushik and D. E. Keyes and B. F. Smith}, 6079 title = {High Performance Parallel Implicit {CFD}}, 6080 journal = {Journal of Parallel Computing}, 6081 year = {2001}, 6082 volume = {27}, 6083 pages = {337-362}, 6084 url = {http://www.mcs.anl.gov/petsc-fun3d/Papers/manke.pdf}, 6085 petsc_uses = {KSP} 6086} 6087 6088@Article{ cristea-sofonea-02, 6089 author = {Artur Cristea and Victor Sofonea}, 6090 title = {Finite Difference lattice Boltzmann model for Liquid Vapour Systems}, 6091 journal = {Proceedings of the Romanian Academy, Series A: Mathematics, Physics, Technical 6092 Sciences, Information Sciences}, 6093 volume = {3}, 6094 number = {3}, 6095 year = {2002}, 6096 petsc_uses = {KSP} 6097} 6098 6099@Article{ cristea2, 6100 author = {Artur Cristea and Victor Sofonea}, 6101 title = {Two component lattice Boltzmann model with flux limiter techniques}, 6102 journal = {Proceedings of the Romanian Academy, Series A: Mathematics, Physics, Technical 6103 Sciences, Information Sciences}, 6104 volume = {4}, 6105 number = {1}, 6106 year = {2003}, 6107 pages = {59--64}, 6108 petsc_uses = {KSP} 6109} 6110 6111@Article{ cristea1, 6112 author = {Artur Cristea and Victor Sofonea}, 6113 title = {Two component lattice Boltzmann model with flux limiters}, 6114 journal = {Central European Journal of Physics}, 6115 volume = {2}, 6116 number = {2}, 6117 year = {2004}, 6118 pages = {382--396}, 6119 petsc_uses = {KSP} 6120} 6121 6122@Article{ sofnea-lamura1, 6123 author = {Victor Sofonea and Antonio Lamura and Giuseppe Gonnella and Artur Cristea}, 6124 title = {Finite-difference lattice Boltzmann model with flux limiters for liquid-vapor 6125 systems}, 6126 journal = {Physical Review E}, 6127 volume = {70}, 6128 number = {4}, 6129 year = {2004}, 6130 pages = {046702-1 / 046702-9}, 6131 petsc_uses = {KSP} 6132} 6133 6134@InProceedings{ gkks01b, 6135 author = {W. D. Gropp and D. K. Kaushik and D. E. Keyes and B. F. Smith}, 6136 title = {Latency, Bandwidth, and Concurrent Issue Limitations in High-Performance {CFD}}, 6137 booktitle = {Proceedings of the First MIT Conference on Computational Fluid and Solid 6138 Mechanics}, 6139 editor = {}, 6140 location = {Cambridge, MA}, 6141 year = {2001}, 6142 month = jun, 6143 url = {http://www.mcs.anl.gov/petsc-fun3d/Papers/mit01.pdf}, 6144 petsc_uses = {KSP} 6145} 6146 6147@InProceedings{ gkks00, 6148 author = {W. D. Gropp and D. K. Kaushik and D. E. Keyes and B. F. Smith}, 6149 title = {Understanding the Parallel Scalability of An Implicit Unstructured Mesh {CFD} 6150 Code}, 6151 booktitle = {Proceedings of the 7th International Conference on High Performance Computing 6152 (HiPC '2000)}, 6153 editor = {}, 6154 location = {Bangalore, India}, 6155 year = {2000}, 6156 pages = {395--404}, 6157 url = {http://www.mcs.anl.gov/petsc-fun3d/Papers/hipc00.pdf}, 6158 petsc_uses = {KSP} 6159} 6160 6161@InProceedings{ gkks-sc00, 6162 author = {W. D. Gropp and D. K. Kaushik and D. E. Keyes and B. F. Smith}, 6163 title = {Performance Modeling and Tuning of an Unstructured Mesh {CFD} Application}, 6164 booktitle = {Proceedings of SC2000}, 6165 editor = {}, 6166 publisher = {IEEE Computer Society}, 6167 year = {2000}, 6168 url = {http://www.mcs.anl.gov/petsc-fun3d/Papers/sc00.pdf}, 6169 petsc_uses = {KSP} 6170} 6171 6172@InProceedings{ knepleysamehsarin99, 6173 author = {Matthew Knepley and Ahmed H. Sameh and Vivek Sarin}, 6174 title = {Design of Large Scale Parallel Simulations}, 6175 booktitle = {Proceedings of Parallel CFD'99}, 6176 editors = {A. {Ecer et al.}}, 6177 publisher = {Elsevier}, 6178 year = {1999}, 6179 petsc_uses = {KSP} 6180} 6181 6182@InProceedings{ gkks-pcfd99, 6183 author = {William D. Gropp and Dinesh K. Kaushik and David E. Keyes and Barry F. Smith}, 6184 title = {Towards Realistic Performance Bounds for Implicit {CFD} codes}, 6185 booktitle = {Proceedings of Parallel CFD'99}, 6186 editors = {A. {Ecer et al.}}, 6187 publisher = {Elsevier}, 6188 url = {http://www.cs.odu.edu/~keyes/papers/pcfd99_gkks.pdf}, 6189 year = {1999}, 6190 petsc_uses = {KSP} 6191} 6192 6193@InProceedings{ kks97, 6194 author = {D. K. Kaushik and D. E. Keyes and B. F. Smith}, 6195 title = {On the Interaction of Architecture and Algorithm in the Domain-Based 6196 Parallelization of an Unstructured Grid Incompressible Flow Code}, 6197 booktitle = {Proceedings of the 10th International Conference on Domain Decomposition 6198 Methods}, 6199 editor = {J. Mandel et al.}, 6200 pages = {311--319}, 6201 publisher = {Wiley}, 6202 note = {}, 6203 year = {1997}, 6204 petsc_uses = {KSP} 6205} 6206 6207@InProceedings{ kks99, 6208 author = {D. K. Kaushik and D. E. Keyes and B. F. Smith}, 6209 title = {{N}ewton-{K}rylov-{S}chwarz Methods for Aerodynamic Problems: Compressible and 6210 Incompressible Flows on Unstructured Grids}, 6211 booktitle = {Proceedings of the 11th International Conference on Domain Decomposition 6212 Methods}, 6213 editors = {C.-H. {Lai et al.}}, 6214 publisher = {Domain Decomposition Press, Bergen}, 6215 url = {ftp://info.mcs.anl.gov/pub/tech_reports/reports/P745.ps.Z}, 6216 year = {1999}, 6217 petsc_uses = {KSP} 6218} 6219 6220@InCollection{ kks97_cfd, 6221 author = {D. E. Keyes and D. K. Kaushik and B. F. Smith}, 6222 title = {Perspectives for {CFD} on Petaflops Systems}, 6223 booktitle = {CFD Review 1998}, 6224 editor = {M. Hafez and K. Oshima}, 6225 publisher = {World Scientific, Singapore}, 6226 pages = {1079--1096}, 6227 note = {}, 6228 year = {1998}, 6229 petsc_uses = {KSP} 6230} 6231 6232@Article{ hm99, 6233 author = {P. D. Hovland and L. C. McInnes}, 6234 title = {Parallel Simulation of Compressible Flow Using Automatic Differentiation and 6235 {PETSc}}, 6236 year = {2000}, 6237 journal = {Parallel Computing}, 6238 url = {ftp://info.mcs.anl.gov/pub/tech_reports/reports/P796.ps.Z}, 6239 note = {special issue of Parallel Computing on ``Parallel Computing in Aerospace''}, 6240 petsc_uses = {KSP} 6241} 6242 6243@InProceedings{ cruzbarbaknepley08, 6244 author = {Felipe A. Cruz and Lorena A. Barba and Matthew G. Knepley}, 6245 title = {Fast Multipole Method for particle interactions: an open source parallel library 6246 component}, 6247 booktitle = {Proceedings of ParCFD2008}, 6248 year = {2008}, 6249 editor = {Tromeur-Dervout et. al.}, 6250 publisher = {Elsevier}, 6251 petsc_uses = {KSP} 6252} 6253 6254@Article{ hwangcai05, 6255 author = {F.-N. Hwang and X.-C. Cai}, 6256 title = {A parallel nonlinear additive {Schwarz} preconditioned inexact {Newton} algorithm 6257 for incompressible {Navier-Stokes} equations}, 6258 journal = {J. Comput. Phys.}, 6259 volume = {204}, 6260 year = {2005}, 6261 pages = {666--691}, 6262 petsc_uses = {KSP} 6263} 6264 6265@Article{ barbaleonard07, 6266 author = {Lorena A Barba and Anthony Leonard}, 6267 title = {Emergence and evolution of tripole vortices from net-circulation initial 6268 conditions}, 6269 journal = {Phys. Fluids}, 6270 volume = {19}, 6271 pages = {017101}, 6272 year = {2007}, 6273 doi = {10.1063/1.2409734}, 6274 petsc_uses = {KSP} 6275} 6276 6277@Article{ barba07, 6278 author = {Lorena A Barba}, 6279 title = {Non-shielded multipolar vortices at high Reynolds number}, 6280 journal = {Phys. Rev. E}, 6281 volume = {73}, 6282 pages = {065303}, 6283 year = {2006}, 6284 doi = {10.1103/PhysRevE.73.065303}, 6285 petsc_uses = {KSP} 6286} 6287 6288@Article{ schofield2010multi, 6289 title = {Multi-material incompressible flow simulation using the moment-of-fluid method}, 6290 author = {Schofield, S.P. and Christon, M.A. and Dyadechko, V. and Garimella, R.V. and 6291 Lowrie, R.B. and Swartz, B.K.}, 6292 journal = {International Journal for Numerical Methods in Fluids}, 6293 volume = {63}, 6294 number = {8}, 6295 pages = {931--952}, 6296 year = {2010}, 6297 publisher = {Wiley Online Library}, 6298 petsc_uses = {KSP} 6299} 6300 6301% LiteralHTML: 6302% LiteralHTML: <a name="wave"><H3><center>Wave propagation and the Helmholtz equation</center></H3> 6303% LiteralHTML: 6304% LiteralHTML: article{DeGersem99, 6305% LiteralHTML: author = {Ji Wng and Yu Wang and Wen-ke Hu and Jian-ke Du}, 6306% LiteralHTML: title = {The high performance of finite element analysis and applications of surface acoustic waves in finite elastic solids}, 6307% LiteralHTML: } 6308@Article{ nagler2014, 6309 title = {Sound transmission through a poroelastic layered panel}, 6310 author = {Loris Nagler and Ping Rong and Martin Schanz and Otto von Estorff}, 6311 journal = {Computational Mechanics}, 6312 volume = {53}, 6313 number = {4}, 6314 pages = {549--560}, 6315 issn = {1432-0924}, 6316 doi = {10.1007/s00466-013-0916-x}, 6317 year = {2014}, 6318 petsc_uses = {KSP} 6319} 6320 6321@Article{ sheikh2013, 6322 author = {Sheikh, A. H. and Lahaye, D. and Vuik, C.}, 6323 title = {On the convergence of shifted {L}aplace preconditioner combined with multilevel 6324 deflation}, 6325 journal = {Numerical Linear Algebra with Applications}, 6326 volume = {20}, 6327 number = {4}, 6328 issn = {1099-1506}, 6329 doi = {10.1002/nla.1882}, 6330 pages = {645--662}, 6331 keywords = {Helmholtz equation, shifted Laplace preconditioner, multigrid deflation, Fourier 6332 analysis}, 6333 year = {2013}, 6334 petsc_uses = {KSP} 6335} 6336 6337@InProceedings{ silence, 6338 author = {J.M. and Alonso and G. Garcia and V. Hernandez and F.D. Denia and F.J. 6339 Fuenmayor}, 6340 title = {A parallel computing approach for solving the Helmholtz equation in 3D domains: 6341 Application to the study of acoustic behaviour of silencers}, 6342 year = {2004}, 6343 booktitle = {Eurppean Congress on Computational Methods in Applied Sciences and Engineering 6344 (ECCOMAS)}, 6345 petsc_uses = {KSP} 6346} 6347 6348@Article{ degersem99, 6349 author = {H. De Gersem and Domenico Lahaye and S. Vandewalle and K. Hameyer}, 6350 title = {Comparison of Quasi Minimal Residual and Bi-Conjugate Gradient Iterative Methods 6351 to Solve Complex Symmetric Systems Arising from Time-Harmonic Simulations}, 6352 journal = {COMPEL}, 6353 year = {1999}, 6354 volume = {18}, 6355 number = {3}, 6356 pages = {298--310}, 6357 bibdate = {}, 6358 petsc_uses = {KSP} 6359} 6360 6361@InProceedings{ widlund-wave-98, 6362 author = {Olof B. Widlund}, 6363 title = {Schwarz Methods for {H}elmholtz's Equation}, 6364 booktitle = {Mathematical and Numerical Aspects of Wave Propagation}, 6365 editor = {John A. DeSanto}, 6366 year = {1998}, 6367 publisher = {SIAM}, 6368 pages = {620--622}, 6369 address = {Philadelphia}, 6370 note = {Proceedings of the Fourth International Conference on Mathematical and Numerical 6371 Aspects of Wave Propagation, Golden, Colorado, June 1--5}, 6372 petsc_uses = {KSP} 6373} 6374 6375@InProceedings{ toselli-wave-98, 6376 author = {Andrea Toselli}, 6377 title = {Overlapping {S}chwarz Methods for {M}axwell's Equations in Conductive Media}, 6378 booktitle = {Mathematical and Numerical Aspects of Wave Propagation}, 6379 editor = {John A. DeSanto}, 6380 year = {1998}, 6381 publisher = {SIAM}, 6382 address = {Philadelphia}, 6383 pages = {540--542}, 6384 note = {Proceedings of the Fourth International Conference on Mathematical and Numerical 6385 Aspects of Wave Propagation, Golden, Colorado, June 1--5}, 6386 petsc_uses = {KSP} 6387} 6388 6389@InProceedings{ mcinnes-wave-98, 6390 author = {L. C. McInnes and R. Susan-Resiga and H. M. Atassi and D. E. Keyes}, 6391 title = {Parallel Solution of {H}elmholtz Problems using Additive {S}chwarz Methods}, 6392 booktitle = {Mathematical and Numerical Aspects of Wave Propagation}, 6393 editor = {John A. DeSanto}, 6394 year = {1998}, 6395 publisher = {SIAM}, 6396 address = {Philadelphia}, 6397 pages = {623--625}, 6398 note = {Proceedings of the Fourth International Conference on Mathematical and Numerical 6399 Aspects of Wave Propagation, Golden, Colorado, June 1--5}, 6400 petsc_uses = {KSP} 6401} 6402 6403@InProceedings{ mska98, 6404 author = {L. C. McInnes and R. Susan-Resiga and D. E. Keyes and H. M. Atassi}, 6405 title = {Additive {S}chwarz Methods with Nonreflecting Boundary Conditions for the 6406 Parallel Computation of {H}elmholtz Problems}, 6407 booktitle = {Proceedings of the 10th Intl. Conf. on Domain Decomposition Methods}, 6408 editor = {J. Mandel et al.}, 6409 publisher = {AMS}, 6410 pages = {349--357}, 6411 year = {1998}, 6412 petsc_uses = {KSP} 6413} 6414 6415@InProceedings{ ccew98, 6416 author = {X.-C. Cai and M. A. Casarin, Jr. and F. W. Elliott, Jr. and O. B. Widlund}, 6417 title = {Overlapping {S}chwarz Algorithms for Solving {H}elmholtz's Equation}, 6418 booktitle = {Proceedings of the 10th Intl. Conf. on Domain Decomposition Methods}, 6419 editor = {J. Mandel et al.}, 6420 publisher = {AMS}, 6421 pages = {437-445}, 6422 year = {1998}, 6423 petsc_uses = {KSP} 6424} 6425 6426@InProceedings{ ra98a, 6427 author = {R. Susan-Resiga and H. M. Atassi}, 6428 title = {Parallel Computing Using {S}chwarz Domain Decomposition Method for Aeroacoustic 6429 Problems}, 6430 booktitle = {Proceedings of the 4th AIAA/CEAS Aeroacoustics Conference}, 6431 publisher = {AIAA}, 6432 pages = {86-96}, 6433 note = {AIAA paper 98-2218}, 6434 year = {1998}, 6435 petsc_uses = {KSP} 6436} 6437 6438@InProceedings{ ar98c, 6439 author = {H. M. Atassi and R. Susan-Resiga}, 6440 title = {Parallel Computation of Harmonic Waves using Domain Decomposition, Part {I}: 6441 General Formulation}, 6442 booktitle = {Proceedings of the ASME Noise Control and Acoustics Division}, 6443 publisher = {ASME}, 6444 note = {NCA-25}, 6445 pages = {375-379}, 6446 year = {1998}, 6447 petsc_uses = {KSP} 6448} 6449 6450@InProceedings{ ra98b, 6451 author = {R. Susan-Resiga and H. M. Atassi}, 6452 title = {Parallel Computation of Harmonic Waves using Domain Decomposition, Part {II}: 6453 Numerical Implementation and Applications}, 6454 booktitle = {Proceedings of the ASME Noise Control and Acoustics Division}, 6455 publisher = {ASME}, 6456 note = {NCA-25}, 6457 pages = {381 -388}, 6458 year = {1998}, 6459 petsc_uses = {KSP} 6460} 6461 6462@InProceedings{ cai-dd10-98, 6463 author = {Xiao-Chuan Cai and Mario A. Casarin and Frank W. Elliott, Jr. and Olof B. 6464 Widlund}, 6465 title = {Overlapping {S}chwarz methods for solving {H}elmholtz's Equation}, 6466 booktitle = {Domain Decomposition Methods 10}, 6467 editors = {Jan Mandel and Charbel Farhat and Xiao-Chuan Cai}, 6468 series = {Contemporary Mathematics}, 6469 volume = {218}, 6470 publisher = {American Mathematical Society}, 6471 address = {Providence, Rhode Island}, 6472 year = {1998}, 6473 pages = {437--445}, 6474 petsc_uses = {KSP} 6475} 6476 6477@InProceedings{ alghamdi2011petclaw, 6478 title = {Pet{C}law: A Scalable Parallel Nonlinear Wave Propagation Solver for {P}ython}, 6479 booktitle = {Proceedings of SpringSim 2011}, 6480 publisher = {ACM}, 6481 author = {Amal Alghamdi and Aron Ahmadia and David I. Ketcheson and Matthew G. Knepley and 6482 Kyle T. Mandli and Lisandro Dalcin}, 6483 year = {2011}, 6484 petsc_uses = {KSP} 6485} 6486 6487@Article{ pyclaw2012, 6488 author = {David I. Ketcheson and Kyle T. Mandli and Aron J. Ahmadia and Amal Alghamdi and 6489 Manuel Quezada de Luna and Matteo Parsani and Matthew G. Knepley and Matthew 6490 Emmett}, 6491 title = {{PyClaw}: Accessible, Extensible, Scalable Tools for Wave Propagation Problems}, 6492 journal = {SIAM Journal on Scientific Computing}, 6493 volume = {34}, 6494 number = {4}, 6495 pages = {C210--C231}, 6496 note = {\url{http://arxiv.org/abs/1111.6583}}, 6497 year = {2012}, 6498 petsc_uses = {KSP} 6499} 6500 6501% LiteralHTML: 6502% LiteralHTML: <a name="optimization"><H3><center>Optimization</center></H3> 6503% LiteralHTML: 6504@Article{ sojkahorakhaplacermak2018, 6505 title = {The impact of enabling multiple subdomains per MPI process in the TFETI domain 6506 decomposition method}, 6507 author = {Radim Sojka and David Hor{\'a}k and V{\'a}clav Hapla and Martin {\v{C}}erm{\'a}k}, 6508 journal = {Applied Mathematics and Computation}, 6509 volume = {319}, 6510 pages = {586--597}, 6511 year = {2018}, 6512 petsc_uses = {KSP} 6513} 6514 6515@Article{ chencai2014, 6516 title = {A parallel two-level domain decomposition based one-shot method for shape 6517 optimization problems}, 6518 author = {Rongliang Chen and Xiao‐Chuan Cai}, 6519 journal = {International Journal for Numerical Methods in Engineering}, 6520 volume = {99}, 6521 number = {13}, 6522 year = {2014}, 6523 doi = {10.1002/nme.4711}, 6524 petsc_uses = {KSP} 6525} 6526 6527@PhDThesis{ prudencio2005, 6528 author = {Ernesto Prudencio}, 6529 title = {Parallel Fully Coupled {Lagrange-Newton-Krylov-Schwarz} Algorithms and Software 6530 for Optimization Problems Constrained by Partial Differential Equations}, 6531 school = {University of Colorado, Boulder}, 6532 year = {2005}, 6533 petsc_uses = {KSP} 6534} 6535 6536@Article{ prudenciocai2007, 6537 title = {Parallel multilevel restricted {Schwarz} preconditioners with pollution removing 6538 for {PDE}-constrained optimization}, 6539 author = {Ernesto Prudencio and X. C. Cai}, 6540 journal = {SIAM J. Sci. Comp.}, 6541 volume = {29}, 6542 number = {3}, 6543 pages = {964--985}, 6544 year = {2007}, 6545 petsc_uses = {KSP} 6546} 6547 6548@Article{ prudenciobyrdcai2006, 6549 author = {Ernesto Prudencio and R. Byrd and X. C. Cai}, 6550 title = {Parallel full space {SQP Lagrange-Newton-Krylov-Schwarz} algorithms for 6551 {PDE}-constrained Optimization Problems}, 6552 journal = {SIAM J. Sci. Comp.}, 6553 volume = {27}, 6554 pages = {1305--1328}, 6555 year = {2006}, 6556 petsc_uses = {KSP} 6557} 6558 6559@InProceedings{ prudenciobyrdcai2004, 6560 title = {Domain decomposition methods for {PDE}-constrained optimization problems}, 6561 author = {Ernesto Prudencio and R. Byrd and X. C. Cai}, 6562 booktitle = {VECPAR 2004}, 6563 editor = {M. Dayde and J. Dongarra and V. Hernandex and J. Palma}, 6564 publisher = {Springer}, 6565 pages = {569--582}, 6566 year = {2004}, 6567 petsc_uses = {KSP} 6568} 6569 6570@Article{ belhamadia-fortin-pcp, 6571 author = {Youssef Belhamadia and Andre Fortin and Eric Chamberland}, 6572 title = {Three-dimensional anisotropic mesh adaptation for phase change problems}, 6573 journal = {Journal of Computational Physics}, 6574 volume = {201}, 6575 pages = {753-770}, 6576 year = {2004}, 6577 url = {http://portal.acm.org/citation.cfm?id=1055817.1055834#references}, 6578 petsc_uses = {KSP} 6579} 6580 6581@Article{ biros00, 6582 author = {George Biros and Omar Ghattas}, 6583 title = {A {Lagrange-Newton-Krylov-Schur} Method for {PDE} Constrained Optimization}, 6584 journal = {SIAG-Opt Views and News}, 6585 volume = {11}, 6586 number = {2}, 6587 year = {2000}, 6588 month = aug, 6589 url = {http://www.cs.cmu.edu/\~{ }oghattas/papers/siag-opt/siag-opt.pdf}, 6590 petsc_uses = {KSP} 6591} 6592 6593@Article{ bmm01, 6594 author = {Steve Benson and Lois Curfman McInnes and Jorge Mor\'{e}}, 6595 journal = {ACM Transactions on Mathematical Software}, 6596 title = {A case study in the performance and scalability of optimization algorithms}, 6597 year = {2001}, 6598 volume = {27}, 6599 number = {3}, 6600 pages = {361--376}, 6601 petsc_uses = {KSP} 6602} 6603 6604@InProceedings{ oghattas1999, 6605 author = {George Biros and Omar Ghattas}, 6606 title = {Parallel preconditioners for {KKT} systems arising in optimal control of viscous 6607 incompressible flows}, 6608 booktitle = {Proceedings of Parallel CFD '99, Williamsburg, Virginia, USA, May 23-26, 1999}, 6609 url = {http://www.cs.cmu.edu/\~{ }oghattas/papers/pcfd99/pcfd99.pdf}, 6610 year = {1999}, 6611 petsc_uses = {KSP} 6612} 6613 6614@InProceedings{ hkms00, 6615 title = {Using Automatic Differentiation for Second-order Matrix-free Methods in 6616 PDE-constrained Optimization}, 6617 author = {P. D. Hovland and D. E. Keyes and L. C. McInnes and W. Samyono}, 6618 url = {http://www.icase.edu/\~{ }keyes/papers/ad2000.ps}, 6619 booktitle = {Automatic Differentiation of Algorithms: From Simulation to Optimization}, 6620 editor = {George Corliss and Christ\`{e}le Faure and Andreas Griewank and Laurent 6621 Hasco\"{e}t and Uwe Naumann}, 6622 publisher = {Springer}, 6623 year = {2002}, 6624 petsc_uses = {KSP} 6625} 6626 6627% old version: replace with biros2005pln1 6628@TechReport{ bg011, 6629 author = {George Biros and Omar Ghattas}, 6630 title = {Parallel Lagrange-Newton-Krylov-Schur Methods for PDE-Constrained Optimization. 6631 Part I: The Krylov-Schur Solver}, 6632 institution = {Laboratory for Mechanics, Algorithms, and Computing, Carnegie Mellon University}, 6633 year = {2001}, 6634 url = {http://www.cs.cmu.edu/\~{ }oghattas/papers/lnks/lnks1.pdf}, 6635 petsc_uses = {KSP} 6636} 6637 6638% old version: replace with biros2005pln2 6639@TechReport{ bg012, 6640 author = {George Biros and Omar Ghattas}, 6641 title = {Parallel {Lagrange-Newton-Krylov-Schur} Methods for {PDE}-Constrained 6642 Optimization. Part II: The {Lagrange-Newton} Solver, and its Application to 6643 Optimal Control of Steady Viscous Flows}, 6644 institution = {Laboratory for Mechanics, Algorithms, and Computing, Carnegie Mellon University}, 6645 year = {2001}, 6646 url = {http://www.cs.cmu.edu/\~{ }oghattas/papers/lnks/lnks2.pdf}, 6647 petsc_uses = {KSP} 6648} 6649 6650% LiteralHTML: 6651% LiteralHTML: <a name="fastmethods"><H3><center>Fast Algorithms</center></H3> 6652% LiteralHTML: 6653@InProceedings{ ly2003, 6654 author = {Lexing Ying and G. Biros and D. Zorin and H. Langston}, 6655 title = {A New Parallel Kernel-independent Fast Multipole Method}, 6656 booktitle = {Proceedings of the ACM/IEEE conference on Supercomputing 2003}, 6657 year = {2003}, 6658 note = {Winner of the Best Student Paper at SC2003}, 6659 petsc_uses = {KSP} 6660} 6661 6662@Article{ yokotabarbaknepley10, 6663 author = {Rio Yokota and L A Barba and Matthew G Knepley}, 6664 title = {{PetRBF} -- A parallel {O(N)} algorithm for radial basis function interpolation}, 6665 journal = {Computer Methods in Applied Mechanics and Engineering}, 6666 volume = {199}, 6667 number = {25-28}, 6668 pages = {1793--1804}, 6669 url = {http://arxiv.org/abs/0909.5413v1}, 6670 note = {\url{http://arxiv.org/abs/0909.5413v1}}, 6671 year = {2010}, 6672 petsc_uses = {KSP} 6673} 6674 6675@Article{ cruzknepleybarba10, 6676 author = {Felipe A. Cruz and Matthew G Knepley and L A Barba}, 6677 title = {{PetFMM} -- A dynamically load-balancing parallel fast multipole library}, 6678 journal = {International Journal of Numerical Methods in Engineering}, 6679 volume = {85}, 6680 number = {4}, 6681 pages = {403--428}, 6682 url = {http://arxiv.org/abs/0905.2637}, 6683 note = {\url{http://arxiv.org/abs/0905.2637}}, 6684 year = {2010}, 6685 petsc_uses = {KSP} 6686} 6687 6688% LiteralHTML: 6689% LiteralHTML: <a name="otherapps"><H3><center>Other Application Areas</center></H3> 6690% LiteralHTML: 6691@Article{ buchanpainumplebysmedleystevenson2012, 6692 title = {A sub-grid scale finite element agglomeration multigrid method with application 6693 to the Boltzmann transport equation}, 6694 author = {AG Buchan and CC Pain and AP Umpleby and RP Smedley-Stevenson}, 6695 journal = {International Journal for Numerical Methods in Engineering}, 6696 volume = {92}, 6697 number = {3}, 6698 pages = {318--342}, 6699 year = {2012}, 6700 publisher = {Wiley Online Library}, 6701 petsc_uses = {KSP} 6702} 6703 6704@Article{ magoulesahamedsuzuki2015, 6705 title = {Green computing on graphics processing units}, 6706 author = {Fr{\'e}d{\'e}ric Magoul{\`e}s and Abal-Kassim Cheik Ahamed and Atsushi Suzuki}, 6707 journal = {Concurrency and Computation: Practice and Experience}, 6708 year = {2015}, 6709 publisher = {Wiley Online Library}, 6710 petsc_uses = {KSP} 6711} 6712 6713@InProceedings{ yanrhodes11, 6714 author = {Yan, Baoqiang and Rhodes, Philip J.}, 6715 title = {IDEA -- An API for Parallel Computing with Large Spatial Datasets}, 6716 booktitle = {Proceedings of the 2011 International Conference on Parallel Processing}, 6717 series = {ICPP '11}, 6718 pages = {355--364}, 6719 year = {2011}, 6720 isbn = {978-0-7695-4510-3}, 6721 numpages = {10}, 6722 doi = {10.1109/ICPP.2011.70}, 6723 acmid = {2066965}, 6724 publisher = {IEEE Computer Society}, 6725 address = {Washington, DC, USA}, 6726 keywords = {cluster, parallelization, spatial dataset, dependency, data partitioning}, 6727 petsc_uses = {KSP} 6728} 6729 6730@Article{ hakansson2013mdstochasticliouville, 6731 author = {Hakansson, Par and Nguyen, ThaoNguyen and Nair, Prasanth B. and Edge, Ruth and 6732 Stulz, Eugen}, 6733 title = {Cu(ii)-porphyrin molecular dynamics as seen in a novel EPR/Stochastic Liouville 6734 equation study}, 6735 journal = {Phys. Chem. Chem. Phys.}, 6736 year = {2013}, 6737 volume = {15}, 6738 issue = {26}, 6739 pages = {10930-10941}, 6740 publisher = {The Royal Society of Chemistry}, 6741 doi = {10.1039/C3CP50788B}, 6742 petsc_uses = {KSP} 6743} 6744 6745@Article{ hakansson2011stochasticliouville, 6746 author = {Hakansson, Par and Nair, Prasanth B.}, 6747 title = {Implicit numerical schemes for the stochastic Liouville equation in Langevin 6748 form}, 6749 journal = {Phys. Chem. Chem. Phys.}, 6750 year = {2011}, 6751 volume = {13}, 6752 issue = {20}, 6753 pages = {9578-9589}, 6754 publisher = {The Royal Society of Chemistry}, 6755 doi = {10.1039/C1CP20400A}, 6756 petsc_uses = {KSP} 6757} 6758 6759@InProceedings{ wang:lee:scidac2011, 6760 author = {Lei Wang and Jungho Lee and Mihai Anitescu and Anter El Azab and Lois Curfman 6761 McInnes and Todd Munson and Barry Smith}, 6762 title = {A Differential Variational Inequality Approach for the Simulation of 6763 Heterogeneous Materials}, 6764 booktitle = {Proceedings of SciDAC 2011 Conference}, 6765 year = {2011}, 6766 petsc_uses = {KSP} 6767} 6768 6769@Article{ bourdinlarsenrichardson2011, 6770 author = {Blaise Bourdin and Christopher Larsen and Casey Richardson}, 6771 title = {A time-discrete model for dynamic fracture based on crack regularization}, 6772 journal = {International Journal of Fracture}, 6773 volume = {168}, 6774 issue = {2}, 6775 pages = {133--143}, 6776 doi = {10.1007/s10704-010-9562-x}, 6777 year = {2011}, 6778 petsc_uses = {KSP} 6779} 6780 6781@Article{ bourdinfrancfortmarigo2008, 6782 author = {Blaise Bourdin and Gilles Francfort and Jean-Jacques Marigo}, 6783 title = {The Variational Approach to Fracture}, 6784 journal = {J. Elasticity}, 6785 volume = {91}, 6786 issue = {1}, 6787 pages = {1--148}, 6788 doi = {10.1007/s10659-007-9107-3}, 6789 year = {2008}, 6790 petsc_uses = {KSP} 6791} 6792 6793@Article{ lahtinen2008spectrum, 6794 title = {Spectrum of the non-abelian phase in Kitaev's honeycomb lattice model}, 6795 author = {Lahtinen, V. and Kells, G. and Carollo, A. and Stitt, T. and Vala, J. and Pachos, 6796 J.K.}, 6797 journal = {Annals of Physics}, 6798 volume = {323}, 6799 number = {9}, 6800 pages = {2286--2310}, 6801 year = {2008}, 6802 publisher = {Elsevier}, 6803 petsc_uses = {KSP} 6804} 6805 6806@InProceedings{ roark2004discriminative, 6807 title = {Discriminative language modeling with conditional random fields and the 6808 perceptron algorithm}, 6809 author = {Roark, B. and Saraclar, M. and Collins, M. and Johnson, M.}, 6810 booktitle = {Proceedings of the 42nd Annual Meeting on Association for Computational 6811 Linguistics}, 6812 pages = {47}, 6813 year = {2004}, 6814 organization = {Association for Computational Linguistics}, 6815 petsc_uses = {KSP} 6816} 6817 6818@Article{ roark2007discriminative, 6819 title = {Discriminative n-gram language modeling}, 6820 author = {Roark, B. and Saraclar, M. and Collins, M.}, 6821 journal = {Computer Speech \& Language}, 6822 volume = {21}, 6823 number = {2}, 6824 pages = {373--392}, 6825 year = {2007}, 6826 publisher = {Elsevier}, 6827 petsc_uses = {KSP} 6828} 6829 6830@Conference{ garcia2011parallel, 6831 title = {{Parallel performance of the PETSc Krylov methods applied to linear systems of 3D 6832 nanodevice simulators}}, 6833 author = {Garcia-Rivera, A. and Valin, R. and Seoane, N. and Garcia-Loureiro, A. and 6834 Aldegunde, M.}, 6835 booktitle = {Electron Devices (CDE), 2011 Spanish Conference on}, 6836 pages = {1--4}, 6837 organization = {IEEE}, 6838 petsc_uses = {KSP} 6839} 6840 6841@Conference{ wesley2006parallel, 6842 title = {{A parallel artificial neural network implementation}}, 6843 author = {Wesley-Smith, I.}, 6844 booktitle = {Proceedings of The National Conference On Undergraduate Research (NCUR)}, 6845 year = {2006}, 6846 petsc_uses = {KSP} 6847} 6848 6849@Article{ hcsw1, 6850 author = {F.-N. Hwang and S.-R. Cai and Y.-L. Shao and J.-S. Wu}, 6851 title = {Parallel {N}ewton--{K}rylov--{S}chwarz algorithms for the three-dimensional 6852 {P}oisson--{B}oltzmann equation in numerical simulation of colloidal particle 6853 interactions}, 6854 journal = {Computer Physics Communications}, 6855 volumne = {181}, 6856 year = {2010}, 6857 pages = {1529--1537}, 6858 petsc_uses = {KSP} 6859} 6860 6861@Article{ hh1, 6862 author = {C.-Y. Huang and F.-N. Hwang}, 6863 title = {Parallel pseudo-transient Newton-Krylov-Schwarz continuation algorithms for 6864 bifurcation analysis of incompressible sudden expansion flows}, 6865 journal = {Applied Numerical Mathematics}, 6866 volume = {60}, 6867 year = {2010}, 6868 pages = {738--751}, 6869 petsc_uses = {KSP} 6870} 6871 6872@Article{ hwhw1, 6873 author = {F.-N. Hwang and Z.-H. Wei and T.-M. Huang and W. Wang}, 6874 title = {A parallel additive Schwarz preconditioned Jacobi-Davidson algorithm for 6875 polynomial eigenvalue problems in quantum dot simulation}, 6876 journal = {Journal of Computational Physics}, 6877 volume = {229}, 6878 year = {2010}, 6879 pages = {2932--2947}, 6880 petsc_uses = {KSP} 6881} 6882 6883@Article{ wei2011parallel, 6884 title = {{A Parallel Scalable PETSc-Based Jacobi-Davidson Polynomial Eigensolver with 6885 Application in Quantum Dot Simulation}}, 6886 author = {Wei, Z.H. and Hwang, F.N. and Huang, T.M. and Wang, W.}, 6887 journal = {Domain Decomposition Methods in Science and Engineering XIX}, 6888 pages = {157--164}, 6889 year = {2011}, 6890 publisher = {Springer}, 6891 petsc_uses = {KSP} 6892} 6893 6894@Article{ flores2007sequential, 6895 title = {{Sequential and parallel resolution of the two-group transient neutron diffusion 6896 equation using second-degree iterative methods}}, 6897 author = {Flores-S{\'a}nchez, O. and Vidal, V. and Garc{\'\i}a, V. and Flores-S{\'a}nchez, P.}, 6898 journal = {High Performance Computing for Computational Science-VECPAR 2006}, 6899 pages = {426--438}, 6900 year = {2007}, 6901 publisher = {Springer}, 6902 petsc_uses = {KSP} 6903} 6904 6905@InProceedings{ gordonbell09, 6906 author = {Dinesh Kaushik and Michael Smith and Allan Wollaber and Barry Smith and Andrew 6907 Siegel and Won Sik Yang}, 6908 title = {Enabling High Fidelity Neutron Transport Simulations on Petascale Architectures}, 6909 booktitle = {ACM/IEEE Proceedings of SC2009: High Performance Networking and Computing}, 6910 note = {{SC'09 Gordon Bell} Prize Finalist}, 6911 year = {2009}, 6912 petsc_uses = {KSP} 6913} 6914 6915@Article{ knepleykarpeevdavidovitseisenberggillespie10, 6916 author = {Matthew G. Knepley and Dmitry A. Karpeev and Seth Davidovits and Robert~S. 6917 Eisenberg and Dirk Gillespie}, 6918 title = {An Efficient Algorithm for Classical Density Functional Theory in Three 6919 Dimensions: Ionic Solutions}, 6920 journal = {Journal of Physical Chemistry}, 6921 volume = {132}, 6922 number = {12}, 6923 pages = {124101--124111}, 6924 url = {http://arxiv.org/abs/0910.1531}, 6925 year = {2010}, 6926 petsc_uses = {KSP} 6927} 6928 6929@Article{ knepleykarpeeveisenberggillespie09, 6930 author = {{Knepley}, M.~G. and {Karpeev}, D.~A. and {Eisenberg}, R.~S. and {Gillespie}, 6931 D.}, 6932 title = {{Energetics of Calcium Selectivity: A Three-Dimensional Classical Density 6933 Functional Theory Approach}}, 6934 journal = {Biophysical Journal}, 6935 month = feb, 6936 volume = {96}, 6937 pages = {661}, 6938 doi = {10.1016/j.bpj.2008.12.3494}, 6939 year = {2009}, 6940 petsc_uses = {KSP} 6941} 6942 6943@Article{ scx2008, 6944 author = {SUWITO AND XIAO-CHUAN CAI AND YUNPING XI}, 6945 title = {PARALLEL FINITE ELEMENT METHOD FOR COUPLED CHLORIDE MOISTURE DIFFUSION IN 6946 CONCRETE}, 6947 journal = {INTERNATIONAL JOURNAL OF NUMERICAL ANALYSIS AND MODELING}, 6948 volume = {3}, 6949 number = {4}, 6950 year = {2006}, 6951 url = {http://www.math.ualberta.ca/ijnam/Volume-3-2006/No-4-06/2006-04-06.pdf}, 6952 petsc_uses = {KSP} 6953} 6954 6955@TechReport{ kdgs2008, 6956 year = {2008}, 6957 school = {Centro Internacional de Methodos Numericos en Ingenieria, Argentina}, 6958 title = {High Performance Simulations of Electrokinetic Flow and Transport in Microfluidic 6959 Chips}, 6960 author = {Pablo A. Klera and Lisandro D. Dalcin and Fabio A. Guarnieria and Mario A. 6961 Stortia}, 6962 url = {http://www.cimec.org.ar/ojs/index.php/cmm/article/view/1383}, 6963 petsc_uses = {KSP} 6964} 6965 6966@Article{ springerlink:10.1007/s10915-011-9551-x, 6967 author = {Schauer, Marco and Roman, Jose and Quintana-Ortí, Enrique and Langer, Sabine}, 6968 affiliation = {Institut für Angewandte Mechanik, Technische Universität Carolo-Wilhelmina zu 6969 Braunschweig, Spielmannstraße 11, 38106 Braunschweig, Germany}, 6970 title = {Parallel Computation of 3-D Soil-Structure Interaction in Time Domain with a 6971 Coupled FEM/SBFEM Approach}, 6972 journal = {Journal of Scientific Computing}, 6973 publisher = {Springer Netherlands}, 6974 issn = {0885-7474}, 6975 keyword = {Mathematics and Statistics}, 6976 pages = {1-22}, 6977 doi = {10.1007/s10915-011-9551-x}, 6978 petsc_uses = {KSP} 6979} 6980 6981@TechReport{ jj2007, 6982 author = {Boris Jeremic and Guanzhou Jie}, 6983 title = {Parallel Finite Element Computations for Soil-Foundation-Structure Interaction 6984 Problems Report}, 6985 institution = {UCD CompGeoMech 02--2007}, 6986 year = {2007}, 6987 url = {http://sokocalo.engr.ucdavis.edu/~jeremic/wwwpublications/CV-R23.pdf}, 6988 petsc_uses = {KSP} 6989} 6990 6991@Unpublished{ kuiper08, 6992 title = {Fast 3D frequency-dependent Radiative Transfer for Magneto-Hydrodynamics}, 6993 author = {Rolf Kuiper}, 6994 institution = {Max-Planck-Institute for Astronomy}, 6995 url = {http://www.mpia.de/~kuiper/MAKEMAKE.html}, 6996 year = {2008}, 6997 petsc_uses = {KSP} 6998} 6999 7000@Article{ williamson2012multidimensional, 7001 title = {Multidimensional multiphysics simulation of nuclear fuel behavior}, 7002 author = {Williamson, R.L. and Hales, J.D. and Novascone, S.R. and Tonks, M.R. and Gaston, 7003 D.R. and Permann, C.J. and Andrs, D. and Martineau, R.C.}, 7004 journal = {Journal of Nuclear Materials}, 7005 volume = {423}, 7006 number = {1}, 7007 pages = {149--163}, 7008 year = {2012}, 7009 publisher = {Elsevier}, 7010 petsc_uses = {KSP} 7011} 7012 7013@InProceedings{ kucukboyaci2015cobra, 7014 title = {COBRA-TF parallelization and application to PWR reactor core subchannel DNB 7015 analysis}, 7016 author = {Kucukboyaci, Vefa and Sung, Yixing and Salko, Robert}, 7017 booktitle = {Joint International Conference on Mathematics and Computation, Supercomputing in 7018 Nuclear Applications and the Monte Carlo Method}, 7019 pages = {1--18}, 7020 year = {2015}, 7021 petsc_uses = {KSP} 7022} 7023 7024@Article{ hales2012solving, 7025 title = {Solving Nonlinear Solid Mechanics Problems with the {J}acobian-{F}ree {N}ewton 7026 {K}rylov Method}, 7027 author = {Hales, J.D. and Novascone, S.R. and Williamson, R.L. and Gaston, D.R. and Tonks, 7028 M.R.}, 7029 journal = {Computer Modeling in Engineering \& Sciences(CMES)}, 7030 volume = {84}, 7031 number = {2}, 7032 pages = {123--153}, 7033 year = {2012}, 7034 publisher = {Tech Science Press}, 7035 petsc_uses = {KSP} 7036} 7037 7038@InProceedings{ srksyp2008, 7039 author = {M. A. Smith and C. Rabiti and D. Kaushik and B. Smith and W. S. Yang and G. 7040 Palmiotti}, 7041 title = {Fast reactor core simulations using the {UNIC} code}, 7042 booktitle = {Proceedings of the International Conference on the Physics of Reactors, Nuclear 7043 Power: A Sustainable Resource}, 7044 year = {2008}, 7045 petsc_uses = {KSP} 7046} 7047 7048@InProceedings{ psrlkssl2007, 7049 author = {G. Palmiotti and M. A. Smith and C. Rabiti and M. Leclere and D. Kaushik and A. 7050 Siegel and B. Smith and E. E. Lewis}, 7051 title = {{UNIC}: Ultimate Neutronic Investigation Code}, 7052 booktitle = {Joint International Topical Meeting on Mathematics and Computation and 7053 Supercomputing in Nuclear Applications}, 7054 year = {2007}, 7055 petsc_uses = {KSP} 7056} 7057 7058@InProceedings{ sprkssl2007, 7059 author = {M. A. Smith and G. Palmiotti and C. Rabiti and D. Kaushik and A. Siegel and B. 7060 Smith and E. E. Lewis}, 7061 title = {{PNFE} Component of the {UNIC} Code}, 7062 booktitle = {Joint International Topical Meeting on Mathematics and Computation and 7063 Supercomputing in Nuclear Applications}, 7064 year = {2007}, 7065 petsc_uses = {KSP} 7066} 7067 7068@InProceedings{ dc-oop-03, 7069 author = {H. Digonnet and T. Coupez}, 7070 title = {Object-oriented programming for fast-and-easy development of parallel 7071 applications in forming processes simulation}, 7072 booktitle = {Proceedings of the Second MIT Conference on Computational Fluid and Solid 7073 Mechanics}, 7074 year = {2003}, 7075 petsc_uses = {KSP} 7076} 7077 7078@InProceedings{ dc-cfm-03, 7079 author = {H. Digonnet and T. Coupez}, 7080 title = {Calcul parallele en mise en forme des materiaux}, 7081 booktitle = {XVIeme Congres Francais de Mecanique}, 7082 year = {2003}, 7083 petsc_uses = {KSP} 7084} 7085 7086@InProceedings{ dsc-pcsev-04, 7087 author = {H. Digonnet and L. Silva and T. Coupez}, 7088 title = {Parallel computation for solving efficiently viscoelastic fluid flow problems}, 7089 booktitle = {Proceedings of ECCOMAS 2004}, 7090 year = {2004}, 7091 petsc_uses = {KSP} 7092} 7093 7094@InProceedings{ dsc-pca3fs-04, 7095 author = {H. Digonnet and L. Silva and T. Coupez}, 7096 title = {Parallel computation applied to 3D FE simulation of polymer injection molding}, 7097 booktitle = {Proceedings of WCCM VI}, 7098 year = {2004}, 7099 petsc_uses = {KSP} 7100} 7101 7102@InProceedings{ dbcs-cpaac-05, 7103 author = {H. Digonnet and O. Basset and T. Coupez and L. Silva}, 7104 title = {Calcul parallele appliqu aux coulements de fluides complexe}, 7105 booktitle = {Proceedings of Eme Congres Francais de Mecanique}, 7106 year = {2005}, 7107 petsc_uses = {KSP} 7108} 7109 7110@Article{ sz2010, 7111 author = {B. Smith and H. Zhang}, 7112 title = {Sparse Triangular Solves for {ILU} Revisited: Data Layout Crucial to Better 7113 Performance}, 7114 journal = {International Journal of High Performance Computing Applications}, 7115 volume = {25}, 7116 number = {4}, 7117 pages = {386--391}, 7118 year = {2011}, 7119 petsc_uses = {KSP} 7120} 7121 7122@Article{ zssz2006, 7123 author = {H. Zhang and B. Smith and M. Sternberg and P. Zapol}, 7124 title = {{SIPs}: Shift-and-Invert Parallel Spectral Transformations}, 7125 journal = {TOMS}, 7126 url = {http://math.nist.gov/toms/Current.html#v33n2}, 7127 volumne = {33}, 7128 number = {2}, 7129 year = {2007}, 7130 petsc_uses = {KSP} 7131} 7132 7133@Article{ gs2006, 7134 author = {Fang Jin and Nivedita R. Gupta and Kathleen J. Stebe}, 7135 title = {The detachment of a viscous drop in a viscous solution in the presence of a 7136 soluble surfactant}, 7137 journal = {Phys. Fluids}, 7138 volume = {18}, 7139 year = {2006}, 7140 url = {http://scitation.aip.org/dbt/dbt.jsp?KEY=PHFLE6&Volume=LASTVOL&Issue=LASTISS}, 7141 petsc_uses = {KSP} 7142} 7143 7144@Article{ jmemsci, 7145 author = {Bo Zhou and Adam Powell}, 7146 title = {Phase Field Simulations of Liquid-Liquid Demixing During Immersion Precipitation 7147 of Polymeric Membranes in 2D and 3D}, 7148 journal = {J. Membrane Sci.}, 7149 volume = {268}, 7150 number = {2}, 7151 pages = {150--164}, 7152 year = {2006}, 7153 month = jan, 7154 day = {15}, 7155 doi = {10.1016/j.memsci.2005.05.030}, 7156 petsc_uses = {KSP} 7157} 7158 7159@InProceedings{ vbde2002, 7160 author = {Anke Veser and Wolfgang Breitung and Sergey Dorofeev and Alexander Efimenko}, 7161 title = {Flame Acceleration Distance in Obstacle-Laden Tubes}, 7162 booktitle = {Proceedings of the NINTH INTERNATIONAL CONFERENCE ON NUMERICAL COMBUSTION}, 7163 url = {http://web.ing.unisannio.it/icnc2002/CP21Turbulent_Combustion-Deflagrations_Jets_&_Fires.pdf}, 7164 year = {2002}, 7165 petsc_uses = {KSP} 7166} 7167 7168@InProceedings{ wid2005, 7169 author = {Alexander I. Bobenko and Peter Schrader}, 7170 title = {Discrete Willmore Flow}, 7171 booktitle = {Eurographics Symposium on Geometry Processing}, 7172 url = {http://www.math.tu-berlin.de/\~{ }bobenko/Papers/Willmore.pdf}, 7173 year = {2005}, 7174 editor = {M. Desbrun and H. Pottmann}, 7175 petsc_uses = {KSP} 7176} 7177 7178@Article{ stj2003, 7179 author = {A. Scascighini and A. Troxler and R. Jeltsch}, 7180 journal = {International Journal for Numerical Methods in Fluids}, 7181 volume = {41}, 7182 issue = {4}, 7183 title = {A numerical method for inverse design based on the inverse Euler equations}, 7184 year = {2003}, 7185 pages = {339--355}, 7186 url = {http://www3.interscience.wiley.com/cgi-bin/abstract/102521480/ABSTRACT}, 7187 petsc_uses = {KSP} 7188} 7189 7190@PhDThesis{ as2001, 7191 author = {ANDREA SCASCIGHINI}, 7192 title = {A Numerical Method for the Design of Internal Flow Configurations Based on the 7193 Inverse Euler Equations}, 7194 school = {SWISS FEDERAL INSTITUTE OF TECHNOLOGY, ZURICH}, 7195 year = {2001}, 7196 url = {http://www.sam.math.ethz.ch/\~{ }andrea/}, 7197 petsc_uses = {KSP} 7198} 7199 7200@Article{ hb2005, 7201 author = {E. McKay Hyde and Oscar P. Bruno}, 7202 journal = {Journal of Computational Physics}, 7203 volume = {202}, 7204 title = {A fast, higher-order solver for scattering by penetrable bodies in three 7205 dimensions}, 7206 year = {2005}, 7207 pages = {236--261}, 7208 url = {http://www.acm.caltech.edu/\~{ }bruno/hyde_bruno_3d_jcp.pdf}, 7209 petsc_uses = {KSP} 7210} 7211 7212@MastersThesis{ d2002, 7213 author = {Matthew F Dixon}, 7214 title = {PARALLEL SOLUTION OF HIGH ORDER FINITE DIFFERENCE SCHEMES FOR PRICING 7215 MULTI-DIMENSIONAL AMERICAN OPTIONS}, 7216 school = {READING UNIVERSITY}, 7217 year = {2002}, 7218 url = {http://www.ma.ic.ac.uk/\~{ }mdixion/papers/MScThesis.pdf.gz}, 7219 petsc_uses = {KSP} 7220} 7221 7222@TechReport{ gzb, 7223 author = {David Gleich and Leonid Zhukov and Pavel Berkhin}, 7224 title = {Fast Parallel PageRank: A Linear System Approach}, 7225 institution = {Stanford University}, 7226 year = {2004}, 7227 url = {http://www.gg.caltech.edu/\~{ }zhukov/papers/ParallelPageRank-paper.pdf}, 7228 petsc_uses = {KSP} 7229} 7230 7231@PhDThesis{ yergeau-99, 7232 author = {Daniel W. Yergeau}, 7233 title = {A DIAL-AN-OPERATOR APPROACH TO SIMULATION OF IMPURITY DIFFUSION IN 7234 SEMICONDUCTORS}, 7235 school = {Stanford}, 7236 year = {1999}, 7237 url = {http://www-tcad.stanford.edu/tcad/pubs/theses/yergeau.pdf}, 7238 petsc_uses = {KSP} 7239} 7240 7241@InProceedings{ rathkopf-miller-00, 7242 author = {J.A. Rathkopf and D.S. Miller and J.M. Owen and L.M. Stuart and M.R. Zika and 7243 P.G. Eltgroth and N.K. Madsen and K.P. McCandless and P.F. Nowak and M.K. Nemanic 7244 and N.A. Gentile and N.D. Keen and T.S. Palmer}, 7245 title = {{KULL}: {LLNL}'s {ASCI} Inertial Confinement Fusion Simulation Code}, 7246 year = {2000}, 7247 booktitle = {Physor 2000 American Nuclear Society Topical Meeting on Advances in Reactor 7248 Physics and Mathematics and Computation into the Next Millennium}, 7249 url = {http://www.llnl.gov/tid/lof/documents/pdf/237860.pdf}, 7250 lab = {LLNL}, 7251 petsc_uses = {KSP} 7252} 7253 7254@Article{ bonfi-palma-pas-05, 7255 author = {A. Bonfiglioli and P. De Palma and G. Pascazio and M. Napolitano}, 7256 journal = {Journal of Turbomachinery}, 7257 volume = {127}, 7258 title = {An Implicit Fluctuation Splitting Scheme for Turbomachinery Flows}, 7259 year = {2005}, 7260 pages = {395-401}, 7261 petsc_uses = {KSP} 7262} 7263 7264@InProceedings{ fettig-sobh-05, 7265 author = {John Fettig and Nahil Sobh and Dmitriy V. Melnikov and Jean-Pierre Leburton}, 7266 title = {High Performance Algorithms for Scalable Spin-Qubit Circuits with Quantum Dots}, 7267 year = {2005}, 7268 booktitle = {Proceedings of the 5th International Conference on Linux Clusters}, 7269 url = {http://www.linuxclustersinstitute.org/Linux-HPC-Revolution/Archive/PDF05/28-Fettig_J.pdf}, 7270 petsc_uses = {KSP} 7271} 7272 7273@TechReport{ melnikov-matagne-05, 7274 author = {Dmitriy V. Melnikov and Philippe Matagne and Jean-Pierre Leburton and D.G. 7275 Austing and G. Yu and S. Tarucha and John Fettig and Nahil Sobh}, 7276 title = {Spin configurations in circular and rectangular vertical quantum dots in a 7277 magnetic field: Three-dimensional self-consistent simulation}, 7278 year = {2005}, 7279 number = {Arxiv preprint cond-mat/0506585}, 7280 url = {http://arxiv.org/pdf/cond-mat/0506585}, 7281 petsc_uses = {KSP} 7282} 7283 7284@InProceedings{ richard-smedley-03, 7285 author = {Richard P. Smedley-Stevenson}, 7286 title = {PARALLEL THERMAL RADIATION TRANSPORT IN TWO DIMENSIONS}, 7287 year = {2003}, 7288 booktitle = {18th International Conference on Transport Theory (18 ICTT)}, 7289 url = {http://www.iprj.uerj.br/\~{ }ricardob/Evento_Cientifico_html/poster03j.pdf}, 7290 petsc_uses = {KSP} 7291} 7292 7293@Article{ guan-godoy-ravaioli-03, 7294 author = {D. Guan and A. Godoy and U. Ravaioli and F. Gamiz}, 7295 journal = {Journal of Computational Electronics}, 7296 volume = {2}, 7297 title = {Comparison Between Non-Equilibrium Green's Function and Monte Carlo Simulations 7298 for Transport in a Silicon Quantum Wire Structure}, 7299 year = {2003}, 7300 pages = {335--339}, 7301 petsc_uses = {KSP} 7302} 7303 7304@Article{ ovtchinnikovcai04, 7305 author = {S. Ovtchinnikov and X.-C. Cai}, 7306 journal = {Numer. Lin. Alg. Applics}, 7307 volume = {11}, 7308 title = {One-level {N}ewton--{K}rylov--{S}chwarz algorithm for unsteady nonlinear radiation 7309 diffusion problem}, 7310 year = {2004}, 7311 pages = {867--881}, 7312 petsc_uses = {KSP} 7313} 7314 7315@Article{ mixedstress, 7316 title = {Floating Solids: Combining Phase Field and Fluid-Structure Interactions}, 7317 author = {Adam Powell and David Dussault}, 7318 journal = {Appl. Numer. Anal. Comp. Math.}, 7319 volume = {2}, 7320 number = {1}, 7321 year = {2005}, 7322 pages = {157--166}, 7323 petsc_uses = {KSP} 7324} 7325 7326@Article{ dhh2005, 7327 author = {G. Deli\'ege and F. Henrotte and K. Hameyer}, 7328 title = {Accuracy analysis of the thrust force in 2D-3D finite element models}, 7329 journal = {International Journal for Computation and Mathematics in Electrical and 7330 Electronic Engineering (COMPEL)}, 7331 year = {2005}, 7332 petsc_uses = {KSP} 7333} 7334 7335@Article{ dhh2004, 7336 author = {G. Deli\'ege and F. Henrotte and W. Deprez and K. Hameyer}, 7337 title = {Finite element modelling of ion convection by electrostatic forces}, 7338 journal = {IEE Proceedings Science, Measurement and Technology}, 7339 year = {2004}, 7340 volume = {151}, 7341 number = {6}, 7342 petsc_uses = {KSP} 7343} 7344 7345@Article{ adams-07b, 7346 author = {Adams M.F.}, 7347 title = {Algebraic Multigrid Techniques for Strongly Indefinite Linear Systems from Direct 7348 Frequency Response Analysis in Solid Mechanics}, 7349 journal = {Computional Mechanics}, 7350 year = {2007}, 7351 volume = {39}, 7352 number = {4}, 7353 pages = {497-507}, 7354 petsc_uses = {KSP} 7355} 7356 7357@InProceedings{ wc2004, 7358 author = {A. Wheelock and D. Cooke}, 7359 title = {Computational Modeling of Ion Beam-Neutralizer Interactions in Two and Three 7360 Dimensions}, 7361 year = {2004}, 7362 booktitle = {40th AIAA/ASME/SAE/ASEE Joint Propulsion Conference and Exhibit}, 7363 url = {http://www.aiaa.org/content.cfm?pageid=406&gTable=Paper&gID=19282}, 7364 petsc_uses = {KSP} 7365} 7366 7367@InProceedings{ allard-gouranton-ipts2002, 7368 author = {Jeremie Allard and Valerie Gouranton and Emmanuel Melin and Bruno Raffin}, 7369 title = {Parallelizing Pre-rendering Computations on a Net Juggler PC Cluster}, 7370 year = {2002}, 7371 booktitle = {Immersive Projection Technology Symposium}, 7372 url = {http://www-id.imag.fr/\~{ }allardj/files/ipts2002.pdf}, 7373 petsc_uses = {KSP} 7374} 7375 7376@Article{ icc, 7377 author = {D Ioan and G Ciuprina and C Ciobotaru}, 7378 title = {Hybrid and concurrent algorithms for nonlinear magnetic field problems}, 7379 journal = {IEEE Transactions on Magnetics}, 7380 year = {2000}, 7381 url = {http://ieeexplore.ieee.org/Xplore/login.jsp?url=/iel5/20/19005/00877735.pdf}, 7382 petsc_uses = {KSP} 7383} 7384 7385@InProceedings{ hs1, 7386 author = {Brian J. Henz and Dale R. Shires}, 7387 title = {Development and Performance Analysis of a Parallel Finite Element Application 7388 Implemented in an Object-Oriented Programming Framework}, 7389 year = {2003}, 7390 booktitle = {PDPTA 2003}, 7391 pages = {1286-1292}, 7392 note = {Resin Transfer Modeling}, 7393 petsc_uses = {KSP} 7394} 7395 7396@TechReport{ b2000, 7397 author = {Rickard Bergstrom}, 7398 title = {Least-Squares Finite Element Methods for Electromagnetic Applications}, 7399 year = {2000}, 7400 institution = {Chalmers}, 7401 number = {2000-05}, 7402 url = {http://www.phi.chalmers.se/pub/preprints/ps/phiprint-2000-05.ps}, 7403 petsc_uses = {KSP} 7404} 7405 7406@Article{ fs2004, 7407 author = {Petri Fast and Michael J. Shelley}, 7408 title = {A Moving Overset Grid Method for Interface Dynamics Applied to Non-Newtonian Hele 7409 Shaw Flow}, 7410 journal = {Journal of Computational Physics}, 7411 year = {2004}, 7412 volume = {195}, 7413 url = {http://www.math.nyu.edu/faculty/shelley/papers/FS2004.pdf}, 7414 pages = {117-142}, 7415 petsc_uses = {KSP} 7416} 7417 7418@MastersThesis{ wallach, 7419 author = {Hanna Wallach}, 7420 title = {Efficient Training of Conditional Random Fields}, 7421 school = {University of Edinburgh}, 7422 year = {2002}, 7423 url = {http://scholar.google.com/url?sa=U&q=http://www.hcrc.ed.ac.uk/\~{ 7424 }osborne/msc-projects/wallach.ps.gz}, 7425 petsc_uses = {KSP} 7426} 7427 7428@Article{ something, 7429 author = {T Rylander and A Bondeson}, 7430 title = {Stability of explicit-implicit hybrid time-stepping schemes for Maxwells 7431 equations}, 7432 journal = {Journal of Computational Physics}, 7433 year = {2002}, 7434 volume = {179}, 7435 pages = {426-438}, 7436 petsc_uses = {KSP} 7437} 7438 7439@TechReport{ uf1, 7440 author = {Uwe Fabricius}, 7441 title = {Comparison of two implementations of {AMG}-preconditioned {CG} considering an 7442 electrostatic problem}, 7443 year = {2004}, 7444 institution = {Friedrich Alexander Universitat Erlangen Nurnberg Germany}, 7445 url = {http://www10.informatik.uni-erlangen.de/de/Publications/TechnicalReports/TechRep04-1.pdf}, 7446 number = {04-1}, 7447 petsc_uses = {KSP} 7448} 7449 7450@InBook{ sg1, 7451 author = {Natalia Seoane and A.J.Garca-Loureiro}, 7452 chapter = {Analysis of Parallel Numerical Libraries to Solve the 3D Electron Continuity 7453 Equation}, 7454 url = {http://www.springerlink.com/app/home/contribution.asp?wasp=h0xlulyhugck3y2gnt2l&referrer=parent&backto=issue,79,112;journal,212,1787;linkingpublicationresults,1:105633,1}, 7455 title = {Lecture Notes in Computer Science}, 7456 publisher = {Springer-Verlag}, 7457 volume = {3037}, 7458 year = {2004}, 7459 petsc_uses = {KSP} 7460} 7461 7462@Article{ nikyilmazgivisheikhipope10, 7463 author = {M. B. Nik and S. L. Yilmaz and P. Givi and M. R. H. Sheikhi and S. B. Pope}, 7464 title = {Simulation of Sandia Flame D Using Velocity-Scalar Filtered Density Function}, 7465 journal = {AIAA Journal}, 7466 volume = {48}, 7467 number = {7}, 7468 pages = {1513--1522}, 7469 year = {2010}, 7470 petsc_uses = {KSP} 7471} 7472 7473@Article{ nikyilmazsheikhigivi10, 7474 author = {Mehdi B. Nik and Server L. Yilmaz and Mohammad Reza H. Sheikhi and Peyman Givi}, 7475 title = {Grid Resolution Effects on VSFMDF/LES}, 7476 journal = {Flow, Turbulence and Combustion}, 7477 doi = {10.1007/s10494-010-9272-5}, 7478 year = {2010}, 7479 petsc_uses = {KSP} 7480} 7481 7482@Article{ idema2013towards, 7483 title = {Towards faster solution of large power flow problems}, 7484 author = {Idema, Reijer and Papaefthymiou, Georgios and Lahaye, Domenico and Vuik, Cornelis 7485 and van der Sluis, Lou}, 7486 journal = {Power Systems, IEEE Transactions on}, 7487 volume = {28}, 7488 number = {4}, 7489 pages = {4918--4925}, 7490 year = {2013}, 7491 publisher = {IEEE}, 7492 petsc_uses = {KSP} 7493} 7494 7495@Article{ 6026245, 7496 author = {Idema, R. and Lahaye, D.J.P. and Vuik, C. and Van der Sluis, L.}, 7497 journal = {Power Systems, IEEE Transactions on}, 7498 title = {Scalable Newton-Krylov Solver for Very Large Power Flow Problems}, 7499 year = {2012}, 7500 month = feb, 7501 volume = {27}, 7502 number = {1}, 7503 pages = {390-396}, 7504 doi = {10.1109/TPWRS.2011.2165860}, 7505 issn = {0885-8950}, 7506 petsc_uses = {KSP} 7507} 7508 7509@Book{ idema2014computational, 7510 title = {Computational Methods in Power System Analysis}, 7511 author = {Idema, Reijer and Lahaye, Domenico JP}, 7512 year = {2014}, 7513 publisher = {Springer}, 7514 petsc_uses = {KSP} 7515} 7516 7517@PhDThesis{ abhyankar2011thesis, 7518 author = {Shrirang Abhyankar}, 7519 title = {Development of an implicitly coupled electromechanical and electromagnetic 7520 transients simulator for power systems}, 7521 school = {Illinois Institute of Technology}, 7522 year = {2011}, 7523 petsc_uses = {KSP} 7524} 7525 7526@InProceedings{ abhyankarhipcna11-1, 7527 author = {Shrirang Abhyankar and Barry Smith and Hong Zhang and A. Flueck}, 7528 title = {Using {PETSc} to develop scalable applications for next-generation power grid}, 7529 year = {2011}, 7530 booktitle = {Proceedings of the 1st International Workshop on High Performance Computing, 7531 Networking and Analytics for the Power Grid}, 7532 url = {http://www.mcs.anl.gov/uploads/cels/papers/P1957-0911.pdf}, 7533 publisher = {ACM}, 7534 petsc_uses = {KSP} 7535} 7536 7537@InProceedings{ abhyankarhipcna11-2, 7538 author = {Shrirang Abhyankar and Alexander Flueck and Xu Zhang and Hong Zhang}, 7539 title = {Development of a parallel three-phase transient stability simulator for power 7540 systems}, 7541 year = {2011}, 7542 booktitle = {Proceedings of the 1st International Workshop on High Performance Computing, 7543 Networking and Analytics for the Power Grid}, 7544 publisher = {ACM}, 7545 petsc_uses = {KSP} 7546} 7547 7548@InProceedings{ abhyankarpesgeneral2012, 7549 author = {Shrirang Abhyankar and A. Flueck}, 7550 title = {An implicitly-coupled solution approach for combined electromechanical and 7551 electromagnetic transients simulation}, 7552 year = {2012}, 7553 booktitle = {Proceedings of the IEEE PES General Meeting}, 7554 publisher = {IEEE}, 7555 petsc_uses = {KSP} 7556} 7557 7558@Article{ idemalahayevuiksluis2012, 7559 author = {Reijer Idema and Domenico Lahaye and Cornelis Vuik and Lou van der Sluis}, 7560 title = {Scalable Newton-Krylov solver for very large Power Flow problems}, 7561 journal = {IEEE Transactions on Power Systems}, 7562 year = {2012}, 7563 volume = {27}, 7564 pages = {390-396}, 7565 petsc_uses = {KSP} 7566} 7567 7568@Article{ korrestzavellasgalinas2013, 7569 author = {George N. Korres and Anastasios Tzavellas and Evangelos Galinas}, 7570 title = {A distributed implementation of multi-area power system state estimation on a 7571 cluster of computers }, 7572 journal = {Electric Power Systems Research }, 7573 volume = {102}, 7574 number = {0}, 7575 pages = {20 - 32}, 7576 year = {2013}, 7577 issn = {0378-7796}, 7578 doi = {10.1016/j.epsr.2013.04.002}, 7579 petsc_uses = {KSP} 7580} 7581 7582% LiteralHTML: <td width="100%" colspan="2"><hr size="4" color="#FF5B5B"> </td> 7583% LiteralHTML:<font color="#FF0000"> 7584% LiteralHTML: Material failure, for example, cracking of steel beams resulting 7585% LiteralHTML: in bridge collapse and corrosion, is a little understood phenomena. Thus simulations 7586% LiteralHTML: are important for prediction and prevention. PETSc has been used 7587% LiteralHTML: in a variety of studies of material failure.</p> 7588% LiteralHTML:</font> 7589% LiteralHTML: 7590@InProceedings{ gray2, 7591 author = {Yuan He and Joshua Gray and Richard Braatz and Richard Alkire}, 7592 title = {Modulized Coupled Simulation of Localized Pit Initiation in Stainless Steel}, 7593 year = {2004}, 7594 booktitle = {American Institute of Chemical Engineers 2004 Annual Meeting}, 7595 petsc_uses = {KSP} 7596} 7597 7598@InProceedings{ gray1, 7599 author = {J. Gray and C. Homescu and L. Petzold and Richard Alkire}, 7600 title = {Algorithms and Computing Architectures for Solving Differential-Algebraic 7601 Equation Systems Typically Encountered in Models of Corrosion Pit Initiation}, 7602 year = {2003}, 7603 booktitle = {Abstracts of the Electrochemical Society 204th meeting}, 7604 petsc_uses = {KSP} 7605} 7606 7607@InProceedings{ crack2, 7608 author = {Erin Lesulauro and Anthony R. Ingraffea and Gerd Heber and Paul A. Wawrzynek}, 7609 title = {A multiscale modeling approach to crack initiation in metallic polycrystals}, 7610 booktitle = {44th AIAA/ASME/ASCE/AHS/ASC Structures, Structural Dynamics, and Materials 7611 Conference}, 7612 url = {http://md1.csa.com/partners/viewrecord.php?requester=gs&collection=TRD&recid=A0325099AH}, 7613 year = {2003}, 7614 petsc_uses = {KSP} 7615} 7616 7617@TechReport{ hdams1, 7618 author = {Gerd Heber and Andrew J. Dolgert and Maxirn Alt and Karen A. Mazurkiewicz and 7619 Lynd Stringer}, 7620 title = {Fracture Mechanics on the Intel Itanium Architecture}, 7621 year = {2001}, 7622 institution = {Intel Corporation}, 7623 url = {http://cedar.intel.com/media/pdf/scs/cptconitanium.pdf}, 7624 petsc_uses = {KSP} 7625} 7626 7627@InProceedings{ ihwi, 7628 author = {E. Iesulauro and G. Heber and P. A. Wawrzynek and A. R. Ingraffea}, 7629 title = {Modeling of 3D Metallic Polycrystals and Simulation of Crack Initiation}, 7630 booktitle = {International Conference ON Computational Engineering and Sciences}, 7631 year = {2002}, 7632 url = {http://www.cfg.cornell.edu/\~{ }erin/erin/ices02_iesulauro.pdf}, 7633 petsc_uses = {KSP} 7634} 7635 7636@InProceedings{ crack, 7637 author = {Bruce Carter and Chuin-Shan Chen and L. Paul Chew and Nikos Chrisochoides and 7638 Guang R. Gao and Gerd Heber and Antony R. Ingraffea and Roland Krause and Chris 7639 Myers and Demian Nave and Keshav Pingali and Paul Stodghill and Stephen Vavasis 7640 and Paul A. Wawrzynek}, 7641 title = {Parallel FEM Simulation of Crack Propagation}, 7642 booktitle = {Proceedings of Irregular 2000}, 7643 url = {http://www.cs.cornell.edu/stodghil/papers/irregular00.ps}, 7644 year = {2000}, 7645 petsc_uses = {KSP} 7646} 7647 7648@InProceedings{ beaudoin98, 7649 author = {A. J. Beaudoin}, 7650 title = {Use of Polycrystal Plasticity Theory in Assessing Material Performance}, 7651 booktitle = {Simulation of materials processing: Theory, methods, and applications - 7652 Proceedings of the Sixth International Conference, NUMIFORM'98}, 7653 editor = {J. Hu\'etink and F. P. T. Baaijens}, 7654 optvolume = {}, 7655 optnumber = {}, 7656 optseries = {}, 7657 year = {1998}, 7658 optorganization={}, 7659 publisher = {A. A. Balkema Publishers}, 7660 address = {Rotterdam, Netherlands}, 7661 month = jun, 7662 optpages = {}, 7663 petsc_uses = {KSP} 7664} 7665 7666% LiteralHTML: <td width="100%" colspan="2"><hr size="4" color="#FF5B5B"> </td> 7667@TechReport{ defordheld1, 7668 author = {JF DeFord and BL Held}, 7669 title = {RF3P-A New Parallel Driven Frequency Electromagnetic Solver}, 7670 year = {2002}, 7671 institution = {Simulation Technology and Applied Research}, 7672 url = {http://www.staarinc.com/support/papers/aces2002.pdf}, 7673 note = {Discusses their parallel commercial solver that uses PETSc}, 7674 petsc_uses = {KSP} 7675} 7676 7677@PhDThesis{ sande2003, 7678 author = {Hans Vande Sande}, 7679 title = {Modelling and Finite Element Simulation of Non-Linear and Anisotropic 7680 Quasi-Static Electromagnetic Systems}, 7681 school = {Katholieke Universiteit Leuven, Belgium}, 7682 year = {2003}, 7683 petsc_uses = {KSP} 7684} 7685 7686@Article{ sdchh2004, 7687 author = {H. Vande Sande and W. Deprez and J. De Coster and F. Henrotte and K. Hameyer}, 7688 title = {Reducing the Computation Time of Non-Linear Problems by an Adaptive Linear System 7689 Tolerance}, 7690 journal = {IEEE Transactions on Magnetics}, 7691 year = {2004}, 7692 volume = {40}, 7693 pages = {1306--1309}, 7694 petsc_uses = {KSP} 7695} 7696 7697@Article{ holst-lindblom-etal:2004, 7698 author = {Michael Holst and Lee Lindblom and Robert Owen and Harald P. Pfeiffer and Mark A. 7699 Scheel and Lawrence E. Kidder}, 7700 title = {Optimal constraint projection for hyperbolic evolution systems, }, 7701 journal = {Phys. Rev. D}, 7702 year = {2004}, 7703 volume = {70}, 7704 pages = {084017}, 7705 petsc_uses = {KSP} 7706} 7707 7708@Article{ marm2005, 7709 author = {Matthew Anderson and Richard A. Matzner}, 7710 title = {Extended Lifetime in Computational Evolution of Isolated Black Holes}, 7711 journal = {Foundations of Physics}, 7712 volume = {35}, 7713 pages = {1572--9516}, 7714 year = {2005}, 7715 petsc_uses = {KSP} 7716} 7717 7718@Article{ cook-pfeiffer:2004, 7719 author = {Cook, Gregory B. and Pfeiffer, Harald P.}, 7720 title = {Excision boundary conditions for black hole initial data}, 7721 journal = {Phys. Rev. D}, 7722 volume = {70}, 7723 pages = {104016--24}, 7724 year = {2004}, 7725 petsc_uses = {KSP} 7726} 7727 7728@Article{ pfeiffer-kidder-etal:2005, 7729 author = {Harald P. Pfeiffer and Lawrence E. Kidder and Mark A. Scheel and Deirdre 7730 Shoemaker}, 7731 title = {Initial data for {E}instein's equations with superposed gravitational waves}, 7732 journal = {Phys. Rev. D}, 7733 year = {2005}, 7734 volume = {71}, 7735 pages = {024020}, 7736 petsc_uses = {KSP} 7737} 7738 7739@Article{ pfeiffer-kidder-etal:2003, 7740 author = {Pfeiffer, Harald P. and Kidder, Lawrence E. and Scheel, Mark A. and Teukolsky, 7741 Saul A.}, 7742 title = {A multidomain spectral method for solving elliptic equations}, 7743 journal = {CPC}, 7744 year = {2003}, 7745 volume = {152}, 7746 pages = {253--273}, 7747 note = {Solves nonlinear coupled 3-D elliptic equations that arise in general relativity. 7748 For a related online version, see arXiv:gr-qc/0202096}, 7749 petsc_uses = {KSP} 7750} 7751 7752@Article{ pfeiffer-cook-teukolsky:2002, 7753 author = {Pfeiffer, Harald P. and Cook, Gregory B. and Teukolsky, Saul A.}, 7754 title = {Comparing initial-data sets for binary black hole}, 7755 journal = {PRD}, 7756 year = {2002}, 7757 volume = {66}, 7758 pages = {024047}, 7759 note = {for a related online version, seearXiv:gr-qc/0203085}, 7760 petsc_uses = {KSP} 7761} 7762 7763@PhDThesis{ pfeiffer:2003, 7764 author = {Pfeiffer, Harald P.}, 7765 title = {Initial Data for Black Hole Evolutions}, 7766 school = {Cornell University}, 7767 year = {2003}, 7768 petsc_uses = {KSP} 7769} 7770 7771@TechReport{ h1, 7772 author = {Erik Schnetter}, 7773 title = {A fast apparent horizon algorithm}, 7774 year = {2002}, 7775 number = {Arxiv preprint gr-qc/0206003}, 7776 url = {http://arxiv.org/pdf/gr-qc/0206003}, 7777 petsc_uses = {KSP} 7778} 7779 7780@Article{ h2, 7781 author = {Erik Schnetter}, 7782 title = {Finding apparent horizons and other 2-surfaces of constant expansion}, 7783 year = {2003}, 7784 journal = {Class. Quantum Grav.}, 7785 pages = {4719-4737}, 7786 volume = {20}, 7787 url = {http://www.iop.org/EJ/article/0264-9381/20/22/001/cqg3_22_001.pdf}, 7788 petsc_uses = {KSP} 7789} 7790 7791@Article{ adams-03a, 7792 author = {Adams, M.~F.}, 7793 journal = {Numerical Linear Algebra with Applications}, 7794 number = {2-3}, 7795 pages = {141-153}, 7796 title = {Algebraic multigrid methods for constrained linear systems with applications to 7797 contact problems in solid mechanics}, 7798 volume = {11}, 7799 year = {2004}, 7800 petsc_uses = {KSP} 7801} 7802 7803@Article{ vandesande1, 7804 author = {H. Vande Sande and H. De Gersem and F. Henrotte and K. Hameyer}, 7805 journal = {IEEE TRANSACTIONS ON MAGNETICS}, 7806 year = {2003}, 7807 volume = {39}, 7808 pages = {1709--1712}, 7809 title = {Solving Nonlinear Magnetic Problems Using {N}ewton Trust Region Methods}, 7810 petsc_uses = {KSP} 7811} 7812 7813@InProceedings{ vbde1, 7814 author = {Rajesh Rawat and Jennifer P. Spinti and Wing Yee and Philip J. Smith}, 7815 year = {2002}, 7816 title = {Parallelization and Integration of a Large Scale Hydrocarbon Pool Fire in the 7817 Uintah PSE}, 7818 booktitle = {In Proceedings of Ninth Internation Conference on Numerical Combustion - ICNC 7819 2002}, 7820 pages = {49-55}, 7821 url = {http://web.ing.unisannio.it/icnc2002/CP21Turbulent_Combustion-Deflagrations_Jets_&_Fires.pdf}, 7822 note = {Extended abstract}, 7823 petsc_uses = {KSP} 7824} 7825 7826@Unpublished{ ep1, 7827 title = {An Inherently-Parallel Method for Solving Discretized Diffusion Equations}, 7828 author = {Bradley R. Eccleston and Todd S. Palmer}, 7829 institution = {Department of Nuclear Engineering, Oregon State University}, 7830 url = {http://www.physics.orst.edu/\~{ }bertrand/stuff/Year_Two_Report.pdf}, 7831 note = {Funded under the ASCI Level III: Computational Transport Issues for Large-Scale 7832 Parallel Simulations}, 7833 year = {1999}, 7834 petsc_uses = {KSP} 7835} 7836 7837@InProceedings{ teo2007scalable, 7838 title = {A scalable modular convex solver for regularized risk minimization}, 7839 author = {Teo, C.H. and Smola, A. and Vishwanathan, SVN and Le, Q.V.}, 7840 booktitle = {Proceedings of the 13th ACM SIGKDD international conference on Knowledge 7841 discovery and data mining}, 7842 pages = {727--736}, 7843 year = {2007}, 7844 organization = {ACM}, 7845 petsc_uses = {KSP} 7846} 7847 7848@InProceedings{ rm02, 7849 author = {Robert Malouf}, 7850 year = {2002}, 7851 title = {A comparison of algorithms for maximum entropy Parameter estimation}, 7852 booktitle = {In Proceedings of the Sixth Conference on Natural Language Learning 7853 (CoNLL-2002)}, 7854 pages = {49-55}, 7855 url = {http://bulba.sdsu.edu/malouf/papers/conll02.pdf}, 7856 petsc_uses = {KSP} 7857} 7858 7859@Unpublished{ hrv02, 7860 title = {Computing the Lambda Modes of a Nuclear Reactor with {SLEPc} and {PETSc}}, 7861 author = {V. Hernandex and J. E. Roman and V. Vidal}, 7862 note = {Submitted to CMMSE}, 7863 petsc_uses = {KSP} 7864} 7865 7866@Article{ tmh2001, 7867 author = {Manfred Gilli and Evis Kellezi and Giorgio Pauletto}, 7868 journal = {Journal of Economic Dynamics and Control}, 7869 year = {2002}, 7870 volume = {26}, 7871 pages = {1499-1515}, 7872 title = {Solving finite difference schemes arising in trivariate option pricing}, 7873 petsc_uses = {KSP} 7874} 7875 7876@InProceedings{ a2, 7877 author = {C.J.Palansuriya and C-H.Lai and C.S.Ierotheou and K.A.Pericleous and D.E.Keyes}, 7878 title = {Comparison of three algorithms for nonlinear metal cutting problems}, 7879 booktitle = {Proceedings of the 11th International Conference on Domain Decomposition 7880 Methods}, 7881 editor = {C.-H. Lai et al.}, 7882 publisher = {Domain Decomposition Press, Bergen}, 7883 url = {http://www.ddm.org/DD11/Palansuriya.ps.gz}, 7884 year = {1999}, 7885 petsc_uses = {KSP} 7886} 7887 7888@Unpublished{ mmmdcmaa-web-page, 7889 title = {{M}ulti-{M}odel {M}ulti-{D}omain {C}omputational {M}ethods in {A}erodynamics and 7890 {A}coustics {W}eb Page}, 7891 url = {http://www.cs.odu.edu/\~{ }keyes/nsf}, 7892 author = {David E. Keyes}, 7893 institution = {Old Dominion University}, 7894 petsc_uses = {KSP} 7895} 7896 7897@Conference{ liu2010parallelization, 7898 title = {{Parallelization of Thermal Recovery Simulation Based on PETSc}}, 7899 author = {Liu, L. and Xue, W. and Shu, J. and Ma, L.}, 7900 booktitle = {International Symposium on Parallel and Distributed Processing with 7901 Applications}, 7902 pages = {528--535}, 7903 year = {2010}, 7904 organization = {IEEE}, 7905 petsc_uses = {KSP} 7906} 7907 7908@Unpublished{ oil-reservoir-sim-web-page, 7909 title = {{N}ew {G}eneration {F}ramework for {P}etroleum, {R}eservoir {S}imulation}, 7910 url = {http://www.pe.utexas.edu/CPGE/new_generation}, 7911 institution = {University of Texas at Austin and Argonne National Laboratory}, 7912 key = {University of Texas at Austin and Argonne National Laboratory}, 7913 petsc_uses = {KSP} 7914} 7915 7916@Article{ tmh2001b, 7917 author = {V. Thiagarajan and K. Milfeld and KT. Milfeld}, 7918 journal = {IEEE TRANSACTIONS ON MAGNETICS }, 7919 year = {2001}, 7920 volume = {37}, 7921 pages = {143--146}, 7922 title = {Adapting EMAP3D to parallel processing}, 7923 petsc_uses = {KSP} 7924} 7925 7926@Article{ harbury98, 7927 author = {HK Harbury and W Porod}, 7928 journal = {VLSI Design}, 7929 year = {1998}, 7930 volume = {6}, 7931 pages = {47--51}, 7932 title = {Parallel computation for electronic waves in quantum corrals}, 7933 petsc_uses = {KSP} 7934} 7935 7936@Article{ bludszuwei98, 7937 author = {Mark Bludszuweit}, 7938 journal = {Journal of Lightwave Technology}, 7939 year = {1998}, 7940 volume = {16}, 7941 number = {7}, 7942 pages = {1336--42}, 7943 title = {Mixed Finite Element Beam Propagation Method}, 7944 petsc_uses = {KSP} 7945} 7946 7947@Article{ s1, 7948 author = {J. L. Friedman and N. Stergioulas}, 7949 journal = {Astrophysics Journal}, 7950 year = {1998}, 7951 volume = {492}, 7952 number = {301}, 7953 pages = {}, 7954 title = {}, 7955 petsc_uses = {KSP} 7956} 7957 7958@Article{ s1a, 7959 author = {S. M. Morsink and N. Stergioulas and S. Blattnig}, 7960 journal = {Astrophysics Journal}, 7961 year = {1999}, 7962 volume = {510}, 7963 number = {854}, 7964 pages = {}, 7965 title = {}, 7966 petsc_uses = {KSP} 7967} 7968 7969@PhDThesis{ s2, 7970 author = {N. Stergioulas}, 7971 title = {Ph. D. thesis}, 7972 year = {1996}, 7973 institution = {University of Wisconsin-Milwaukee}, 7974 petsc_uses = {KSP} 7975} 7976 7977@InProceedings{ coral1, 7978 author = {L. Kettunen and K. Forsman and D. Levine and W. Gropp}, 7979 title = {Solutions of TEAM Problem \#13 Using Integral Equations in a Sequential and 7980 Parallel Computing Environment}, 7981 booktitle = {Proceedings of the Miami TEAM Workshop}, 7982 location = {Florida International University, Department of Electrical Engineering and 7983 Computing Science}, 7984 month = nov, 7985 year = {1993}, 7986 petsc_uses = {KSP} 7987} 7988 7989@InProceedings{ coral2, 7990 author = {L. Kettunen and K. Forsman and D. Levine and W. Gropp}, 7991 title = {Solutions of TEAM Problems 13 and 20 Using a Volume Integral Formulation}, 7992 booktitle = {Proceedings of Aix-les-Bains TEAM Workshop}, 7993 month = dec, 7994 year = {1994}, 7995 petsc_uses = {KSP} 7996} 7997 7998@InProceedings{ coral3, 7999 author = {L. Kettunen and K. Forsman and D. Levine and W. Gropp}, 8000 title = {Computational Electromagnetics and Parallel Dense Matrix Computations}, 8001 booktitle = {Proceedings of the SIAM Parallel Processing for Scientific Computing Conference}, 8002 location = {Florida International University, Department of Electrical Engineering and 8003 Computing Science}, 8004 year = {1995}, 8005 petsc_uses = {KSP} 8006} 8007 8008@InProceedings{ mijalkovic, 8009 author = {Slobodan Mijalkovi\'{c}}, 8010 title = {Evaluation of Multigrid as a Solver for Stress Analysis Problems in Semiconductor 8011 Process Simulation}, 8012 booktitle = {Multigrid Methods VI: Proceedings of the Sixth European Multigrid Conference Held 8013 Gent, Belgium, September 27--30, 1999.}, 8014 editor = {Erik Dick, Kris Riemslagh, Jan Vierendeels}, 8015 optvolume = {14}, 8016 optseries = {Lecture Notes in Computational Science and Engineering}, 8017 year = {2000}, 8018 publisher = {Springer}, 8019 address = {Berlin}, 8020 optpages = {179--184}, 8021 petsc_uses = {KSP} 8022} 8023 8024@Article{ bludszuwei98a, 8025 author = {Mark Bludszuweit}, 8026 journal = {Journal of Lightwave Technology}, 8027 year = {1998}, 8028 volume = {16}, 8029 number = {7}, 8030 pages = {1336--42}, 8031 title = {Mixed Finite Element Beam Propagation Method}, 8032 petsc_uses = {KSP} 8033} 8034 8035@Article{ gilli-pauletto-1998, 8036 author = {Manfred Gilli and Giorgio Pauletto}, 8037 title = {Parallel {K}rylov Methods for Econometric Model Simulation}, 8038 journal = {Computational Economics}, 8039 year = {2000}, 8040 volume = {16}, 8041 pages = {173--186}, 8042 petsc_uses = {KSP} 8043} 8044 8045% LiteralHTML: 8046% LiteralHTML: <a name="packages"></a><H3><center>Software Packages that use or interface to PETSc</center></H3> 8047% LiteralHTML: 8048@Article{ collierdalcincalo2013, 8049 title = {{PetIGA}: High-Performance Isogeometric Analysis}, 8050 author = {Nathan Collier and Lisandro Dalcin and Victor M. Calo}, 8051 journal = {arxiv}, 8052 year = {2013}, 8053 number = {1305.4452}, 8054 note = {\url{http://arxiv.org/abs/1305.4452}}, 8055 petsc_uses = {KSP} 8056} 8057 8058@Article{ collierdalcinvignalcortescalo2016, 8059 title = {PetIGA: A framework for high-performance isogeometric analysis}, 8060 author = {Lisandro Dalcin and Nathan Collier and Philippe Vignal and AMA C{\^o}rtes and 8061 Victor M. Calo}, 8062 journal = {Computer Methods in Applied Mechanics and Engineering}, 8063 year = {2016}, 8064 petsc_uses = {KSP} 8065} 8066 8067@Misc{ petiga-web-page, 8068 author = {N. Collier and L. Dalcin and V.M. Calo}, 8069 title = {{PetIGA} {W}eb page}, 8070 url = {https://bitbucket.org/dalcinl/petiga/}, 8071 howpublished = {\url{https://bitbucket.org/dalcinl/petiga/}}, 8072 year = {2014}, 8073 petsc_uses = {KSP} 8074} 8075 8076@Article{ logg07, 8077 author = {Logg, Anders}, 8078 title = {Automating the Finite Element Method}, 8079 journal = {Archives of Computational Methods in Engineering}, 8080 volume = {14}, 8081 number = {2}, 8082 pages = {93-138}, 8083 year = {2007}, 8084 doi = {10.1007/s11831-007-9003-9}, 8085 publisher = {Kluwer Academic Publishers}, 8086 issn = {1134-3060}, 8087 language = {English}, 8088 petsc_uses = {KSP} 8089} 8090 8091@Article{ jezequelcouturierdenis12, 8092 author = {Jezequel, Fabienne and Couturier, Rapha\"el and Denis, Christophe}, 8093 title = {Solving large sparse linear systems in a grid environment: the GREMLINS code 8094 versus the PETSc library}, 8095 journal = {The Journal of Supercomputing}, 8096 volume = {59}, 8097 number = {3}, 8098 pages = {1517-1532}, 8099 year = {2012}, 8100 issn = {0920-8542}, 8101 doi = {10.1007/s11227-011-0563-y}, 8102 publisher = {Springer US}, 8103 keywords = {Asynchronous iterations; Grid computing; Iterative method; Multisplitting method; 8104 Sparse linear solver}, 8105 language = {English}, 8106 petsc_uses = {KSP} 8107} 8108 8109@Unpublished{ feap-web-page, 8110 title = {FEAP: A Finite Element Analysis Program}, 8111 url = {http://www.ce.berkeley.edu/projects/feap/}, 8112 author = {FEAP Team}, 8113 note = {Uses PETSc linear solvers - iterative and direct}, 8114 petsc_uses = {KSP} 8115} 8116 8117@Unpublished{ parpre-web-page, 8118 title = {{ParPre} {W}eb {P}age}, 8119 url = {http://www.cs.utk.edu/\~{ }eijkhout/parpre.html}, 8120 institution = {University of Tennessee}, 8121 author = {Victor Eijkhout}, 8122 note = {This is no longer supported. A set of preconditioners built on PETSc}, 8123 petsc_uses = {KSP} 8124} 8125 8126@Unpublished{ pism, 8127 title = {{PISM}: a Parallel Ice Sheet Model}, 8128 author = {{PISM Team}}, 8129 abstract = {We have developed a numerical model of ice sheets called PISM (a Parallel Ice 8130 Sheet Model). The thickness, temperature, velocity and age of the ice are all 8131 simulated, as is the deformation of the earth underneath the ice. New techniques 8132 for fast ice dynamics, earth deformation, and verification have are included.}, 8133 note = {\url{http://www.pism-docs.org/}}, 8134 petsc_uses = {KSP} 8135} 8136 8137@Unpublished{ oofem, 8138 title = {OOFEM - an object oriented finite element package}, 8139 author = {Borek Patzak}, 8140 url = {http://www.oofem.org}, 8141 petsc_uses = {KSP} 8142} 8143 8144@Unpublished{ dks2openfvm, 8145 title = {OpenFVM - a finite volume based general purpose CFD solver}, 8146 author = {Open source development}, 8147 url = {http://openfvm.sourceforge.net/}, 8148 petsc_uses = {KSP} 8149} 8150 8151@Unpublished{ sundar-2008w, 8152 title = {DENDRO: a parallel geometric multigrid library for trilinear finite elements on 8153 octree meshes}, 8154 author = {H. Sundar and R.S. Sampath and S.S. Adavani and C. Davatzikos and G. Biros}, 8155 institution = {University of Pennsylvania}, 8156 url = {http://www.seas.upenn.edu/~csela/dendro/html/index.html}, 8157 petsc_uses = {KSP} 8158} 8159 8160@Unpublished{ khatiwala07-software, 8161 title = {A computational framework for simulation of biogeochemical tracers in the ocean}, 8162 author = {Khatiwala, S.}, 8163 institution = {Columbia University}, 8164 url = {http://www.ldeo.columbia.edu/\~{ }spk}, 8165 petsc_uses = {KSP} 8166} 8167 8168@InBook{ jiaolima99, 8169 author = {Xiangmin Jiao and Xiang-Yang Li and Xiaosong Ma}, 8170 chapter = {{SIFFEA}:Scalable Integrated Framework for Finite Element Analysis}, 8171 url = {http://portal.acm.org/citation.cfm?id=646895.709725}, 8172 title = {Lecture Notes in Computer Science}, 8173 publisher = {Springer-Verlag}, 8174 volume = {1732}, 8175 year = {1999}, 8176 petsc_uses = {KSP} 8177} 8178 8179@Article{ crow1, 8180 author = {C. S. Crow IV}, 8181 title = {DistSolve: An Open Source Web Service for Solving Sparse Systems of Equations}, 8182 journal = {Hopkins Undergraduate Research Journal}, 8183 year = {2003}, 8184 url = {http://www.jhu.edu/hurj/issue2/09D%20Crow%20DistSolve.pdf}, 8185 petsc_uses = {KSP} 8186} 8187 8188@Unpublished{ petsc-python, 8189 title = {PETSc for Python}, 8190 author = {L. Dalcin}, 8191 url = {https://petsc.org/main/petsc4py}, 8192 note = {Provides Python bindings for PETSc}, 8193} 8194 8195@Unpublished{ cfdship, 8196 title = {{CFDShip-Iowa}}, 8197 author = {Pablo M. Carrica and Robert V. Wilson and Fred Stern}, 8198 institution = {University of Iowa}, 8199 url = {http://www.iihr.uiowa.edu/\~{ }cfdship/}, 8200 note = {CFDShip-Iowa is a multiblock free surface flow solver that uses overset 8201 structured grids, designed for ship applications}, 8202 petsc_uses = {KSP} 8203} 8204 8205@Unpublished{ bvw, 8206 title = {Multiflow}, 8207 author = {Berend van Wachem}, 8208 institution = {Mechanical Engineering - Chalmers University of Technology}, 8209 url = {http://www.tfd.chalmers.se/\~{ }berend/page3.html}, 8210 note = {MultiFlow is a curvlinear, multiblock, multiprocessor flowsolver for multiphase 8211 flows.}, 8212 petsc_uses = {KSP} 8213} 8214 8215@Unpublished{ dks2, 8216 title = {FENA - A Finite Element Model for the North Atlantic}, 8217 author = {Jens Schroeter}, 8218 institution = {Alfred-Wegener-Institute for Polar and Marine Research}, 8219 url = {http://www.awi-bremerhaven.de/Modelling/INVERSE/FENAdesc/FENAdesc.html}, 8220 petsc_uses = {KSP} 8221} 8222 8223@TechReport{ piwonski2010idea, 8224 title = {The Idea and Concept of {Metos3D}: {A} Marine Ecosystem Toolkit for Optimization 8225 and Simulation in {3-D}}, 8226 author = {Piwonski, J. and Slawig, T.}, 8227 year = {2010}, 8228 institution = {Christian-Albrechts-Universit\"at zu Kiel}, 8229 url = {http://www.informatik.uni-kiel.de/uploads/tx_publication/tr_1016_01.pdf}, 8230 petsc_uses = {KSP} 8231} 8232 8233@Unpublished{ metos3d-web, 8234 title = {{Metos3D}: {A} Marine Ecosystem Toolkit for Optimization and Simulation in 3-D}, 8235 author = {Piwonski, J. and Slawig, T.}, 8236 institution = {Christian-Albrechts-Universit\"at zu Kiel}, 8237 url = {http://www.informatik.uni-kiel.de/en/algorithmic-optimal-control/software/metos3d/}, 8238 petsc_uses = {KSP} 8239} 8240 8241@Unpublished{ magpar, 8242 author = {W. Scholz}, 8243 title = {Magpar: Parallel Micromagnetics Code}, 8244 institution = {Vienna University of Technology}, 8245 url = {http://magnet.atp.tuwien.ac.at/scholz/magpar/}, 8246 petsc_uses = {KSP} 8247} 8248 8249@Misc{ libmesh:sourceforge, 8250 author = {}, 8251 title = {{libMesh}:a C++ framework for the numerical simulation of partial differential 8252 equations on serial and parallel platforms}, 8253 note = {[Online]}, 8254 url = {http://libmesh.github.io}, 8255 petsc_uses = {KSP} 8256} 8257 8258@Misc{ moose-web-page, 8259 title = {Multiphysics {O}bject-{O}riented {S}imulation {E}nvironment ({MOOSE})}, 8260 author = {David Andrs and Cody Permann and Andrew Slaughter and Richard Martineau and Derek 8261 Gaston and John Peterson and Jason Miller}, 8262 institution = {Idaho National Laboratory}, 8263 howpublished = {\url{http://mooseframework.org}}, 8264 petsc_uses = {KSP} 8265} 8266 8267@Article{ gaston2009moose, 8268 title = {MOOSE: {A} parallel computational framework for coupled systems of nonlinear 8269 equations}, 8270 author = {Gaston, D. and Newman, C. and Hansen, G. and Lebrun-Grandi{\'e}, D.}, 8271 journal = {Nuclear Engineering and Design}, 8272 volume = {239}, 8273 number = {10}, 8274 pages = {1768--1778}, 8275 year = {2009}, 8276 publisher = {Elsevier}, 8277 petsc_uses = {KSP} 8278} 8279 8280@Article{ tonks2012object, 8281 title = {An object-oriented finite element framework for multiphysics phase field 8282 simulations}, 8283 author = {Tonks, M.R. and Gaston, D. and Millett, P.C. and Andrs, D. and Talbot, P.}, 8284 journal = {Computational Materials Science}, 8285 volume = {51}, 8286 number = {1}, 8287 pages = {20--29}, 8288 year = {2012}, 8289 publisher = {Elsevier}, 8290 petsc_uses = {KSP} 8291} 8292 8293@Misc{ pylithmanual, 8294 author = {Brad Aagaard and Sue Kientz and Matthew G. Knepley and Surendra Somala and Leif 8295 Strand and Charles Williams}, 8296 title = {{PyLith} User Manual Version 2.0.0}, 8297 year = {2014}, 8298 url = {http://geodynamics.org/cig/software/github/pylith/v2.0.0/pylith-2.0.0_manual.pdf}, 8299 petsc_uses = {KSP} 8300} 8301 8302@Misc{ pylith-web-page, 8303 author = {Brad Aagaard and Matthew G. Knepley and Charles Williams}, 8304 title = {{PyLith}}, 8305 year = {2012}, 8306 url = {http://geodynamics.org/resources/pylith/}, 8307 howpublished = {\url{http://geodynamics.org/resources/pylith/}}, 8308 petsc_uses = {KSP} 8309} 8310 8311@Misc{ galemanual, 8312 author = {Walter Landry and Luke Hodkinson and Susan Kientz}, 8313 title = {Gale User Manual Version 2.0.0}, 8314 year = {2011}, 8315 url = {http://geodynamics.org/cig/software/gale/gale.pdf}, 8316 petsc_uses = {KSP} 8317} 8318 8319@Unpublished{ underworld, 8320 author = {Louis Moresi}, 8321 title = {{UnderWorld}: A Geodynamics Modelling Code}, 8322 institution = {Monash University}, 8323 url = {http://www.mcc.monash.edu/twiki/view/Codes}, 8324 petsc_uses = {KSP} 8325} 8326 8327@Article{ moresi2007computational, 8328 title = {Computational approaches to studying non-linear dynamics of the crust and 8329 mantle}, 8330 author = {Moresi, L. and Quenette, S. and Lemiale, V. and Meriaux, C. and Appelbe, B. and 8331 M{\"u}hlhaus, H.B.}, 8332 journal = {Physics of the Earth and Planetary Interiors}, 8333 volume = {163}, 8334 number = {1-4}, 8335 pages = {69--82}, 8336 year = {2007}, 8337 publisher = {Elsevier}, 8338 petsc_uses = {KSP} 8339} 8340 8341@Article{ pitt2009chaste, 8342 title = {Chaste: a test-driven approach to software development for biological modelling}, 8343 author = {Pitt-Francis, J. and Pathmanathan, P. and Bernabeu, M.O. and Bordas, R. and 8344 Cooper, J. and Fletcher, A.G. and Mirams, G.R. and Murray, P. and Osborne, J.M. 8345 and Walter, A. and others}, 8346 journal = {Computer Physics Communications}, 8347 volume = {180}, 8348 number = {12}, 8349 pages = {2452--2471}, 8350 year = {2009}, 8351 publisher = {Elsevier}, 8352 petsc_uses = {KSP} 8353} 8354 8355@Misc{ fenicsproject, 8356 title = {{The FEniCS project}}, 8357 author = {Logg, A. and {\O}lgaard, K. and Rognes, M.E. and Wells, G.N. and Jansson, J. and 8358 Kirby, R.C. and Knepley, M.G. and Lindbo, D. and Skavhaug, O.}, 8359 note = {A continually updated technical report. \url{http://fenicsproject.org}}, 8360 url = {http://fenicsproject.org}, 8361 year = {2011}, 8362 petsc_uses = {KSP} 8363} 8364 8365@Unpublished{ snark, 8366 title = {Snark: A suite of software for geoscientific applications and a philosophy of 8367 scientific software development}, 8368 institution = {Victorian Partnership for Advanced Computing}, 8369 url = {http://vpac.org/Snark}, 8370 petsc_uses = {KSP} 8371} 8372 8373@Misc{ imoose:sourceforge, 8374 author = {Guido Arians and Thomas Bauer and Christian Kaehler and Wolfgang Mai and 8375 Christoph Monzel and Dirk {van Riesen} and Christoph Schlensok}, 8376 title = {Innovative Modern Object-Oriented Solving Environment - {iMOOSE}}, 8377 note = {[Online]}, 8378 url = {http://imoose.sourceforge.net}, 8379 petsc_uses = {KSP} 8380} 8381 8382@Unpublished{ fossi, 8383 author = {Stephan Frickenhaus}, 8384 title = {FoSSI: Family of Simplified Solver Interfaces, offers scalable access to 8385 MPI-parallel solvers from CSR-matrix format frequently used in sequential/vector 8386 codes}, 8387 institution = {AWI-Bremerhaven, Germanny}, 8388 url = {http://www.awi.de/en/research/scientific_computing/research_topics_of_scientific_computing/fossi/}, 8389 petsc_uses = {KSP} 8390} 8391 8392@Unpublished{ fun3dweb, 8393 author = {Dinesh Kaushik}, 8394 title = {PETSC-FUN3D Benchmark Page}, 8395 institution = {ODU/ANL}, 8396 url = {http://www.mcs.anl.gov/petsc-fun3d}, 8397 note = {CFD Benchmark of some solvers in PETSc}, 8398 petsc_uses = {KSP} 8399} 8400 8401@Unpublished{ scirun, 8402 author = {SCIRun Development Team}, 8403 title = {SCIRun}, 8404 institution = {University of Utah}, 8405 url = {http://www.sci.utah.edu/stories/2001/jul_scirun120.html}, 8406 note = {SCIRun now uses PETSc linear solvers}, 8407 petsc_uses = {KSP} 8408} 8409 8410@Misc{ prometheus, 8411 author = {Mark F. Adams}, 8412 title = {Prometheus - A scalable unstructured finite element solver}, 8413 institution = {Berkeley}, 8414 howpublished = {\url{http://www.cs.berkeley.edu/~madams/prometheus}}, 8415 url = {http://www.cs.berkeley.edu/\~{ }madams/prometheus}, 8416 petsc_uses = {KSP} 8417} 8418 8419@Unpublished{ illuminator, 8420 author = {Adam C. Powell, IV}, 8421 title = {Illuminator Distributed Visualization Library}, 8422 url = {http://lyre.mit.edu/\~{ }powell/Illuminator.html}, 8423 petsc_uses = {KSP} 8424} 8425 8426@Unpublished{ rheoplast, 8427 title = {RheoPlast Phase Field Multi-Physics Code}, 8428 author = {Adam Powell and David Dussault and Bo Zhou}, 8429 url = {http://lyre.mit.edu/\~{ }powell/rheoplast.html}, 8430 petsc_uses = {KSP} 8431} 8432 8433@Misc{ tao-web-page, 8434 title = {{Toolkit for Advanced Optimization ({TAO})} {W}eb Page}, 8435 author = {Alp Dener and Adam Denchfield and Todd Munson and Jason Sarich and Stefan Wild 8436 and Steve Benson and Lois Curfman McInnes and Jorge Mor{\'e}}, 8437 institution = {Mathematics and Computer Science Division, Argonne National Laboratory}, 8438 howpublished = {\url{http://www.mcs.anl.gov/tao}}, 8439 petsc_uses = {KSP} 8440} 8441 8442@TechReport{ tao-user-ref, 8443 title = {{Toolkit for Advanced Optimization ({TAO}) users manual}}, 8444 author = {Alp Dener and Adam Denchfield and Todd Munson and Jason Sarich and Stefan Wild 8445 and Steve Benson and Lois Curfman McInnes}, 8446 institution = {Argonne National Laboratory}, 8447 year = {2019}, 8448 number = {ANL/MCS-TM-322 - Rev 3.12}, 8449 petsc_uses = {KSP} 8450} 8451 8452% url = "http://www.mcs.anl.gov/tao", 8453@Unpublished{ mefpp-web-page, 8454 title = {{MEF++} {W}eb {P}age}, 8455 url = {http://www.giref.ulaval.ca/ressources/projets/mefpp.html}, 8456 institution = {Groupe Interdisiplinaire de Recherche en Elements Finis}, 8457 author = {Eric Chamberland}, 8458 note = {A finite element code for fluid dynamics, solid mechanics, thermal and 8459 multiphysics}, 8460 petsc_uses = {KSP} 8461} 8462 8463@Unpublished{ tipetsc-titanium, 8464 title = {Ti-PETSc - an interface to PETSc from Titanium}, 8465 institution = {Berkeley}, 8466 author = {He, Yun and Liblit, Bun and Lin, Chang}, 8467 url = {https://citeseerx.ist.psu.edu/document?repid=rep1&type=pdf&doi=9f7959be13337c735d52e5c0b0994bdea6d75a96}, 8468 year = {1999}, 8469 petsc_uses = {KSP}, 8470} 8471 8472@Unpublished{ ptatin-web-page, 8473 title = {ptatin3d}, 8474 author = {Jed Brown and Laetitia {Le Pourhiet} and Dave A. May and Patrick Sanan}, 8475 url = {https://bitbucket.org/jedbrown/ptatin3d}, 8476 year = {2018}, 8477 petsc_uses = {KSP} 8478} 8479 8480@Misc{ multiphase-web-page, 8481 author = {Q. Zou}, 8482 title = {Multiphase flow with {PETSc}}, 8483 institution = {LANL}, 8484 howpublished = {\url{http://cnls-www.lanl.gov/~qzou}}, 8485 url = {http://cnls-www.lanl.gov/\~{ }qzou}, 8486 lab = {LANL}, 8487 petsc_uses = {KSP} 8488} 8489 8490@Misc{ electromag-web-page, 8491 title = {{EMSolve Web} page}, 8492 institution = {LLNL}, 8493 howpublished = {http://www.llnl.gov/casc/emsolve}, 8494 url = {http://www.Llnl.gov/casc/emsolve}, 8495 author = {Daniel {White et al.}}, 8496 lab = {LLNL}, 8497 petsc_uses = {KSP} 8498} 8499 8500@Unpublished{ fe-software-web-page, 8501 institution = {Kuleuven}, 8502 title = {Finite element software}, 8503 url = {http://www.esat.kuleuven.ac.be/elen/research/software-development}, 8504 petsc_uses = {KSP} 8505} 8506 8507@Misc{ petsc-web-page, 8508 author = {Satish Balay and Shrirang Abhyankar and Mark~F. Adams and Steven Benson and Jed 8509 Brown and Peter Brune and Kris Buschelman and Emil~M. Constantinescu and Lisandro 8510 Dalcin and Alp Dener and Victor Eijkhout and Jacob Faibussowitsch and William~D. 8511 Gropp and V\'{a}clav Hapla and Tobin Isaac and Pierre Jolivet and Dmitry Karpeev 8512 and Dinesh Kaushik and Matthew~G. Knepley and Fande Kong and Scott Kruger and 8513 Dave~A. May and Lois Curfman McInnes and Richard Tran Mills and Lawrence Mitchell 8514 and Todd Munson and Jose~E. Roman and Karl Rupp and Patrick Sanan and Jason Sarich 8515 and Barry~F. Smith and Stefano Zampini and Hong Zhang and Hong Zhang and Junchao 8516 Zhang}, 8517 title = {{PETS}c {W}eb page}, 8518 url = {https://petsc.org/}, 8519 howpublished = {\url{https://petsc.org/}}, 8520 year = {2024} 8521} 8522 8523@Unpublished{ petsc-debian-package, 8524 author = {Adam C. Powell, IV}, 8525 title = {Debian package for PETSc}, 8526 url = {http://lyre.mit.edu/\~{ }powell/petsc.html}, 8527 petsc_uses = {KSP} 8528} 8529 8530@Unpublished{ cactus, 8531 title = {Cactus Website}, 8532 url = {http://www.cactuscode.org/}, 8533 note = {Provides two interface to the PETSc solvers}, 8534 petsc_uses = {KSP} 8535} 8536 8537@Unpublished{ petsc-fem, 8538 author = {Mario Storti and Norberto Nigro}, 8539 title = {PETSc-FEM: A General Purpose, Parallel, Multi-Physics FEM Program}, 8540 institution = {Centro Internacional de Metodos Computacionales en Ingenieria (CIMEC)}, 8541 url = {http://www.cimec.org.ar/petscfem}, 8542 petsc_uses = {KSP} 8543} 8544 8545@Misc{ fidap, 8546 title = {FIDAP 8.5}, 8547 howpublished = {\url{http://www.fluent.com}}, 8548 url = {http://www.fluent.com}, 8549 note = {Fluent's commercial finite element fluid code uses PETSc for parallel linear 8550 solves.}, 8551 key = {FIDAP 8.5}, 8552 petsc_uses = {KSP} 8553} 8554 8555@Unpublished{ slepc, 8556 author = {Carmen Campos and Jos\'e E. Rom\'an and Eloy Romero and Andr\'es Tom\'as and 8557 Vicente Hern\'andez and Vicent Vidal}, 8558 title = {{SLEPc} Website}, 8559 url = {http://slepc.upv.es/}, 8560 note = {Scalable Library for Eigenvalue Problem Computations}, 8561 petsc_uses = {KSP} 8562} 8563 8564@TechReport{ slepc-users-manual, 8565 author = {Carmen Campos and Jos\'e E. Rom\'an and Eloy Romero and Andr\'es Tom\'as and 8566 Vicente Hern\'andez and Vicent Vidal}, 8567 title = {{SLEPc} Users Manual}, 8568 number = {DISC-II/24/02}, 8569 url = {http://slepc.upv.es/}, 8570 note = {Scalable Library for Eigenvalue Problem Computations}, 8571 petsc_uses = {KSP} 8572} 8573 8574@Misc{ deal.ii, 8575 title = {deal.II}, 8576 howpublished = {\url{http://www.dealii.org}}, 8577 url = {http://www.dealii.org}, 8578 note = {deal.II is a C++ library targeting adaptive finite elements and error estimation. 8579 It allows PETSc linear algebra and solvers to be used underneath.}, 8580 key = {deal.II 5.0}, 8581 petsc_uses = {KSP} 8582} 8583 8584@Article{ bangerth2007deal, 8585 title = {{deal.II---A general-purpose object-oriented finite element library}}, 8586 author = {Bangerth, W. and Hartmann, R. and Kanschat, G.}, 8587 journal = {ACM Transactions on Mathematical Software (TOMS)}, 8588 volume = {33}, 8589 number = {4}, 8590 pages = {24--es}, 8591 issn = {0098-3500}, 8592 year = {2007}, 8593 publisher = {ACM}, 8594 petsc_uses = {KSP} 8595} 8596 8597@Misc{ globalarrays, 8598 author = {Jarek {Nieplocha et al.}}, 8599 title = {Global Arrays}, 8600 institution = {Pacific Northwest National Laboratories}, 8601 howpublished = {\url{http://www.emsl.pnl.gov/docs/global}}, 8602 url = {http://www.emsl.pnl.gov/docs/global}, 8603 note = {Global arrays can use PETSc linear solvers}, 8604 lab = {PNNL}, 8605 petsc_uses = {KSP} 8606} 8607 8608% LiteralHTML: 8609% LiteralHTML: <a name="software"><H3><center>Software Engineering</center></H3> 8610% LiteralHTML: 8611@Article{ petsccommunity2022, 8612 title = {The Community is the Infrastructure: A Short Discussion of the {PETSc} User 8613 Community}, 8614 author = {Mark Adams and Satish Balay and Jed Brown and Victor Eijkhout and Jacob 8615 Faibussowitsch and Fande Kong and Matthew Knepley and Scott Kruger and Oana Marin 8616 and Richard Mills and Todd Munson and Patrick Sanan and Barry Smith and Hong Zhang 8617 and Hong Zhang and Junchao Zhang}, 8618 journal = {Computing in Science and Engineering}, 8619 volume = {24}, 8620 number = {03}, 8621 pages = {6--15}, 8622 issn = {1558-366X}, 8623 doi = {10.1109/MCSE.2022.3169974}, 8624 publisher = {IEEE Computer Society}, 8625 address = {Los Alamitos, CA, USA}, 8626 month = may, 8627 year = {2022}, 8628 url = {https://figshare.com/articles/conference_contribution/The_Community_is_the_Infrastructure_A_Short_Discussion_of_the_PETSc_User_Community/16523043}, 8629 petsc_uses = {KSP} 8630} 8631 8632@Article{ brownknepleysmith14, 8633 author = {Jed Brown and Matthew G. Knepley and Barry Smith}, 8634 title = {Run-time extensibility and librarization of simulation software}, 8635 journal = {IEEE Computing in Science and Engineering}, 8636 month = jan, 8637 volume = {17}, 8638 number = {1}, 8639 pages = {38--45}, 8640 doi = {10.1109/MCSE.2014.95}, 8641 year = {2015}, 8642 petsc_uses = {KSP} 8643} 8644 8645@TechReport{ ass2012, 8646 author = {Shrirang Abhyankar and Barry Smith and Kerry Stevens}, 8647 title = {Preliminary implementation of Hybrid {MPI}/pthread programming model in {PETSc}}, 8648 institution = {Argonne National Laboratory}, 8649 type = {Preprint}, 8650 year = {2012}, 8651 number = {ANL/MCS-P2011-0112}, 8652 petsc_uses = {KSP} 8653} 8654 8655@TechReport{ clearyknepley99, 8656 author = {Andrew Cleary and Matthew G. Knepley}, 8657 title = {Solvers as Operators}, 8658 institution = {Lawrence Livermore National Laboratory}, 8659 type = {Technical Report}, 8660 number = {UCRL-ID-135342}, 8661 year = {1999}, 8662 petsc_uses = {KSP} 8663} 8664 8665@TechReport{ smcabbkz2012, 8666 author = {Barry Smith and Lois Curfman McInnes and Emil Constantinescu and Mark Adams and 8667 Satish Balay and Jed Brown and Matthew Knepley and Hong Zhang}, 8668 title = {{PETSc's} software strategy for the design space of composable extreme-scale 8669 solvers}, 8670 institution = {Argonne National Laboratory}, 8671 type = {Preprint}, 8672 note = {{DOE} Exascale Research Conference, April 16-18, 2012, Portland, OR}, 8673 year = {2012}, 8674 number = {ANL/MCS-P2059-0312}, 8675 petsc_uses = {KSP} 8676} 8677 8678@InProceedings{ mhwpmhs2009, 8679 author = {R. T. Mills and F. M. Hoffman and P. H. Worley and K. S. Pwerumalla and A. Mirin 8680 and G. E. Hammond and B. Smith}, 8681 title = {Coping at the User-Level with Resource Limitations in the {Cray} Message Passing 8682 Toolkit {MPI} at Scale}, 8683 booktitle = {Cray Users Group Conference}, 8684 year = {2009}, 8685 petsc_uses = {KSP} 8686} 8687 8688@InProceedings{ msmhls2010, 8689 author = {R. T. Mills and V. Sripathi and G. Mahinthakumar and G. Hammond and P. C. 8690 Lichtner and B. F. Smith}, 8691 title = {Engineering {PFLOTRAN} for Scalable Performance on {Cray} {XT} and {IBM} 8692 {BlueGene} Architectures}, 8693 booktitle = {Proceedings of SciDAC 2010 Annual Meeting}, 8694 year = {2010}, 8695 petsc_uses = {KSP} 8696} 8697 8698@InCollection{ msk2013, 8699 author = {Victor Minden and Barry F. Smith and Matthew G. Knepley}, 8700 title = {Preliminary Implementation of {PETSc} Using {GPUs}}, 8701 booktitle = {GPU Solutions to Multi-scale Problems in Science and Engineering}, 8702 series = {Lecture Notes in Earth System Sciences}, 8703 editor = {David A. Yuen and Long Wang and Xuebin Chi and Lennart Johnsson and Wei Ge and 8704 Yaolin Shi}, 8705 doi = {10.1007/978-3-642-16405-7_7}, 8706 publisher = {Springer Berlin Heidelberg}, 8707 pages = {131--140}, 8708 year = {2013}, 8709 isbn = {978-3-642-16404-0}, 8710 petsc_uses = {KSP} 8711} 8712 8713@InCollection{ knepleyyuen13, 8714 author = {Matthew G. Knepley and David A. Yuen}, 8715 title = {Why Scientists and Engineers need {GPU}s today}, 8716 booktitle = {GPU Solutions to Multi-scale Problems in Science and Engineering}, 8717 series = {Lecture Notes in Earth System Sciences}, 8718 editor = {David A. Yuen and Long Wang and Xuebin Chi and Lennart Johnsson and Wei Ge and 8719 Yaolin Shi}, 8720 doi = {10.1007/978-3-642-16405-7_1}, 8721 publisher = {Springer Berlin Heidelberg}, 8722 pages = {131--140}, 8723 year = {2013}, 8724 isbn = {978-3-642-16404-0}, 8725 petsc_uses = {KSP} 8726} 8727 8728@InCollection{ karpeevknepleybrune13, 8729 author = {Dmitry A. Karpeev and Matthew G. Knepley and Peter R. Brune}, 8730 title = {Accurate Evaluation of Local Averages on {GPGPUs}}, 8731 booktitle = {GPU Solutions to Multi-scale Problems in Science and Engineering}, 8732 series = {Lecture Notes in Earth System Sciences}, 8733 editor = {David A. Yuen and Long Wang and Xuebin Chi and Lennart Johnsson and Wei Ge and 8734 Yaolin Shi}, 8735 doi = {10.1007/978-3-642-16405-7_30}, 8736 publisher = {Springer Berlin Heidelberg}, 8737 pages = {487--501}, 8738 year = {2013}, 8739 isbn = {978-3-642-16404-0}, 8740 petsc_uses = {KSP} 8741} 8742 8743@InCollection{ zhengetal13, 8744 title = {{GPU} Implementation of Multigrid Solver for {S}tokes Equation with Strongly 8745 Variable Viscosity}, 8746 author = {Liang Zheng and Taras Gerya and Matthew G. Knepley and David A. Yuen and Huai 8747 Zhang and Yaolin Shi}, 8748 booktitle = {GPU Solutions to Multi-scale Problems in Science and Engineering}, 8749 series = {Lecture Notes in Earth System Sciences}, 8750 editor = {David A. Yuen and Long Wang and Xuebin Chi and Lennart Johnsson and Wei Ge and 8751 Yaolin Shi}, 8752 doi = {10.1007/978-3-642-16405-7_21}, 8753 publisher = {Springer Berlin Heidelberg}, 8754 pages = {321--333}, 8755 year = {2013}, 8756 isbn = {978-3-642-16404-0}, 8757 petsc_uses = {KSP} 8758} 8759 8760@Article{ zhengetal13b, 8761 title = {Implementation of a multigrid solver on {GPU} for {S}tokes equations with 8762 strongly variable viscosity based on {M}atlab and {CUDA}}, 8763 author = {Liang Zheng and Taras Gerya and Matthew G. Knepley and David A. Yuen and Huai 8764 Zhang and Yaolin Shi}, 8765 journal = {IJHPCA}, 8766 volume = {28}, 8767 number = {1}, 8768 pages = {50--60}, 8769 doi = {10.1177/1094342013478640}, 8770 year = {2013}, 8771 petsc_uses = {KSP} 8772} 8773 8774@InBook{ s2011, 8775 author = {B. Smith}, 8776 chapter = {PETSc, the Portable, Extensible Toolkit for Scientific computing}, 8777 title = {Encyclopedia of Parallel Computing}, 8778 bookeditor = {D. Padua}, 8779 publisher = {Springer}, 8780 year = {2011}, 8781 petsc_uses = {KSP} 8782} 8783 8784@Article{ acostamejia06, 8785 author = {Carlos D. Acosta and Carlos E. Mej\'ia}, 8786 title = {Computaci\'on cient\'ifica en paralelo con interfaz MATLAB a PETSc}, 8787 journal = {Lecturas Matem\'aticas}, 8788 volume = {27}, 8789 year = {2006}, 8790 pages = {213--224}, 8791 petsc_uses = {KSP} 8792} 8793 8794@InProceedings{ quenettemoresisunterappelbe07, 8795 author = {Steve Quenette and Louis Moresi and {P. D.} Sunter and Bill F. Appelbe}, 8796 title = {Explaining StGermain: An aspect oriented environment for building extensible 8797 computational mechanics modeling software}, 8798 booktitle = {Parallel and Distributed Processing Symposium, IPDPS 2007}, 8799 publisher = {IEEE}, 8800 pages = {1--8}, 8801 yerar = {2007}, 8802 petsc_uses = {KSP} 8803} 8804 8805@Article{ dfm1, 8806 title = {Vectorized sparse matrix multiply for compressed row storage format}, 8807 author = {E. F. D'Azevedo and M. R. Fahey and R. T. Mills}, 8808 journal = {Lecture Notes in Computer Science}, 8809 year = {2005}, 8810 pages = {99--106}, 8811 volume = {3514}, 8812 lab = {ORNL}, 8813 petsc_uses = {KSP} 8814} 8815 8816@InProceedings{ laniquintinokimpedeconinckvandewallepoedts05, 8817 author = {Andrea Lani and Tiago Quintino and Dries Kimpe and Herman Deconinck and Stefan 8818 Vandewalle and Stefaan Poedts}, 8819 title = {The COOLFluiD Framework: Design Solutions for High Performance Object Oriented 8820 Scientific Computing Software}, 8821 booktitle = {Computational Science ICCS 2005: 5th International Conference}, 8822 year = {2005}, 8823 note = {Lecture Notes in Computer Science}, 8824 volume = {3514}, 8825 publisher = {Springer-Verlag GmbH}, 8826 petsc_uses = {KSP} 8827} 8828 8829@InProceedings{ dalcin-paz-storti, 8830 author = {L. Dalcin and R. Paz and M. Storti}, 8831 title = {Desarrollo de Aplicaciones Paralelas en Python}, 8832 booktitle = {Proceedings of *XIV Congress on Numerical Methods and its Applications (ENIEF). 8833 Bariloche, Argentina}, 8834 year = {2004}, 8835 petsc_uses = {KSP} 8836} 8837 8838@Article{ mpi-python, 8839 author = {L. Dalcin and R. Paz and M. Storti}, 8840 title = {MPI for Python}, 8841 journal = {Journal of Parallel and Distributed Computing}, 8842 year = {2005}, 8843 petsc_uses = {KSP} 8844} 8845 8846@Unpublished{ hrv02a, 8847 title = {{SLEPc}: Scalable Library for Eigenvalue Problem Computations}, 8848 author = {V. Hernandex and J. E. Roman and V. Vidal}, 8849 note = {Submited to VecPar 2002}, 8850 year = {2002}, 8851 petsc_uses = {KSP} 8852} 8853 8854@Article{ knyazev2007block, 8855 title = {Block Locally Optimal Preconditioned Eigenvalue Xolvers {(BLOPEX)} in {Hypre} and 8856 {PETSc}}, 8857 author = {Knyazev, A. V. and Argentati, M. E. and Lashuk, I. and Ovtchinnikov, E. E.}, 8858 journal = {SIAM Journal on Scientific Computing}, 8859 volume = {29}, 8860 pages = {2224-2239}, 8861 doi = {10.1137/060661624}, 8862 year = {2007}, 8863 petsc_uses = {KSP} 8864} 8865 8866@MastersThesis{ aarrestad-master, 8867 author = {Asbjorn Hoiland Aarrestad}, 8868 title = {Time Dependent Solution of the Schrodinger Equation for Parallel Computers}, 8869 school = {University of Bergen}, 8870 month = aug, 8871 year = {2003}, 8872 url = {http://www.parallab.uib.no/projects/molecul/matrix/}, 8873 note = {Implemented Runge-Kutta methods using PETSc}, 8874 petsc_uses = {KSP} 8875} 8876 8877@PhDThesis{ kaushik-phd, 8878 author = {D. K. Kaushik}, 8879 title = {Performance Modeling and Prediction for the Scalable Solution of Partial 8880 Differential Equations on Unstructured Grids}, 8881 school = {Old Dominion University}, 8882 month = dec, 8883 year = {2002}, 8884 url = {http://www.mcs.anl.gov/\~{ }kaushik/Papers/thesis.ps}, 8885 petsc_uses = {KSP} 8886} 8887 8888@TechReport{ rb1, 8889 author = {Rickard Bergstrom}, 8890 title = {Object Oriented Implementation of a General Finite Element Code}, 8891 number = {2002-13}, 8892 institution = {Chalmers Finite Element Center, Chalmers University of Technology}, 8893 year = {2002}, 8894 url = {http://www.phi.chalmers.se/pub/preprints/pdf/phiprint-2002-13.pdf}, 8895 note = {Discribes a finite element software package that uses PETSc for its solvers}, 8896 petsc_uses = {KSP} 8897} 8898 8899@InProceedings{ dbl1, 8900 author = {Enzo A. Dari and Gustavo C. Buscaglia and Adrian J. Lew}, 8901 title = {A Parallel General Purpose Finite Element System}, 8902 booktitle = {IX SIAM Conference on Parallel Processing for Scientific Computing}, 8903 publisher = {SIAM}, 8904 year = {1999}, 8905 url = {http://cabmec1.cnea.gov.ar/papers/apgpfes.ps.gz}, 8906 note = {Describes software that uses PETSc for its parallel linear solves}, 8907 petsc_uses = {KSP} 8908} 8909 8910@Article{ p1, 8911 title = {Parallel Components for PDEs and Optimization: Some Issues and Experiences}, 8912 author = {B. Norris and S. Balay and S. Benson and L. Freitag and P. Hovland and L. McInnes 8913 and B. Smith}, 8914 journal = {Parallel Computing}, 8915 year = {2002}, 8916 pages = {1811--1831}, 8917 volume = {28 (12)}, 8918 petsc_uses = {KSP} 8919} 8920 8921@Article{ automatic-ad, 8922 author = {Paul Hovland and Boyana Norris and Barry Smith}, 8923 title = {Making Automatic Differentiation Truly Automatic: Coupling {PETSc} with {ADIC}}, 8924 year = {2005}, 8925 journal = {Future Generation Computer Systems}, 8926 volume = {21}, 8927 number = {8}, 8928 pages = {1426--1438}, 8929 petsc_uses = {KSP} 8930} 8931 8932@TechReport{ remote-math, 8933 author = {Elizabeth Dolan and Paul Hovland and Jorge Mor\'e and Boyana Norris and Barry 8934 Smith}, 8935 title = {Remote Access to Mathematical Software}, 8936 number = {ANL/MCS-P889-0601}, 8937 institution = {Mathematics and Computer Science Division, Argonne National Laboratory}, 8938 month = jun, 8939 year = {2001}, 8940 url = {http://icm.mcs.kent.edu/research/iamc01proceedings.html}, 8941 petsc_uses = {KSP} 8942} 8943 8944@InProceedings{ gropp98, 8945 author = {William D. Gropp}, 8946 title = {Exploiting Existing Software in Libraries: Successes, Failures, and Reasons Why}, 8947 publisher = {SIAM}, 8948 booktitle = {Proceedings of the SIAM Workshop on Object Oriented Methods for Inter-operable 8949 Scientific and Engineering Computing}, 8950 year = {1999}, 8951 pages = {21-29}, 8952 petsc_uses = {KSP} 8953} 8954 8955@InProceedings{ knepleysarin99, 8956 author = {Matthew Knepley and Vivek Sarin}, 8957 title = {Algorithm Development for Large Scale Computing}, 8958 publisher = {SIAM}, 8959 booktitle = {Proceedings of the SIAM Workshop on Object Oriented Methods for Inter-operable 8960 Scientific and Engineering Computing}, 8961 note = {\url{http://books.google.com/books?id=2Da5OcnjPSgC&lpg=PA58&ots=TJCK64BUeg&dq=Bill%20Gropp%20Science%20Engineering%20Object%20Oriented&pg=PA138#v=onepage&q&f=false}}, 8962 year = {1999}, 8963 petsc_uses = {KSP} 8964} 8965 8966@InBook{ bgms00, 8967 author = {S. Balay and W. D. Gropp and L. C. McInnes and B. F. Smith}, 8968 chapter = {Software for the Scalable Solution of {PDEs}}, 8969 url = {ftp://info.mcs.anl.gov/pub/tech_reports/reports/P834.ps.Z}, 8970 title = {CRPC Handbook of Parallel Computing}, 8971 editor = {J. Dongarra and I. Foster and G. Fox and B. Gropp and K. Kennedy and L. Torczon 8972 and A. White}, 8973 publisher = {Morgan Kaufmann Publishers}, 8974 year = {2002}, 8975 petsc_uses = {KSP} 8976} 8977 8978@InProceedings{ hovland_norris_smith98, 8979 author = {Paul Hovland and Boyana Norris and Lucas Roh and Barry Smith}, 8980 title = {Developing a Derivative-Enhanced Object-Oriented Toolkit for Scientific 8981 Computations}, 8982 publisher = {SIAM}, 8983 booktitle = {Proceedings of the SIAM Workshop on Object Oriented Methods for Inter-operable 8984 Scientific and Engineering Computing}, 8985 url = {ftp://info.mcs.anl.gov/pub/tech_reports/reports/P731.ps.Z}, 8986 note = {also available as Argonne preprint ANL/MCS-P731-1098}, 8987 year = {1999}, 8988 pages = {129-137}, 8989 petsc_uses = {KSP} 8990} 8991 8992@InProceedings{ efficient, 8993 author = {Satish Balay and William D. Gropp and Lois Curfman McInnes and Barry F. Smith}, 8994 title = {Efficient Management of Parallelism in Object Oriented Numerical Software 8995 Libraries}, 8996 booktitle = {Modern Software Tools in Scientific Computing}, 8997 editor = {E. Arge and A. M. Bruaset and H. P. Langtangen}, 8998 publisher = {Birkhauser Press}, 8999 pages = {163--202}, 9000 year = {1997}, 9001 petsc_uses = {KSP} 9002} 9003 9004% url = "ftp://info.mcs.anl.gov/pub/tech_reports/reports/P634.ps.Z" 9005@TechReport{ petsc-user-ref, 9006 author = {Satish Balay and Shrirang Abhyankar and Mark~F. Adams and Steven Benson and Jed 9007 Brown and Peter Brune and Kris Buschelman and Emil Constantinescu and Lisandro 9008 Dalcin and Alp Dener and Victor Eijkhout and Jacob Faibussowitsch and William~D. 9009 Gropp and V\'{a}clav Hapla and Tobin Isaac and Pierre Jolivet and Dmitry Karpeev 9010 and Dinesh Kaushik and Matthew~G. Knepley and Fande Kong and Scott Kruger and 9011 Dave~A. May and Lois Curfman McInnes and Richard Tran Mills and Lawrence Mitchell 9012 and Todd Munson and Jose~E. Roman and Karl Rupp and Patrick Sanan and Jason Sarich 9013 and Barry~F. Smith and Stefano Zampini and Hong Zhang and Hong Zhang and Junchao 9014 Zhang}, 9015 title = {{PETSc/TAO} Users Manual}, 9016 institution = {Argonne National Laboratory}, 9017 number = {ANL-21/39 - Revision 3.21}, 9018 doi = {10.2172/2205494}, 9019 year = {2024} 9020} 9021 9022% url = {https://petsc.org/release} 9023@TechReport{ petsc-developers, 9024 author = {Scott Kruger and Patrick Sanan and Barry~F. Smith}, 9025 title = {{PETS}c Developers Guide}, 9026 institution = {Argonne National Laboratory}, 9027 number = {ANL-18/18}, 9028 year = {2018}, 9029 url = {https://petsc.org/release/developers}, 9030 petsc_uses = {KSP} 9031} 9032 9033@Unpublished{ alice-memory-snooper, 9034 author = {Ibrahima Ba and Barry~F. Smith}, 9035 title = {The {ALICE} Memory Snooper}, 9036 year = {1999}, 9037 petsc_uses = {KSP} 9038} 9039 9040@TechReport{ petsc-user-ref-polish, 9041 author = {Marcin Bojko and Piotr Krzyzanowski}, 9042 title = {Rozwiazywanie ukladow rownan przy pomocy pakietu PETSc}, 9043 institution = {Instytut Matematyki, Stosowanej i Mechaniki, Uniwersytet Warszawski}, 9044 year = {1998}, 9045 note = {An introduction to PETSc in Polish}, 9046 petsc_uses = {KSP} 9047} 9048 9049@InProceedings{ abghmn00, 9050 title = {Integrating Automatic Differentiation with Object-Oriented Toolkits for 9051 High-Performance Scientific Computing}, 9052 author = {J. Abate and S. Benson and L. Grignon and P. Hovland and L. C. McInnes and B. 9053 Norris}, 9054 url = {ftp://info.mcs.anl.gov/pub/tech_reports/reports/P820.ps.Z}, 9055 booktitle = {Automatic Differentiation of Algorithms: From Simulation to Optimization}, 9056 editor = {George Corliss and Christ\`{e}le Faure and Andreas Griewank and Laurent 9057 Hasco\"{e}t and Uwe Naumann}, 9058 publisher = {Springer}, 9059 year = {2002}, 9060 petsc_uses = {KSP} 9061} 9062 9063@Unpublished{ petsc-mpi-paper, 9064 author = {Lois Curfman McInnes and Barry F. Smith}, 9065 title = {{PETS}c 2.0: A Case Study of Using {MPI} to Develop Numerical Software 9066 Libraries}, 9067 note = {Proceedings of the MPI Developers Conference, Notre Dame, IN}, 9068 month = jun, 9069 year = {1995}, 9070 petsc_uses = {KSP} 9071} 9072 9073@InProceedings{ miss-paper, 9074 author = {William D. Gropp and Barry F. Smith}, 9075 title = {Scalable, Extensible, and Portable Numerical Libraries}, 9076 publisher = {IEEE}, 9077 year = {1994}, 9078 booktitle = {Proceedings of the Scalable Parallel Libraries Conference}, 9079 address = {Mississippi State University}, 9080 pages = {87--93}, 9081 keyword = {numerical libraries, scientific computing, parallel computing}, 9082 petsc_uses = {KSP} 9083} 9084 9085@InProceedings{ snes-paper, 9086 author = {William D. Gropp and Lois Curfman McInnes and Barry F. Smith}, 9087 title = {Scalable Libraries for Solving Systems of Nonlinear Equations and Unconstrained 9088 Minimization Problems}, 9089 publisher = {IEEE}, 9090 year = {1995}, 9091 booktitle = {Proceedings of the Scalable Parallel Libraries Conference}, 9092 address = {Mississippi State University}, 9093 pages = {60-67}, 9094 keyword = {nonlinear equations, optimization, superconductivity, parallel computing}, 9095 petsc_uses = {KSP} 9096} 9097 9098@Article{ dsneutral, 9099 author = {Barry F. Smith and William D. Gropp}, 9100 title = {The Design of Data-structure-neutral Libraries for the Iterative Solution of 9101 Sparse Linear Systems}, 9102 journal = {Scientific Programming}, 9103 volume = {5}, 9104 pages = {329--336}, 9105 key = {GroppSmith96 ! KSP design}, 9106 year = {1996}, 9107 petsc_uses = {KSP} 9108} 9109 9110@InProceedings{ bgms98, 9111 author = {Satish Balay and William D. Gropp and Lois Curfman McInnes and Barry F. Smith}, 9112 title = {A Microkernel Design for Component-based Parallel Numerical Software Systems}, 9113 booktitle = {Proceedings of the SIAM Workshop on Object Oriented Methods for Inter-operable 9114 Scientific and Engineering Computing}, 9115 publisher = {SIAM}, 9116 pages = {58-67}, 9117 url = {ftp://info.mcs.anl.gov/pub/tech_reports/reports/P727.ps.Z}, 9118 year = {1998}, 9119 petsc_uses = {KSP} 9120} 9121 9122@Article{ hkm98, 9123 author = {M. E. Hayder and D. E. Keyes and P. Mehrotra}, 9124 title = {A Comparison of the {PETSc} Library and {HPF} Implementations of an Archetypal 9125 {PDE} Computation}, 9126 journal = {Advances in Engineering Software}, 9127 volume = {29}, 9128 pages = {415-424}, 9129 year = {1998}, 9130 petsc_uses = {KSP} 9131} 9132 9133@TechReport{ pdpta99, 9134 author = {L. A. Freitag and W. D. Gropp and P. D. Hovland and L. C. McInnes and B. F. 9135 Smith}, 9136 title = {Infrastructure and Interfaces for Large-Scale Numerical Software}, 9137 note = {to appear in the Proceedings of the 1999 International Conference on Parallel and 9138 Distributed Processing Techniques and Applications, June 28 - July 1, 1999, Las 9139 Vegas, Nevada}, 9140 institution = {Mathematics and Computer Science Division, Argonne National Laboratory}, 9141 url = {ftp://info.mcs.anl.gov/pub/tech_reports/reports/P751.ps.Z}, 9142 number = {ANL/MCS-P751-0599}, 9143 year = {1999}, 9144 petsc_uses = {KSP} 9145} 9146 9147@InProceedings{ bbh:com, 9148 author = {C. H. Bischof and H. M. B{\"u}cker and P. D. Hovland}, 9149 title = {{On Combining Computational Differentiation and Toolkits for Parallel Scientific 9150 Computing}}, 9151 booktitle = {Euro-Par 2000 -- Parallel Processing, Proceedings of the 6th International 9152 Euro-Par Conference, Munich, Germany, August/September 2000}, 9153 year = {2000}, 9154 editor = {A. Bode and T. Ludwig and W. Karl and R. Wism{\"u}ller}, 9155 volume = {1900}, 9156 series = {Lecture Notes in Computer Science}, 9157 pages = {86--94}, 9158 address = {Berlin}, 9159 publisher = {Springer}, 9160 url = {ftp://info.mcs.anl.gov/pub/tech_reports/reports/P797.ps.Z}, 9161 petsc_uses = {KSP} 9162} 9163 9164@InProceedings{ overture00, 9165 author = {K. R. Buschelman and W. D. Gropp and L. C. McInnes and B. F. Smith}, 9166 title = { {PETSc and Overture}: Lessons Learned Developing an Interface between 9167 Components}, 9168 url = {ftp://info.mcs.anl.gov/pub/tech_reports/reports/P858.ps.Z}, 9169 booktitle = {Proceedings of the International Federation for Information Processing Working 9170 Conference on Software Architectures for Scientific Computing, Kluwer}, 9171 year = {2000}, 9172 pages = {57--68}, 9173 petsc_uses = {KSP} 9174} 9175 9176@TechReport{ smith97, 9177 title = {An Interface for Efficient Vector Scatters and Gathers on Parallel Machines}, 9178 url = {ftp://info.mcs.anl.gov/pub/tech_reports/reports/P701.ps.Z}, 9179 number = {ANL/MCS-P701}, 9180 author = {Barry F. Smith}, 9181 institution = {Mathematics and Computer Science Division, Argonne National Laboratory}, 9182 petsc_uses = {KSP} 9183} 9184 9185@Article{ smith98, 9186 author = {Barry Smith}, 9187 title = {The Transition of Numerical Software: From Nuts-and-Bolts to Abstraction}, 9188 journal = {SIGNUM Newsletter}, 9189 year = {1998}, 9190 url = {ftp://info.mcs.anl.gov/pub/tech_reports/reports/P712.ps.Z}, 9191 petsc_uses = {KSP} 9192} 9193 9194@TechReport{ ad-petsc-tm, 9195 title = {Using {ADIFOR} and {ADIC} to Provide a {J}acobian for the {SNES} Component of 9196 {PETSc}}, 9197 author = {Christian Bischof and Paul Hovland and Po-Ting Wu}, 9198 year = {1997}, 9199 type = {Technical Memorandum}, 9200 institution = {ANL}, 9201 url = {ftp://info.mcs.anl.gov/pub/tech_reports/reports/TM233.ps.Z}, 9202 number = {ANL/MCS-TM-233}, 9203 petsc_uses = {KSP} 9204} 9205 9206% LiteralHTML: 9207% LiteralHTML: <a name="algorithm"><H3><center>Algorithm design and analysis</center></H3> 9208% LiteralHTML: 9209@PhDThesis{ klotzthesis2019, 9210 author = {Thomas S. Klotz}, 9211 title = {Numerical Analysis of Nonlinear Boundary Integral Equations Arising in Molecular 9212 Biology}, 9213 school = {Rice University}, 9214 year = {2019}, 9215 petsc_uses = {KSP} 9216} 9217 9218@Article{ klotzbardhanknepley2018, 9219 title = {Efficient Evaluation of Ellipsoidal Harmonics for Potential Modeling}, 9220 author = {Thomas S. Klotz and Jaydeep Bardhan and Matthew G. Knepley}, 9221 journal = {arXiv e-prints}, 9222 eprint = {1708.06028}, 9223 archiveprefix = {arXiv}, 9224 primaryclass = {math.na}, 9225 year = {2018}, 9226 note = {\url{http://arxiv.org/abs/1708.06028}}, 9227 petsc_uses = {KSP} 9228} 9229 9230@Misc{ brown2016, 9231 title = {Threading Tradeoffs in Domain Decomposition}, 9232 author = {Jed Brown}, 9233 note = {SIAM Parallel Processing Conference, To Thread or Not To Thread Minisymposium, 9234 \url{https://www.cse.buffalo.edu/~knepley/presentations/SIAMPP2016_1.pdf}}, 9235 url = {https://www.cse.buffalo.edu/~knepley/presentations/SIAMPP2016_1.pdf}, 9236 year = {2016}, 9237 petsc_uses = {KSP} 9238} 9239 9240@Article{ changnakshatralaknepleyjohnsson2017, 9241 title = {A performance spectrum for parallel computational frameworks that solve {PDEs}}, 9242 author = {Justin Chang and Kalyana B. Nakshatrala and Matthew G. Knepley and Lennart 9243 Johnsson}, 9244 journal = {Concurency: Practice and Experience}, 9245 volume = {30}, 9246 number = {11}, 9247 eprint = {1705.03625}, 9248 doi = {10.1002/cpe.4401}, 9249 year = {2017}, 9250 petsc_uses = {KSP} 9251} 9252 9253@Article{ changfabienknepleymills2018, 9254 title = {Comparative study of finite element methods using the Time-Accuracy-Size {(TAS)} 9255 spectrum analysis}, 9256 author = {Justin Chang and Maurice S. Fabien and Matthew G. Knepley and Richard T. Mills}, 9257 journal = {SIAM Journal on Scientific Computing}, 9258 volume = {40}, 9259 number = {6}, 9260 pages = {C779--C802}, 9261 eprint = {1802.07832}, 9262 doi = {10.1137/18M1172260}, 9263 year = {2018}, 9264 petsc_uses = {KSP} 9265} 9266 9267@Article{ joshaghanichangnakshatralaknepley2019, 9268 title = {Composable solvers for the four-field double porosity/permeability model}, 9269 author = {M. S. Joshaghani and Justin Chang and Kalyana B. Nakshatrala and Matthew G. 9270 Knepley}, 9271 journal = {Journal of Computational Physics}, 9272 volume = {386}, 9273 pages = {428--466}, 9274 doi = {10.1016/j.jcp.2019.02.020}, 9275 year = {2019}, 9276 petsc_uses = {KSP} 9277} 9278 9279@InProceedings{ barralknepleylangepiggottgorman2016, 9280 title = {Anisotropic mesh adaptation in {Firedrake} with {PETSc} {DMPlex}}, 9281 author = {Nicolas Barral and Matthew G. Knepley and Michael Lange and Matthew D. Piggott 9282 and Gerard J. Gorman}, 9283 booktitle = {25th International Meshing Roundtable}, 9284 editor = {Steve Owen and Hang Si}, 9285 month = sep, 9286 address = {Washington, DC}, 9287 pages = {1--5}, 9288 url = {http://imr.sandia.gov/papers/imr25/2026_imr25RN_Barral.pdf}, 9289 year = {2016}, 9290 petsc_uses = {KSP} 9291} 9292 9293@Article{ adamsbrownknepleysamtaney2016, 9294 title = {Segmental Refinement: A Multigrid Technique for Data Locality}, 9295 author = {Mark F. Adams and Jed Brown and Matthew G. Knepley and Ravi Samtaney}, 9296 journal = {SIAM Journal on Scientific Computing}, 9297 url = {http://epubs.siam.org/toc/sjoce3/38/4 }, 9298 epub = {http://arxiv.org/abs/1406.7808}, 9299 volume = {8}, 9300 number = {4}, 9301 pages = {C426--C440}, 9302 doi = {10.1137/140975127}, 9303 year = {2016}, 9304 petsc_uses = {KSP} 9305} 9306 9307@InProceedings{ maysananruppknepleysmith2016, 9308 title = {Extreme-Scale Multigrid Components within {PETSc}}, 9309 author = {Dave A. May and Patrick Sanan and Karl Rupp and Matthew G. Knepley and Barry F. 9310 Smith}, 9311 booktitle = {Proceedings of the {Platform for Advanced Scientific Computing Conference}}, 9312 series = {PASC '16}, 9313 isbn = {978-1-4503-4126-4}, 9314 location = {Lausanne, Switzerland}, 9315 pages = {5:1--5:12}, 9316 articleno = {5}, 9317 numpages = {12}, 9318 doi = {10.1145/2929908.2929913}, 9319 acmid = {2929913}, 9320 publisher = {ACM}, 9321 address = {New York, NY, USA}, 9322 keywords = {GPU, HPC, agglomeration, coarse-level solver, multigrid, parallel computing, 9323 preconditioning}, 9324 year = {2016}, 9325 petsc_uses = {KSP} 9326} 9327 9328@Article{ liu2015field, 9329 title = {Field-Split Preconditioned Inexact Newton Algorithms}, 9330 author = {Lulu Liu and David E Keyes}, 9331 journal = {SIAM Journal on Scientific Computing}, 9332 volume = {37}, 9333 number = {3}, 9334 pages = {A1388--A1409}, 9335 year = {2015}, 9336 publisher = {SIAM}, 9337 petsc_uses = {KSP} 9338} 9339 9340@Article{ lujiaomissirlis2014, 9341 title = {A hybrid geometric+ algebraic multigrid method with semi-iterative smoothers}, 9342 author = {Cao Lu and Xiangmin Jiao and Nikolaos Missirlis}, 9343 journal = {Numerical Linear Algebra with Applications}, 9344 volume = {21}, 9345 number = {2}, 9346 pages = {221--238}, 9347 year = {2014}, 9348 publisher = {Wiley Online Library}, 9349 petsc_uses = {KSP} 9350} 9351 9352@Article{ badiamartinprincipe2013, 9353 title = {Enhanced balancing Neumann-Neumann preconditioning in computational fluid and 9354 solid mechanics}, 9355 author = {Santiago Badia and Alberto F. Mart\'in and Javier Principe}, 9356 journal = {International Journal for Numerical Methods in Engineering}, 9357 volume = {96}, 9358 number = {4}, 9359 pages = {203--230}, 9360 year = {2013}, 9361 petsc_uses = {KSP} 9362} 9363 9364@Article{ morganknepleysananscott2016, 9365 title = {A Stochastic Performance Model for Pipelined {Krylov} Methods}, 9366 author = {Hannah Morgan and Matthew G. Knepley and Patrick Sanan and L. Ridgway Scott}, 9367 journal = {Concurrency and Computation: Practice and Experience}, 9368 volume = {28}, 9369 pages = {4532--4542}, 9370 year = {2016}, 9371 url = {http://arxiv.org/abs/1602.04873}, 9372 doi = {10.1002/cpe.3820}, 9373 petsc_uses = {KSP} 9374} 9375 9376@Article{ morgansananknepleymills2020, 9377 title = {Understanding performance variability in standard and pipelined parallel {Krylov} 9378 solvers}, 9379 author = {Hannah Morgan and Patrick Sanan and Matthew G. Knepley and Richard Tran Mills}, 9380 journal = {The International Journal of High Performance Computing Applications}, 9381 volume = {35}, 9382 issue = {1}, 9383 doi = {10.1177/1094342020966835}, 9384 url = {https://doi.org/10.1177/1094342020966835}, 9385 eprint = {https://doi.org/10.1177/1094342020966835}, 9386 year = {2020}, 9387 petsc_uses = {KSP} 9388} 9389 9390@Article{ msz2013, 9391 title = {Efficient Sparse Matrix-Matrix Products Using Colorings}, 9392 author = {M. McCourt and B. F. Smith and H. Zhang}, 9393 journal = {SIAM Journal on Matrix Analysis and Applications}, 9394 year = {2015}, 9395 note = {To appear}, 9396 petsc_uses = {KSP} 9397} 9398 9399@Article{ bassi2014agglomeration, 9400 title = {Agglomeration-based physical frame d{G} discretizations: {A}n attempt to be mesh 9401 free}, 9402 author = {Bassi, Francesco and Botti, Lorenzo and Colombo, Alessandro}, 9403 journal = {Mathematical Models and Methods in Applied Sciences}, 9404 volume = {24}, 9405 number = {08}, 9406 pages = {1495--1539}, 9407 year = {2014}, 9408 publisher = {World Scientific}, 9409 petsc_uses = {KSP} 9410} 9411 9412@Article{ jhuranidemkowicz12, 9413 author = {{Jhurani}, C. and {Demkowicz}, L.}, 9414 title = {{Multiscale modeling using goal-oriented adaptivity and numerical homogenization. 9415 Part II: Algorithms for the Moore-Penrose pseudoinverse}}, 9416 journal = {Computer Methods in Applied Mechanics and Engineering}, 9417 volume = {213}, 9418 pages = {418-426}, 9419 year = {2012}, 9420 month = mar, 9421 doi = {10.1016/j.cma.2011.06.003}, 9422 adsurl = {http://adsabs.harvard.edu/abs/2012CMAME.213..418J}, 9423 petsc_uses = {KSP} 9424} 9425 9426@Article{ yangcai11, 9427 author = {Yang, Haijian and Cai, Xiao-Chuan}, 9428 title = {Parallel Two-Grid Semismooth {N}ewton--{K}rylov--{S}chwarz Method for Nonlinear 9429 Complementarity Problems}, 9430 journal = {J. Sci. Comput.}, 9431 issue_date = {May 2011}, 9432 volume = {47}, 9433 number = {2}, 9434 month = may, 9435 pages = {258--280}, 9436 year = {2011}, 9437 issn = {0885-7474}, 9438 numpages = {23}, 9439 doi = {10.1007/s10915-010-9436-4}, 9440 acmid = {1971246}, 9441 publisher = {Plenum Press}, 9442 address = {New York, NY, USA}, 9443 keywords = {Complementarity problem, Grid sequencing, Parallel computing, Schwarz 9444 preconditioners, Semismooth Newton, Two-level methods}, 9445 petsc_uses = {KSP} 9446} 9447 9448@Article{ rheinbach09, 9449 author = {Rheinbach, Oliver}, 9450 title = {Parallel Iterative Substructuring in Structural Mechanics}, 9451 journal = {Archives of Computational Methods in Engineering}, 9452 volume = {16}, 9453 number = {4}, 9454 pages = {425-463}, 9455 year = {2009}, 9456 issn = {1134-3060}, 9457 doi = {10.1007/s11831-009-9035-4}, 9458 publisher = {Springer Netherlands}, 9459 language = {English}, 9460 petsc_uses = {KSP} 9461} 9462 9463@Article{ knepleyterrel2013, 9464 author = {Matthew G. Knepley and Andy R. Terrel}, 9465 title = {Finite Element Integration on {GPUs}}, 9466 journal = {{ACM} Transactions on Mathematical Software}, 9467 volume = {39}, 9468 number = {2}, 9469 accepted = {17 April 2012}, 9470 year = {2013}, 9471 abstract = {We present a novel finite element integration method for low order elements on 9472 GPUs. We achieve more than 100GF for element integration on first order 9473 discretizations of both the Laplacian and Elasticity operators on an NVIDIA 9474 GTX285, which has a nominal single precision peak flop rate of 1 TF/s and 9475 bandwidth of 159 GB/s, corresponding to a bandwidth limited peak of 40 GF/s.}, 9476 url = {http://arxiv.org/abs/1103.0066}, 9477 note = {no. 10, \url{http://arxiv.org/abs/1103.0066}}, 9478 petsc_uses = {KSP} 9479} 9480 9481@Article{ knepleyruppterrel2016, 9482 title = {Finite Element Integration with Quadrature on the GPU}, 9483 journal = {ArXiv e-prints}, 9484 author = {Matthew G. Knepley and Karl Rupp and Andy R. Terrel}, 9485 version = {1}, 9486 date = {2016-07-14}, 9487 eprinttype = {arxiv}, 9488 eprintclass = {cs.MS}, 9489 eprint = {1607.04245v1}, 9490 petsc_uses = {KSP} 9491} 9492 9493@Article{ klawonnlanserrheinbach2014, 9494 title = {Nonlinear {FETI-DP} and {BDDC} Methods}, 9495 author = {Axel Klawonn and Martin Lanser and Oliver Rheinbach}, 9496 journal = {SIAM Journal on Scientific Computing}, 9497 volume = {36}, 9498 number = {2}, 9499 pages = {A737--A765}, 9500 year = {2014}, 9501 petsc_uses = {KSP} 9502} 9503 9504@Article{ bruneknepleysmithtu15, 9505 title = {Composing Scalable Nonlinear Algebraic Solvers}, 9506 author = {Peter R. Brune and Matthew G. Knepley and Barry F. Smith and Xuemin Tu}, 9507 journal = {SIAM Review}, 9508 volume = {57}, 9509 number = {4}, 9510 pages = {535--565}, 9511 note = {\url{http://www.mcs.anl.gov/papers/P2010-0112.pdf}}, 9512 url = {http://www.mcs.anl.gov/papers/P2010-0112.pdf}, 9513 doi = {10.1137/130936725}, 9514 year = {2015}, 9515 petsc_uses = {KSP} 9516} 9517 9518@Article{ mszm2014, 9519 title = {Hierarchical {Krylov} and nested {Krylov} methods for extreme-scale computing}, 9520 author = {Lois Curfman McInnes and Barry Smith and Hong Zhang and Richard Tran Mills}, 9521 volume = {40}, 9522 pages = {17--31}, 9523 year = {2014}, 9524 journal = {Parallel Computing}, 9525 doi = {10.1016/j.parco.2013.10.001}, 9526 petsc_uses = {KSP} 9527} 9528 9529@TechReport{ mszm2012, 9530 title = {Hierarchical {Krylov} and Nested {Krylov} Methods for Extreme-Scale Computing}, 9531 author = {Lois Curfman McInnes and Barry Smith and Hong Zhang and Richard Tran Mills}, 9532 year = {2012}, 9533 number = {ANL/MCS-P2097-0512}, 9534 institution = {Argonne National Laboratory}, 9535 petsc_uses = {KSP} 9536} 9537 9538@InProceedings{ bkmms2012, 9539 author = {Jed Brown and Matthew G. Knepley and David A. May and Lois C. McInnes and Barry 9540 F. Smith}, 9541 title = {Composable linear solvers for multiphysics}, 9542 booktitle = {Proceeedings of the 11th {International Symposium on Parallel and Distributed 9543 Computing} ({ISPDC} 2012)}, 9544 year = {2012}, 9545 doi = {10.1109/ISPDC.2012.16}, 9546 publisher = {IEEE Computer Society}, 9547 pages = {55--62}, 9548 petsc_uses = {KSP} 9549} 9550 9551@Article{ bourdinbucuroudet2009, 9552 author = {Blaise Bourdin and D. Bucur and E. Oudet}, 9553 title = {Optimal Partitions for Eigenvalues}, 9554 journal = {SIAM J. Sci. Comput.}, 9555 volume = {31}, 9556 number = {6}, 9557 pages = {4100--4114}, 9558 year = {2009}, 9559 petsc_uses = {KSP} 9560} 9561 9562@InBook{ kimnbourdin2007, 9563 author = {J.-H. Kimn and Blaise Bourdin}, 9564 title = {Numerical implementation of overlapping balancing domain decomposition methods on 9565 unstructured meshes}, 9566 editor = {O. B. Widlund and D. E. Keyes}, 9567 booktitle = {Domain Decomposition Methods in Science and Engineering XVI}, 9568 series = {Lecture Notes in Computational Science and Engineering}, 9569 number = {55}, 9570 publisher = {Springer-Verlag}, 9571 pages = {309--315}, 9572 url = {http://www.cims.nyu.edu/dd16/proceedings/kimn_bourdin_mini_6.pdf}, 9573 year = {2007}, 9574 petsc_uses = {KSP} 9575} 9576 9577@Article{ bjm2005, 9578 author = {AH Baker and ER Jessup and T Manteuffel}, 9579 title = {A Technique for Accelerating the Convergence of Restarted GMRES}, 9580 journal = {SIAM JOURNAL ON MATRIX ANALYSIS AND APPLICATIONS}, 9581 year = {2005}, 9582 petsc_uses = {KSP} 9583} 9584 9585@Unpublished{ sundar-2008a, 9586 author = {R.S. Sampath and G. Biros}, 9587 title = {A parallel geometric multigrid method for finite elements on octree meshes}, 9588 url = {http://www.seas.upenn.edu/\~{ }rahulss}, 9589 petsc_uses = {KSP} 9590} 9591 9592@Article{ sundar-2008, 9593 author = {H. Sundar and R.S. Sampath and G. Biros}, 9594 title = {Bottom-up construction and 2:1 balance refinement of linear octrees in parallel}, 9595 journal = {SIAM Journal on Scientific Computing}, 9596 year = {2008}, 9597 url = {http://www.seas.upenn.edu/\~{ }rahulss}, 9598 petsc_uses = {KSP} 9599} 9600 9601@InProceedings{ sundar-2007, 9602 author = {H. Sundar and R.S. Sampath and S.S. Adavani and C. Davatzikos and G. Biros}, 9603 title = {Low-constant parallel algorithms for finite element simulations using linear 9604 octrees}, 9605 booktitle = {SC'07: ACM/IEEE Conference on Supercomputing}, 9606 year = {2007}, 9607 url = {http://www.seas.upenn.edu/\~{ }rahulss}, 9608 petsc_uses = {KSP} 9609} 9610 9611@InProceedings{ adams-98a, 9612 author = {Adams, Mark ~F.}, 9613 title = {A Parallel Maximal Independent Set Algorithm}, 9614 booktitle = {Proceedings 5th copper mountain conference on iterative methods}, 9615 year = {1998}, 9616 petsc_uses = {KSP} 9617} 9618 9619@Article{ akcelik2005ddd, 9620 title = {{Dynamic data-driven inversion for terascale simulations: real-time 9621 identification of airborne contaminants}}, 9622 author = {Ak\c{c}elik, V. and Biros, G. and Draganescu, A. and Hill, J. and Ghattas, O. and 9623 van Bloemen Waanders, B.}, 9624 journal = {Proceedings of the 2005 ACM/IEEE conference on Supercomputing}, 9625 year = {2005}, 9626 publisher = {IEEE Computer Society Washington, DC, USA}, 9627 petsc_uses = {KSP} 9628} 9629 9630@InBook{ akcelik-2006, 9631 author = {V. Akcelik and G. Biros and Omar Ghattas and J. Hill and David Keyes and B. van 9632 Bloemen Waanders}, 9633 bookeditor = {M. Heroux and P. Raghaven and H. Simon}, 9634 title = {Frontiers of Parallel Computing}, 9635 chapter = {Parallel algorithms for {PDE}-constrained optimization}, 9636 publisher = {SIAM}, 9637 year = {2006}, 9638 petsc_uses = {KSP} 9639} 9640 9641@Article{ dt, 9642 author = {Matthew F. Dixon and C. J. Kenneth Tan}, 9643 title = {Using Distributed Computers to Deterministically Approximate Higher Dimensional 9644 Convection Diffusion Equations}, 9645 journal = {The Journal of Supercomputing}, 9646 year = {2004}, 9647 pages = {235--253}, 9648 volume = {28}, 9649 url = {http://www.springerlink.com/(nekina45nmdgrib5izizn3ip)/app/home/contribution.asp?referrer=parent&backto=issue,8,8;journal,20,73;linkingpublicationresults,1:100302,1}, 9650 petsc_uses = {KSP} 9651} 9652 9653@PhDThesis{ hwang2004, 9654 author = {Feng-Nan Hwang}, 9655 title = {Some Parallel Linear and Nonlinear {Schwarz} Methods with Applications in 9656 Computational Fluid Dynamics}, 9657 school = {University of Colorado at Boulder}, 9658 year = {2004}, 9659 petsc_uses = {KSP} 9660} 9661 9662@PhDThesis{ baker, 9663 author = {{A. H.} Baker}, 9664 title = {On improving the performance of the linear solver restarted {GMRES}}, 9665 school = {University of Colorado at Boulder}, 9666 year = {2003}, 9667 petsc_uses = {KSP} 9668} 9669 9670@TechReport{ klawonnrheinbach601, 9671 author = {Axel Klawonn and Oliver Rheinbach}, 9672 title = {A Parallel Implementation of Dual-Primal {FETI-DP} Methods for Three Dimensional 9673 Linear Elasticity Using a Transformation of Basis}, 9674 institution = {Universit\"at Duisburg-Essen}, 9675 year = {2005}, 9676 type = {Technical Report}, 9677 number = {SM-E-601}, 9678 petsc_uses = {KSP} 9679} 9680 9681@TechReport{ klawonnrheinbach609, 9682 author = {Axel Klawonn and Oliver Rheinbach}, 9683 title = {Inexact FETI-DP Methods}, 9684 institution = {Universit\"at Duisburg-Essen}, 9685 year = {2005}, 9686 type = {Technical Report}, 9687 number = {SM-E-609}, 9688 petsc_uses = {KSP} 9689} 9690 9691@TechReport{ klawonnrheinbach607, 9692 author = {Axel Klawonn and Oliver Rheinbach}, 9693 title = {Robust FETI-DP Methods for Heterogeneous Three Dimensional Elasticity Problems}, 9694 institution = {Universit\"at Duisburg-Essen}, 9695 year = {2005}, 9696 type = {Technical Report}, 9697 number = {SM-E-607}, 9698 petsc_uses = {KSP} 9699} 9700 9701@Article{ kul-natraj-pbp, 9702 author = {Kshitij Kulshreshtha and Neela Nataraj and Michael Jung}, 9703 title = {Performance of a parallel mixed finite element implementation for fourth order 9704 clamped anisotropic plate bending problems in distributed memory environments}, 9705 journal = {Applied Mathematics and Computation}, 9706 volume = {155}, 9707 year = {2004}, 9708 number = {3}, 9709 pages = {753--777}, 9710 petsc_uses = {KSP} 9711} 9712 9713@Article{ bramkamp2006uej, 9714 author = {F. D. Bramkamp and H. M. B{\"u}cker and A. Rasch}, 9715 title = {Using Exact {J}acobians in an Implicit {N}ewton-{K}rylov Method}, 9716 journal = {Computers \& Fluids}, 9717 volume = {35}, 9718 number = {10}, 9719 pages = {1063--1073}, 9720 doi = {10.1016/j.compfluid.2005.10.003}, 9721 abstract = {In an implicit Newton-Krylov method for inviscid, compressible fluid flow, the 9722 derivation of the analytic flux Jacobian can become quite complicated depending on 9723 the complexity of the numerical flux calculation. Practically, the derivation of 9724 the exact Jacobian by hand is an unrealistic option because of the enormous 9725 man-hour investment needed. In this work, automatic differentiation is used to 9726 evaluate the exact Jacobian of upwind schemes implemented in the flow solver 9727 QUADFLOW. We compare the use of exact Jacobians and Jacobians numerically 9728 approximated by first-order forward differences. For a two-dimensional airfoil 9729 under three different flight conditions (quasi-incompressible flow, compressible 9730 subsonic flow, and transonic flow), we show that the robustness and performance of 9731 the present finite volume scheme is significantly improved by using exact 9732 Jacobians.}, 9733 year = {2006}, 9734 petsc_uses = {KSP} 9735} 9736 9737@Article{ shahbazi1, 9738 author = {Khosro Shahbazi}, 9739 title = {An explicit expression for the penalty parameter of the interior penalty method}, 9740 journal = {Journal of Computational Physics}, 9741 volume = {205}, 9742 year = {2005}, 9743 pages = {401--407}, 9744 petsc_uses = {KSP} 9745} 9746 9747@TechReport{ kk, 9748 title = {A Parallel Lanczos Algorithm for Eigensystem Calculation}, 9749 author = {Hans-Peter Kersken and Uwe Kuster}, 9750 year = {1999}, 9751 institution = {University of Stuttgart}, 9752 url = {http://elib.uni-stuttgart.de/opus/volltexte/1999/310/pdf/310.pdf}, 9753 number = {310}, 9754 petsc_uses = {KSP} 9755} 9756 9757@Article{ miha-mija, 9758 author = {M. D. Mihajlovi and S. Mijalkovi}, 9759 title = {A component decomposition preconditioning for 3D stress analysis problems}, 9760 journal = {Numerical Linear Algebra with Applications}, 9761 volume = {9}, 9762 year = {2002}, 9763 pages = {567--583}, 9764 url = {http://www3.interscience.wiley.com/cgi-bin/abstract/98516459/ABSTRACT}, 9765 petsc_uses = {KSP} 9766} 9767 9768@Article{ bjm, 9769 author = {M Benzi and W Joubert and G Mateescu}, 9770 journal = {Electronic Transactions on Numerical Analysis}, 9771 year = {1999}, 9772 volume = {8}, 9773 pages = {88--114}, 9774 title = {Numerical experiments with parallel orderings for {ILU} preconditioners}, 9775 url = {http://scholar.google.com/url?sa=U&q=http://emis.bibl.cwi.nl/journals/ETNA/vol.8.1999/pp88-114.dir/pp88-114.ps}, 9776 petsc_uses = {KSP} 9777} 9778 9779@PhDThesis{ hyde, 9780 author = {EMK Hyde}, 9781 title = {Fast, High-Order Methods for Scattering by Inhomogeneous Media}, 9782 school = {Caltech}, 9783 year = {2003}, 9784 url = {http://www.acm.caltech.edu/\~{ }bruno/02hyde_thesis_print.pdf}, 9785 petsc_uses = {KSP} 9786} 9787 9788@Article{ km2003, 9789 author = {A. Keese and H. G. Matthies}, 9790 journal = {Proceedings in Applied Mathematics and Mechanics}, 9791 year = {2003}, 9792 volume = {2}, 9793 pages = {485--486}, 9794 title = {Parallel Solution of Stochastic PDEs}, 9795 url = {http://www3.interscience.wiley.com/cgi-bin/abstract/104087421/ABSTRACT}, 9796 petsc_uses = {KSP} 9797} 9798 9799@Article{ whszss, 9800 author = {Joachim Weickert and Josef Heers and Christoph Schnorr and Karel J. Zuiderveld 9801 and Otmar Scherzer and H. Siegfried Stiehl}, 9802 journal = {Real Time Imaging}, 9803 year = {2001}, 9804 volume = {7}, 9805 pages = {31--45}, 9806 title = {Fast parallel algorithms for a broad class of nonlinear variational diffusion 9807 approaches}, 9808 url = {http://www.mia.uni-saarland.de/weickert/Papers/TR_5_99.ps.gz}, 9809 petsc_uses = {KSP} 9810} 9811 9812@TechReport{ baker1, 9813 title = {An Efficient Block Variant of GMRES}, 9814 author = {A. H. Baker and J. M. Dennis and E. R. Jessup}, 9815 year = {2003}, 9816 type = {Technical Report}, 9817 institution = {University of Colorado, Boulder}, 9818 url = {http://www.scd.ucar.edu/css/staff/dennis/papers/block.pdf}, 9819 number = {CU-CS-957-03}, 9820 petsc_uses = {KSP} 9821} 9822 9823@InProceedings{ mc2003, 9824 author = {Leszek Marcinkowski and Xiao-Chuan Cai}, 9825 title = {Parallel Performance of Some Two-Level {ASPIN} Algorithms}, 9826 booktitle = {Proceedings of the 15th International Conference on Domain Decomposition 9827 Methods}, 9828 pages = {639--646}, 9829 publisher = {Springer, Lecture Notes in Computational Science and Engineering (LNCSE).}, 9830 note = {}, 9831 url = {http://www.ddm.org/DD15/proceedings-dd15.html}, 9832 year = {2003}, 9833 petsc_uses = {KSP} 9834} 9835 9836@InProceedings{ kt2003, 9837 author = {Deepak V. Kulkarni and Daniel A. Tortorelli}, 9838 title = {A Domain Decomposition Based Two-Level Newton Scheme for Nonlinear Problems}, 9839 booktitle = {Proceedings of the 15th International Conference on Domain Decomposition 9840 Methods}, 9841 pages = {615--622}, 9842 publisher = {Springer, Lecture Notes in Computational Science and Engineering (LNCSE).}, 9843 note = {}, 9844 url = {http://www.ddm.org/DD15/proceedings-dd15.html}, 9845 year = {2003}, 9846 petsc_uses = {KSP} 9847} 9848 9849@InProceedings{ krw2003, 9850 author = {Axel Klawonn and Oliver Rheinbach and Olof B. Widlund}, 9851 title = {Some Computational Results for Dual-Primal FETI Methods for Elliptic Problems in 9852 3D}, 9853 booktitle = {Proceedings of the 15th International Conference on Domain Decomposition 9854 Methods}, 9855 pages = {361--368}, 9856 publisher = {Springer, Lecture Notes in Computational Science and Engineering (LNCSE).}, 9857 note = {}, 9858 url = {http://www.ddm.org/DD15/proceedings-dd15.html}, 9859 year = {2003}, 9860 petsc_uses = {KSP} 9861} 9862 9863@InProceedings{ hc2003, 9864 author = {Feng-Nan Hwang and Xiao-Chuan Cai}, 9865 title = {Improving Robustness and Parallel Scalability of {Newton's} Method Through 9866 Nonlinear Preconditioning}, 9867 booktitle = {Proceedings of the 15th International Conference on Domain Decomposition 9868 Methods}, 9869 pages = {201--208}, 9870 publisher = {Springer, Lecture Notes in Computational Science and Engineering (LNCSE).}, 9871 note = {}, 9872 url = {http://www.ddm.org/DD15/proceedings-dd15.html}, 9873 year = {2003}, 9874 petsc_uses = {KSP} 9875} 9876 9877@InProceedings{ g2003, 9878 author = {P. Goldfeld}, 9879 title = {Balancing {Neumann-Neumann} for (In)Compressible Linear Elasticity and 9880 (Generalized) {Stokes} and Parallel Implementation}, 9881 booktitle = {Proceedings of the 14th International Conference on Domain Decomposition 9882 Methods}, 9883 pages = {209--216}, 9884 editor = {I. Herrera and D. Keyes and O. Widlund and R. Yates}, 9885 publisher = {National Autonomous University of Mexico (UNAM)}, 9886 note = {}, 9887 url = {http://www.ddm.org/DD14}, 9888 year = {2003}, 9889 petsc_uses = {KSP} 9890} 9891 9892@InProceedings{ dhv2003, 9893 author = {Zdenek Dostal and David Horak and Oldrich Vlach}, 9894 title = {Toward scalable {FETI} algorithm for variational inequalities with applications to 9895 composites}, 9896 booktitle = {Proceedings of the 14th International Conference on Domain Decomposition 9897 Methods}, 9898 pages = {395--401}, 9899 editor = {I. Herrera and D. Keyes and O. Widlund and R. Yates}, 9900 publisher = {National Autonomous University of Mexico (UNAM)}, 9901 note = {}, 9902 url = {http://www.ddm.org/DD14}, 9903 year = {2003}, 9904 petsc_uses = {KSP} 9905} 9906 9907@InProceedings{ dhsv2002, 9908 author = {Zdenek Dostal and David Horak and Jan Szweda and Vit Vondrak}, 9909 title = {Scalabilities of {FETI} for variational inequalities and contact shape 9910 optimization}, 9911 booktitle = {Proceedings of the 13th International Conference on Domain Decomposition 9912 Methods}, 9913 pages = {359--367}, 9914 editor = {N. Debit and M.Garbey and R. Hoppe and J. Periaux and D. Keyes and Y. Kuznetsov}, 9915 publisher = {CIMNE, Barcelona, Spain}, 9916 note = {}, 9917 url = {http://www.ddm.org/DD13}, 9918 year = {2002}, 9919 petsc_uses = {KSP} 9920} 9921 9922@InProceedings{ cky2002, 9923 author = {Xiao-Chuan Cai and David E. Keyes and David P. Young}, 9924 title = {A Nonlinear Additive {S}chwarz Preconditioned Inexact {N}ewton Method for Shocked 9925 Duct Flows}, 9926 booktitle = {Proceedings of the 13th International Conference on Domain Decomposition 9927 Methods}, 9928 pages = {343--350}, 9929 editor = {N. Debit and M.Garbey and R. Hoppe and J. Periaux and D. Keyes and Y. Kuznetsov}, 9930 publisher = {CIMNE, Barcelona, Spain}, 9931 note = {}, 9932 url = {http://www.ddm.org/DD13}, 9933 year = {2002}, 9934 petsc_uses = {KSP} 9935} 9936 9937@Conference{ li-etal:03, 9938 author = {Li, Z. and Lanteri S. and Saad, Y.}, 9939 title = {Multiplicative-additive preconditioning combination for general sparse linear 9940 systems}, 9941 booktitle = {2003 International Conference on Preconditioning Techniques for Large Sparse 9942 Matrix Problems in Scientific and Industrial Applications}, 9943 address = {Napa, California, USA}, 9944 date = {october 27-29}, 9945 year = {2003}, 9946 petsc_uses = {KSP} 9947} 9948 9949@Article{ bashir2008hessian, 9950 title = {Hessian-based model reduction for large-scale systems with initial-condition 9951 inputs}, 9952 author = {Bashir, O. and Willcox, K. and Ghattas, O. and van Bloemen Waanders, B. and Hill, 9953 J.}, 9954 journal = {International journal for numerical methods in engineering}, 9955 volume = {73}, 9956 number = {6}, 9957 pages = {844--868}, 9958 year = {2008}, 9959 publisher = {Wiley Online Library}, 9960 petsc_uses = {KSP} 9961} 9962 9963@Article{ bashir2007hessian, 9964 title = {Hessian-Based Model Reduction for Large-Scale Data Assimilation Problems}, 9965 author = {Bashir, O. and Ghattas, O. and Hill, J. and van Bloemen Waanders, B. and Willcox, 9966 K.}, 9967 journal = {Computational Science--ICCS 2007}, 9968 pages = {1010--1017}, 9969 year = {2007}, 9970 publisher = {Springer}, 9971 petsc_uses = {KSP} 9972} 9973 9974@Article{ akcelik2011fast, 9975 title = {Fast algorithms for {B}ayesian uncertainty quantification in large-scale linear 9976 inverse problems based on low-rank partial {H}essian approximations}, 9977 author = {Ak\c{c}elik, V. and Flath, H.P. and Ghattas, O. and Hill, J. and van Bloemen 9978 Waanders, B. and Wilcox, L.}, 9979 journal = {SIAM Journal on Scientific Computing}, 9980 volume = {33}, 9981 number = {1}, 9982 year = {2011}, 9983 petsc_uses = {KSP} 9984} 9985 9986@InProceedings{ ff2003, 9987 author = {Abul K. M. Fahimuddin and Heike Fassbender}, 9988 title = {Model Reduction for Large Scale Applications in Microsystem Technology}, 9989 booktitle = {Proceedings of the 2004 SIAM Parallel Processing Conference}, 9990 year = {2003}, 9991 petsc_uses = {KSP} 9992} 9993 9994@InProceedings{ d2b2004, 9995 author = {Masoud Darbandi and Gerry E. Schneider and Seyed Mehi Bostandoost}, 9996 title = {Parallel Computation of a Fully Implicit Finite Volume Method Using Different 9997 Ordering Strategies}, 9998 booktitle = {Proceedings of AIAA Conference, Reno, Nevada}, 9999 year = {2004}, 10000 petsc_uses = {KSP} 10001} 10002 10003@InProceedings{ d2v2005, 10004 author = {Masoud Darbandi and Gerry E. Schneider and Soheyl Vakili}, 10005 title = {A Comparative Study of Preconditioned Methods for Solving Fully Coupled Fluid 10006 Flow Equations}, 10007 booktitle = {The 13th Annual Conference on Computational Fluid Dynamics}, 10008 year = {2005}, 10009 petsc_uses = {KSP} 10010} 10011 10012@InProceedings{ dvs2006, 10013 author = {Masoud Darbandi and Soheyl Vakili and Gerry E. Schneider}, 10014 title = {The Employment of Algebraic Multigrid as a Preconditioner to Solve Fully Implicit 10015 Mixed Convection Equations}, 10016 booktitle = { The 44th AIAA Aerospace Sciences Meeting and Exhibit}, 10017 year = {2006}, 10018 petsc_uses = {KSP} 10019} 10020 10021@Article{ dsv2006, 10022 author = {Masoud Darbandi and Gerry E. Schneider and Soheyl Vakili}, 10023 title = {Using Different Preconditioned Krylov Subspace Methods to Solve Coupled Fluid 10024 Flow Equations}, 10025 journal = {Computational Fluid Dynamics}, 10026 year = {2006}, 10027 volume = {15}, 10028 number = {1}, 10029 petsc_uses = {KSP} 10030} 10031 10032@Article{ lahaye03, 10033 author = {Lahaye, D. and Vandewalle, S. and Hameyer, K.}, 10034 title = {An Algebraic Multilevel Preconditioner for Field-Circuit Coupled Problems}, 10035 journal = {J. Comput. Appl. Math.}, 10036 year = {2004}, 10037 pages = {267--275}, 10038 volume = {168}, 10039 petsc_uses = {KSP} 10040} 10041 10042@TechReport{ brmn, 10043 title = {Faster {PDE}-based Simulations Using Robust Composite Linear Solvers}, 10044 author = {S. Bhowmick and P. Raghavan and L. McInnes and B. Norris}, 10045 year = {2002}, 10046 type = {Technical Report}, 10047 institution = {ANL}, 10048 number = {ANL/MCS-P993-0902}, 10049 note = {To appear in Future Generation Computer Systems}, 10050 petsc_uses = {KSP} 10051} 10052 10053@InProceedings{ mnbr, 10054 author = {L. McInnes and B. Norris and S. Bhowmick and P. Raghavan}, 10055 title = {Adaptive Sparse Linear Solvers for Implicit {CFD} Using {Newton-Krylov} 10056 Algorithms}, 10057 booktitle = {Proceedings of the Second MIT Conference on Computational Fluid and Solid 10058 Mechanics}, 10059 year = {2003}, 10060 petsc_uses = {KSP} 10061} 10062 10063@InProceedings{ bmnr, 10064 author = {S. Bhowmick and L. McInnes and B. Norris and P. Raghavan}, 10065 title = {The Role of Multi-Method Linear Solvers in {PDE}-based Simulations}, 10066 booktitle = {Proceedings of the 2003 International Conference on Computational Science and its 10067 Applications, Lecture notes in Computer Science 2677}, 10068 editor = {V. Kumar and M. L. Gavrilova and C. J. K. Tan and P. L'Ecuyer}, 10069 pages = {828--839}, 10070 year = {2003}, 10071 petsc_uses = {KSP} 10072} 10073 10074@Article{ ph03, 10075 author = {M. Pernice and R. D. Hornung}, 10076 title = {Newton-Krylov-FAC Methods for Problems Discretized on Locally Refined Grids}, 10077 journal = {Computing and Visualization in Science}, 10078 year = {2003}, 10079 lab = {LANL}, 10080 petsc_uses = {KSP} 10081} 10082 10083@Article{ adams-02, 10084 author = {Adams, M.~F. and Brezina, M. and Hu, J. J. and Tuminaro, R. S}, 10085 journal = {J. Comp. Phys.}, 10086 number = {2}, 10087 pages = {593-610}, 10088 title = {Parallel multigrid smoothing: polynomial versus {G}auss--{S}eidel}, 10089 volume = {188}, 10090 year = {2003}, 10091 petsc_uses = {KSP} 10092} 10093 10094@InProceedings{ adams2001distributed, 10095 title = {A distributed memory unstructured {G}auss-{S}eidel algorithm for multigrid 10096 smoothers}, 10097 author = {Adams, M.F.}, 10098 booktitle = {Supercomputing, ACM/IEEE 2001 Conference}, 10099 pages = {14--14}, 10100 year = {2001}, 10101 organization = {IEEE}, 10102 petsc_uses = {KSP} 10103} 10104 10105@PhDThesis{ els01, 10106 author = {Ulrich Elsner}, 10107 title = {Static and Dynamic Graph Partitioning. A comparative study of existing 10108 algorithms}, 10109 school = {Technical University Chemnitz}, 10110 year = {2002}, 10111 publisher = {Logos Verlag, Berlin}, 10112 isbn = {3-89722-923-4}, 10113 annote = {Uses PETSc's high quality parallel algorithms to provide a framework to compare 10114 different graph partitioning algorithms}, 10115 petsc_uses = {KSP} 10116} 10117 10118@TechReport{ ckk02, 10119 title = {Pseudo-Transient Continuation and Differential-Algebraic Equations}, 10120 author = {Todd S. Coffey and C. T. Kelley and David E. Keyes}, 10121 year = {2002}, 10122 type = {Technical Report}, 10123 institution = {ODU}, 10124 url = {http://www.math.odu.edu/\~{ }keyes}, 10125 note = {Submitted to the special issue of the SIAM Journal of Scientific Computing 10126 dedicated to papers from the 2002 Copper Mountain Conference on Iterative 10127 Methods}, 10128 petsc_uses = {KSP} 10129} 10130 10131@Article{ gpw2002, 10132 title = {Balancing Neumann-Neumann Preconditioners for Mixed Approximations of 10133 Heterogeneous Problems in Linear Elasticity}, 10134 author = {Paulo Goldfeld and Luca F. Pavarino and Olof B. Widlund}, 10135 year = {2003}, 10136 pages = {283--324}, 10137 volume = {95}, 10138 url = {http://www.cs.nyu.edu/csweb/Research/TechReports/TR2002-825/TR2002-825.pdf}, 10139 journal = {Numerische Mathematik}, 10140 petsc_uses = {KSP} 10141} 10142 10143@Article{ dh1, 10144 title = {Scalability and FETI based algorithm for large discretized variational 10145 inequalities}, 10146 author = {Z Dostal and D Horak}, 10147 year = {2003}, 10148 pages = {347--357}, 10149 volume = {61}, 10150 url = {http://portal.acm.org/citation.cfm?id=770222.770239}, 10151 journal = {Mathematics and Computers in Simulation}, 10152 petsc_uses = {KSP} 10153} 10154 10155@InProceedings{ dhsv1, 10156 author = {Zdenek Dostal and David Horak and Jan Szweda and Vit Vondrak}, 10157 url = {http://cdcsp.univ-lyon1.fr/\~{ }dd13/DD13proc/Dostal.pdf}, 10158 title = {36 Scalabilities of {FETI} for Variational Inequalities and Contact Shape 10159 Optimization}, 10160 booktitle = {Proceedings of the 13th International Conference on Domain Decomposition 10161 Methods}, 10162 editor = { N. Debit and M. Garbey and R. Hoppe and J. Periaus and D. Keyes and Y. 10163 Kuznetsov}, 10164 petsc_uses = {KSP} 10165} 10166 10167@Article{ lahaye02, 10168 author = {Domenico Lahaye and S. Vandewalle and K. Hameyer}, 10169 title = {An Algebraic Multilevel Preconditioner for Field-Circuit Coupled Problems}, 10170 journal = {IEEEMAGN}, 10171 year = {2002}, 10172 volume = {38}, 10173 number = {2}, 10174 pages = {413-416}, 10175 petsc_uses = {KSP} 10176} 10177 10178@Article{ ckm01, 10179 author = {X.-C. Cai and D. E. Keyes and L. Marcinkowski}, 10180 url = {http://www.cs.colorado.edu/homes/cai/public_html/papers/10page.ps}, 10181 title = {Nonlinear additive {Schwarz} preconditioners and applications in computational 10182 fluid dynamics}, 10183 journal = {International Journal of Numerical Methods in Fluid Mechanics}, 10184 year = {2002}, 10185 volume = {40}, 10186 pages = {1463--1470}, 10187 petsc_uses = {KSP} 10188} 10189 10190@InProceedings{ cky01, 10191 author = {X.-C. Cai and D. E. Keyes and D. P. Young}, 10192 url = {http://www.cs.colorado.edu/homes/cai/public_html/papers/dd13_1d.ps}, 10193 title = {A nonlinear additive {Schwarz} preconditioned inexact {Newton} method for shocked 10194 duct flow}, 10195 booktitle = {Proceedings of the 13th International Conference on Domain Decomposition 10196 Methods}, 10197 editor = { N. Debit and M. Garbey and R. Hoppe and J. Periaus and D. Keyes and Y. 10198 Kuznetsov}, 10199 year = {2002}, 10200 petsc_uses = {KSP} 10201} 10202 10203@Article{ ck02, 10204 author = {X.-C. Cai and D. E. Keyes}, 10205 url = {http://www.cs.colorado.edu/homes/cai/public_html/papers/aspin.ps}, 10206 title = {Nonlinearly preconditioned inexact {Newton} algorithms}, 10207 journal = {SIAM J. Sci. Comput.}, 10208 year = {2002}, 10209 pages = {183--200}, 10210 volume = {24}, 10211 petsc_uses = {KSP} 10212} 10213 10214@Article{ c04, 10215 author = {Feng-Nan Hwang and X.-C. Cai}, 10216 url = {http://amath.colorado.edu/student/hwangf/papers/one-level-aspin.pdf}, 10217 title = {A parallel nonlinear additive {Schwarz} preconditioned inexact {Newton} algorithm 10218 for incompressible {Navier-Stokes} equations}, 10219 journal = {Journal of Computational Physics}, 10220 year = {2005}, 10221 volume = {204}, 10222 pages = {666--691}, 10223 petsc_uses = {KSP} 10224} 10225 10226@Article{ hc06, 10227 author = {Feng-Nan Hwang and X.-C. Cai}, 10228 url = {http://www.cs.colorado.edu/\~{ }cai/papers/aspin2_06.pdf}, 10229 title = {A Class of Parallel Two-Level Nonlinear {Schwarz} Preconditioned Inexact {Newton} 10230 Algorithms}, 10231 journal = {Computer Methods in Applied Mechanics and Engineering}, 10232 year = {2006}, 10233 volume = {196}, 10234 pages = {1603--1611}, 10235 petsc_uses = {KSP} 10236} 10237 10238@InProceedings{ adams-01, 10239 author = {Mark F. Adams}, 10240 title = {A Distributed Memory Unstructured {G}auss-{S}eidel Algorithm for Multigrid 10241 Smoothers}, 10242 booktitle = {ACM/IEEE Proceedings of SC2001: High Performance Networking and Computing}, 10243 address = {Denver, Colorado}, 10244 month = nov, 10245 year = {2001}, 10246 petsc_uses = {KSP} 10247} 10248 10249@Book{ 1dl, 10250 author = {Domenico Lahaye}, 10251 title = {Algebraic Multigrid for Two Dimensional Time-Harmonic Magnetic Field 10252 Computations}, 10253 year = {2001}, 10254 publisher = {Katholieke Universiteit Leuven}, 10255 notes = {Thesis}, 10256 petsc_uses = {KSP} 10257} 10258 10259@Article{ adams-00, 10260 author = {Adams, M.~F.}, 10261 journal = {International Journal for Numerical Methods in Engineering}, 10262 number = {8}, 10263 pages = {1241-1262}, 10264 title = {Parallel Multigrid Solvers for 3{D} Unstructured Finite Element Problems in Large 10265 Deformation Elasticity and Plasticity}, 10266 volume = {48}, 10267 year = {2000}, 10268 petsc_uses = {KSP} 10269} 10270 10271@Article{ adams2002evaluation, 10272 author = {Adams, M.~F.}, 10273 journal = {International Journal for Numerical Methods in Engineering}, 10274 number = {1}, 10275 pages = {519-534}, 10276 title = {Evaluation of Three Unstructured Multigrid Methods on 3{D} Finite Element 10277 Problems in Solid Mechanics}, 10278 volume = {55}, 10279 year = {2002}, 10280 petsc_uses = {KSP} 10281} 10282 10283@Article{ lahaye00, 10284 author = {Domenico Lahaye and De Gersem, H. and Vandewalle, S. and Hameyer, K.}, 10285 title = {Algebraic Multigrid for Complex Symmetric Systems}, 10286 journal = {IEEEMAGN}, 10287 year = {2000}, 10288 volume = {36}, 10289 number = {4}, 10290 pages = {1535--1538}, 10291 petsc_uses = {KSP} 10292} 10293 10294@InProceedings{ adams-99c, 10295 author = {Mark F. Adams and J. Demmel}, 10296 title = {Parallel Multigrid Solver Algorithms and Implementations for 3{D} Unstructured 10297 Finite Element Problems}, 10298 booktitle = {Proceedings of SC99: High Performance Networking and Computing}, 10299 address = {Portland, Oregon}, 10300 month = nov, 10301 year = {1999}, 10302 petsc_uses = {KSP} 10303} 10304 10305@Article{ chan95, 10306 author = {T. Chan and B. Smith and J. Zou}, 10307 title = {Overlapping {S}chwarz Methods on Unstructured Meshes using Non-matching Coarse 10308 Grids}, 10309 journal = {Numer. Math.}, 10310 year = {1995}, 10311 volume = {73}, 10312 pages = {149--167}, 10313 petsc_uses = {KSP} 10314} 10315 10316@TechReport{ adams-csd-98-993, 10317 pages = {11}, 10318 year = {1998}, 10319 type = {Technical Report}, 10320 number = {CSD-98-993}, 10321 institution = {University of California, Berkeley}, 10322 title = {A Parallel Maximal Independent Set Algorithm}, 10323 bibdate = {March 11, 1998}, 10324 author = {Mark F. Adams and James Demmel}, 10325 abstract = {The parallel construction of maximal independent sets is a useful building block 10326 for many algorithms in the computational sciences, including graph coloring and 10327 multigrid coarse grid creation on unstructured meshes. We present an efficient 10328 asynchronous maximal independent set algorithm for use on parallel computers, for 10329 ``well partitioned'' graphs, that arise from finite element (FE) models. For 10330 appropriately partitioned bounded degree graphs, it is shown that the running time 10331 of our algorithm under the P-RAM computational model is of $O(1)$, which is an 10332 improvement over the previous best P-RAM complexity for this class of graphs. We 10333 present numerical experiments on an IBM SP, that confirm our P-RAM complexity 10334 model is indicative of the performance one can expect with practical partitions on 10335 graphs from FE problems.}, 10336 month = mar, 10337 petsc_uses = {KSP} 10338} 10339 10340@Article{ benzigolubliesen2005, 10341 title = {Numerical solution of saddle point problems}, 10342 author = {Michele Benzi and Gene H. Golub and J\"org Liesen}, 10343 volume = {14}, 10344 journal = {Acta Numerica}, 10345 pages = {1-–137}, 10346 doi = {10.1017/S0962492904000212}, 10347 year = {2005} 10348} 10349 10350@Article{ mardal2011preconditioning, 10351 title = {Preconditioning discretizations of systems of partial differential equations}, 10352 author = {Kent-Andre Mardal and Ragnar Winther}, 10353 journal = {Numerical Linear Algebra with Applications}, 10354 volume = {18}, 10355 number = {1}, 10356 pages = {1--40}, 10357 year = {2011} 10358} 10359 10360@TechReport{ k676, 10361 year = {1994}, 10362 type = {Technical Report}, 10363 number = {TR1994-676}, 10364 institution = {New York University}, 10365 title = {An Optimal Preconditioner for a Class of Saddle Point Problems with a Penalty 10366 Term}, 10367 author = {Axel Klawonn}, 10368 url = {http://www.cs.nyu.edu/csweb/Research/TechReports/TR1994-676/TR1994-676.pdf}, 10369 petsc_uses = {KSP} 10370} 10371 10372@Book{ ak1, 10373 author = {Axel Klawonn}, 10374 title = {Preconditioners for Indefinite Problems}, 10375 year = {1995}, 10376 publisher = {Westfalishen Wilhelms-Universitat Munster}, 10377 url = {http://www.cs.nyu.edu/csweb/Research/TechReports/TR1996-716/TR1996-716.pdf}, 10378 notes = {Thesis}, 10379 petsc_uses = {KSP} 10380} 10381 10382@TechReport{ knepleykarpeev05, 10383 pages = {41}, 10384 year = {2005}, 10385 type = {Technical Report}, 10386 number = {ANL/MCS-P1295-1005}, 10387 institution = {Argonne National Laboratory}, 10388 title = {Flexible Representation of Computational Meshes}, 10389 author = {Matthew G. Knepley and Dmitry A. Karpeev}, 10390 abstract = {}, 10391 url = {ftp://info.mcs.anl.gov/pub/tech_reports/reports/P1295.pdf}, 10392 note = {\url{ftp://info.mcs.anl.gov/pub/tech_reports/reports/P1295.pdf}}, 10393 month = oct, 10394 petsc_uses = {DMPlex} 10395} 10396 10397@TechReport{ knepleykarpeev07a, 10398 pages = {14}, 10399 year = {2007}, 10400 type = {Technical Report}, 10401 number = {ANL/MCS-P1455-0907}, 10402 institution = {Argonne National Laboratory}, 10403 title = {Mesh Algorithms for {PDE} with {Sieve} {I}: {Mesh} Distribution}, 10404 author = {Matthew G. Knepley and Dmitry A. Karpeev}, 10405 abstract = {}, 10406 url = {ftp://info.mcs.anl.gov/pub/tech_reports/reports/P1455.pdf}, 10407 note = {\url{ftp://info.mcs.anl.gov/pub/tech_reports/reports/P1455.pdf}}, 10408 month = feb, 10409 petsc_uses = {DMPlex} 10410} 10411 10412@Article{ knepleykarpeev09, 10413 author = {Matthew G. Knepley and Dmitry A. Karpeev}, 10414 title = {Mesh Algorithms for {PDE} with {Sieve} {I}: {Mesh} Distribution}, 10415 journal = {Scientific Programming}, 10416 volume = {17}, 10417 number = {3}, 10418 pages = {215--230}, 10419 year = {2009}, 10420 doi = {10.3233/SPR-2009-0249}, 10421 url = {http://arxiv.org/abs/0908.4427}, 10422 note = {\url{http://arxiv.org/abs/0908.4427}}, 10423 petsc_uses = {DMPlex} 10424} 10425 10426@Article{ biezuner2012computing, 10427 author = {Biezuner, Rodney and Brown, Jed and Ercole, Grey and Martins, Eder}, 10428 affiliation = {Departamento de Matem\'atica—ICEx, Universidade Federal de Minas Gerais, Av. 10429 Ant\^onio Carlos 6627, Caixa Postal 702, 30161-970 Belo Horizonte, MG, Brazil}, 10430 title = {Computing the First Eigenpair of the $p$-{L}aplacian via Inverse Iteration of 10431 Sublinear Supersolutions}, 10432 journal = {Journal of Scientific Computing}, 10433 publisher = {Springer Netherlands}, 10434 issn = {0885-7474}, 10435 keyword = {Mathematics and Statistics}, 10436 pages = {180--201}, 10437 volume = {52}, 10438 issue = {1}, 10439 year = {2012}, 10440 doi = {10.1007/s10915-011-9540-0}, 10441 petsc_uses = {KSP} 10442} 10443 10444% LiteralHTML: 10445% LiteralHTML: <a name="books"><H3><center>Books</center></H3> 10446% LiteralHTML: 10447@Book{ knepley2017, 10448 title = {Computational Science I}, 10449 author = {Matthew G. Knepley}, 10450 url = {https://www.cse.buffalo.edu/~knepley/classes/caam519/CSBook.pdf}, 10451 note = {\url{https://www.cse.buffalo.edu/~knepley/classes/caam519/CSBook.pdf}}, 10452 publisher = {PETSc}, 10453 year = {2017}, 10454 petsc_uses = {KSP} 10455} 10456 10457@Article{ verleyeuser, 10458 title = {{User friendly permeability predicting software for technical textiles}}, 10459 author = {Verleye, B. and Morren, G. and Lomov, S.V. and Sol, H. and Verpoest, I. and 10460 Roose, D.}, 10461 journal = {status: published}, 10462 issn = {1560-6074}, 10463 publisher = {Hong Kong Polytechnic University, Hong Kong Institution of Textile and Apparel}, 10464 petsc_uses = {KSP} 10465} 10466 10467@Book{ pacheco, 10468 author = {Peter Pacheco}, 10469 title = {Parallel Programming with MPI}, 10470 year = {1997}, 10471 publisher = {Morgan-Kaufmann}, 10472 note = {Devotes a couple of sections to PETSc}, 10473 petsc_uses = {KSP} 10474} 10475 10476@Book{ 1sbg, 10477 author = {Barry F. Smith and Petter Bj{\o}rstad and William D. Gropp}, 10478 title = {Domain Decomposition: Parallel Multilevel Methods for Elliptic Partial 10479 Differential Equations}, 10480 year = {1996}, 10481 publisher = {Cambridge University Press}, 10482 url = {http://www.mcs.anl.gov/~bsmith/ddbook.html}, 10483 petsc_uses = {KSP} 10484} 10485 10486@Misc{ petsc-fem:homepage, 10487 title = {{PETSc-FEM}: A General Purpose, Parallel, Multi-physics {FEM} Program}, 10488 author = {M. Storti and N. Nigro and R. Paz and L. Dalcin and E. Lopez and L. Battaglia and 10489 G. Rodriguez and G. Filippini}, 10490 howpublished = {\url{http://www.cimec.org.ar/twiki/bin/view/Cimec/PETScFEM}}, 10491 petsc_uses = {KSP} 10492} 10493 10494@Misc{ petsc4py-web-page, 10495 author = {Lisandro Dalcin}, 10496 title = {{PETSc} for {Python} -- {Python} bindings for {PETSc} libraries}, 10497 howpublished = {\url{http://code.google.com/p/petsc4py/}}, 10498 note = {http://code.google.com/p/petsc4py/}, 10499 petsc_uses = {KSP} 10500} 10501 10502@Article{ libmeshpaper06, 10503 author = {B.~S.~Kirk and J.~W.~Peterson and R.~H.~Stogner and G.~F.~Carey}, 10504 title = {{\texttt{libMesh}: A C++ Library for Parallel Adaptive Mesh Refinement/Coarsening 10505 Simulations}}, 10506 journal = {Engineering with Computers}, 10507 volume = {22}, 10508 number = {3--4}, 10509 pages = {237--254}, 10510 year = {2006}, 10511 doi = {10.1007/s00366-006-0049-3}, 10512 petsc_uses = {KSP} 10513} 10514 10515@Misc{ sisiphus:homepage, 10516 title = {{SISIPHUS}: Scalable Ice-Sheet Solvers and Infrastructure for Petascale, 10517 High-Resolution, Unstructured Simulations}, 10518 author = {T. {Tautges et al.}}, 10519 howpublished = {\url{http://trac.mcs.anl.gov/projects/sisiphus/wiki}}, 10520 petsc_uses = {KSP} 10521} 10522 10523@Misc{ pflotran:homepage, 10524 title = {{PFLOTRAN} project}, 10525 author = {Ben Andre and Gautam Bisht and Nathan Collier and Glenn Hammond and Satish Karra 10526 and Jitendra Kumar and Peter Lichtner and Richard Mills}, 10527 howpublished = {\url{http://pflotran.org/}}, 10528 petsc_uses = {KSP} 10529} 10530 10531@Misc{ pism:homepage, 10532 title = {{PISM}: A Parallel Ice Sheet Model}, 10533 author = {E. {Bueler et al.}}, 10534 howpublished = {\url{http://pism-docs.org}}, 10535 petsc_uses = {KSP} 10536} 10537 10538@Misc{ dohp:homepage, 10539 title = {Dohp: Dual order $hp$-finite elements}, 10540 author = {J. Brown}, 10541 howpublished = {\url{http://dohp.org}}, 10542 petsc_uses = {KSP} 10543} 10544 10545@Article{ mccourtrognlienetal12, 10546 title = {Improving parallel scalability for edge plasma transport simulations with neutral 10547 gas species}, 10548 author = {M. McCourt and T. D. Rognlien and L. C. McInnes and H. Zhang}, 10549 journal = {Computational Science and Discovery}, 10550 year = {2012}, 10551 volume = {5}, 10552 number = {014012}, 10553 doi = {10.1088/1749-4699/5/1/014012}, 10554 note = {Focus on 22nd International Conference on Numerical Simulations of Plasmas (ICNSP 10555 2011)}, 10556 petsc_uses = {KSP} 10557} 10558 10559@Misc{ petclaw-github, 10560 title = {Pet{C}law Software}, 10561 author = {Kyle T. Mandli and David I. Ketcheson and Amal Alghamdi and Aron Ahmadia}, 10562 year = {2011}, 10563 howpublished = {\url{https://github.com/pyclaw/pyclaw}}, 10564 petsc_uses = {KSP} 10565} 10566 10567@Misc{ pyclaw-web-page, 10568 author = {Kyle T. Mandli and David I. Ketcheson and others}, 10569 title = {{PyClaw} software}, 10570 howpublished = {\url{http://clawpack.github.io/doc/pyclaw/}}, 10571 url = {http://clawpack.github.io/doc/pyclaw/}, 10572 year = {2012}, 10573 petsc_uses = {KSP} 10574} 10575 10576@Article{ ketcheson2011highorder, 10577 title = {High-order wave propagation algorithms for general hyperbolic systems}, 10578 author = {Ketcheson, David I. and Parsani, Matteo and LeVeque, Randall J.}, 10579 year = {2011}, 10580 note = {submitted}, 10581 petsc_uses = {KSP} 10582} 10583 10584@Article{ biros2005pln1, 10585 title = {{Parallel {Lagrange-Newton-Krylov-Schur} methods for {PDE} constrained 10586 optimization. Part I: The {Krylov-Schur} solver}}, 10587 author = {Biros, G. and Ghattas, O.}, 10588 journal = {SIAM Journal on Scientific Computing}, 10589 volume = {27}, 10590 number = {2}, 10591 pages = {687--713}, 10592 year = {2005}, 10593 publisher = {Society for Industrial and Applied Mathematics Philadelphia, PA, USA}, 10594 petsc_uses = {KSP} 10595} 10596 10597@Article{ biros2005pln2, 10598 title = {Parallel {Lagrange-Newton-Krylov-Schur} methods for {PDE}-constrained 10599 optimization. Part {II}: The {Lagrange Newton} solver, and its application to 10600 optimal control of steady viscous flows}, 10601 author = {Biros, G. and Ghattas, O.}, 10602 journal = {SIAM Journal on Scientific Computing}, 10603 volume = {27}, 10604 number = {2}, 10605 pages = {714--739}, 10606 year = {2005}, 10607 publisher = {Society for Industrial and Applied Mathematics Philadelphia, PA, USA}, 10608 petsc_uses = {KSP} 10609} 10610 10611@Misc{ issm:homepage, 10612 title = {{I}ce {S}heet {S}ystem {M}odel}, 10613 author = {Eric Larour and Mathieu Morlighem and Helene Seroussi}, 10614 year = {2010}, 10615 note = {\href{http://issm.jpl.nasa.gov}{\url{issm.jpl.nasa.gov}}}, 10616 petsc_uses = {KSP} 10617} 10618 10619@Article{ morlighem2010spatial, 10620 title = {Spatial patterns of basal drag inferred using control methods from a 10621 full-{S}tokes and simpler models for {P}ine {I}sland {G}lacier, {W}est 10622 {A}ntarctica}, 10623 author = {Morlighem, M. and Rignot, E. and Seroussi, H. and Larour, E. and Dhia, H.B. and 10624 Aubry, D.}, 10625 journal = {Geophysical Research Letters}, 10626 volume = {37}, 10627 number = {14}, 10628 pages = {L14502}, 10629 year = {2010}, 10630 publisher = {American Geophysical Union}, 10631 petsc_uses = {KSP} 10632} 10633 10634@Article{ jardin2012plasmas, 10635 title = {Multiple timescale calculations of sawteeth and other global macroscopic dynamics 10636 of tokamak plasmas}, 10637 author = {S. C. Jardin and N. Ferraro and J. Breslau and J. Chen}, 10638 journal = {Computational Science \& Discovery}, 10639 volume = {5}, 10640 number = {1}, 10641 url = {http://stacks.iop.org/1749-4699/5/014002}, 10642 year = {2012}, 10643 petsc_uses = {KSP} 10644} 10645 10646@Article{ cmz2016, 10647 title = {Analysis and Practical Use of Flexible {BiCGStab}}, 10648 author = {Jie Chen and Lois Curfman McInnes and Hong Zhang}, 10649 journal = {Journal of Scientific Computing}, 10650 publisher = {Springer}, 10651 pages = {803--825}, 10652 volume = {68}, 10653 issue = {2}, 10654 url = {http://link.springer.com/article/10.1007/s10915-015-0159-4}, 10655 doi = {10.1007/s10915-015-0159-4}, 10656 year = {2016}, 10657 note = {Also preprint ANL/MCS-P3039-0912}, 10658 petsc_uses = {KSP} 10659} 10660 10661@Article{ knepleybrownruppsmith13, 10662 author = {{Knepley}, M.~G. and {Brown}, J. and {Rupp}, K. and {Smith}, B.~F.}, 10663 title = {Achieving High Performance with Unified Residual Evaluation}, 10664 journal = {ArXiv e-prints}, 10665 eprint = {1309.1204}, 10666 archiveprefix = {arXiv}, 10667 primaryclass = {cs.MS}, 10668 keywords = {Computer Science - Mathematical Software, Computer Science - Computational 10669 Engineering, Finance, and Science}, 10670 year = {2013}, 10671 month = sep, 10672 adsurl = {http://adsabs.harvard.edu/abs/2013arXiv1309.1204K}, 10673 adsnote = {Provided by the SAO/NASA Astrophysics Data System}, 10674 petsc_uses = {KSP} 10675} 10676 10677@Book{ fenicsbook, 10678 title = {Automated Solution of Differential Equations by the Finite Element Method: The 10679 FEniCS Book}, 10680 series = {Lecture Notes in Computational Science and Engineering}, 10681 volume = {84}, 10682 editor = {Anders Logg, Kent-Andre Mardal, Garth Wells}, 10683 publisher = {Springer}, 10684 isbn = {978-3-642-23098-1}, 10685 year = {2012}, 10686 petsc_uses = {KSP} 10687} 10688 10689@Article{ demidovahnertruppgottschling12, 10690 author = {{Demidov}, D. and {Ahnert}, K. and {Rupp}, K. and {Gottschling}, P.}, 10691 title = {{Programming CUDA and OpenCL: A Case Study Using Modern C++ Libraries}}, 10692 journal = {ArXiv e-prints}, 10693 archiveprefix = {arXiv}, 10694 eprint = {1212.6326}, 10695 primaryclass = {cs.MS}, 10696 keywords = {Computer Science - Mathematical Software, Computer Science - Distributed, 10697 Parallel, and Cluster Computing, Physics - Computational Physics}, 10698 year = {2012}, 10699 month = dec, 10700 adsurl = {http://adsabs.harvard.edu/abs/2012arXiv1212.6326D}, 10701 adsnote = {Provided by the SAO/NASA Astrophysics Data System}, 10702 petsc_uses = {KSP} 10703} 10704 10705@InProceedings{ viennacl, 10706 author = {Rupp, K. and Rudolf, F. and Weinbub, J.}, 10707 title = {{ViennaCL - A High Level Linear Algebra Library for GPUs and Multi-Core CPUs}}, 10708 booktitle = {Intl.~Workshop on GPUs and Scientific Applications}, 10709 year = {2010}, 10710 pages = {51-56}, 10711 petsc_uses = {KSP} 10712} 10713 10714@Article{ knepleybrownmcinnessmithruppadams2015, 10715 title = {Exascale Computing without Threads}, 10716 author = {Matthew G. Knepley and Jed Brown and Lois Curfman McInnes and Barry Smith and 10717 Karl Rupp and Mark Adams}, 10718 url = {https://figshare.com/articles/Exascale_Computing_without_Threads-Barry_Smith_pdf/5824950}, 10719 note = {Whitepaper for the DOE High Performance Computing Operational Review (HPCOR) on 10720 Scientific Software Architecture for Portability and Performance}, 10721 doi = {10.6084/m9.figshare.5824950.v1}, 10722 year = {2015}, 10723 petsc_uses = {KSP} 10724} 10725 10726@Article{ knepleybrownmcinnessmithruppadams2015b, 10727 title = {Overview of the {PETSc} Library}, 10728 author = {Matthew G. Knepley and Jed Brown and Lois Curfman McInnes and Barry Smith and 10729 Karl Rupp and Mark Adams}, 10730 url = {http://www.orau.gov/hpcor2015/whitepapers/Overview_of_the_PETSc_Library-Lois_McInnes.pdf}, 10731 note = {Whitepaper for the DOE High Performance Computing Operational Review (HPCOR) on 10732 Scientific Software Architecture for Portability and Performance}, 10733 year = {2015}, 10734 petsc_uses = {KSP} 10735} 10736 10737@InCollection{ balaybrownknepleymcinnessmith2015, 10738 author = {Satish Balay and Jed Brown and Matthew G. Knepley and Lois McInnes and Barry 10739 Smith}, 10740 title = {Providing Mixed Language and Legacy Support within a Library}, 10741 editor = {J. Carver}, 10742 booktitle = {Software Engineering for Science}, 10743 publisher = {Taylor \& Francis}, 10744 year = {2015}, 10745 petsc_uses = {KSP} 10746} 10747 10748@Article{ ruppbalaybrownknepleymcinnessmith2015, 10749 title = {On The Evolution Of User Support Topics in Computational Science and Engineering 10750 Software}, 10751 author = {Karl Rupp and Satish Balay and Jed Brown and Matthew G. Knepley and Lois Curfman 10752 McInnes and Barry F. Smith}, 10753 note = {Whitepaper for Computational Science \& Engineering Software Sustainability and 10754 Productivity Challenges}, 10755 journal = {ArXiv e-prints}, 10756 archiveprefix = {arXiv}, 10757 eprint = {1510.01122}, 10758 year = {2015}, 10759 petsc_uses = {KSP} 10760} 10761 10762@InProceedings{ knepley2013accurately, 10763 title = {Accurately Citing Software and Algorithms Used in Publications}, 10764 author = {Knepley, Matthew G. and Brown, Jed and McInnes, Lois Curfman and Smith, Barry 10765 F.}, 10766 year = {2013}, 10767 booktitle = {First Workshop on Sustainable Software for Science: Practice and Experiences 10768 (WSSSPE), held at SC13}, 10769 doi = {10.6084/m9.figshare.785731}, 10770 petsc_uses = {KSP} 10771} 10772 10773@InProceedings{ milleretal2013, 10774 title = {Package Management Practice Essential for Interoperability: Lessons Learned and 10775 Strategies Developed for {FASTMath}}, 10776 author = {Mark C. Miller and Lori Diachin and Satish Balay and Lois Curfman McInnes and 10777 Barry Smith}, 10778 year = {2013}, 10779 booktitle = {First Workshop on Sustainable Software for Science: Practice and Experiences 10780 (WSSSPE), held at SC13}, 10781 doi = {10.6084/m9.figshare.789055}, 10782 petsc_uses = {KSP} 10783} 10784 10785@TechReport{ dudsonetal2012, 10786 title = {Improved Nonlinear Solvers in {BOUT++}}, 10787 author = {Ben Dudson and Sean Farley and Lois Curfman McInnes}, 10788 institution = {Argonne National Laboratory}, 10789 number = {ANL/MCS-P3025-0812}, 10790 year = {2012}, 10791 petsc_uses = {KSP} 10792} 10793 10794@Misc{ brown13, 10795 author = {J. Brown}, 10796 title = {Scalable Repository Workflows}, 10797 note = {whitepaper submitted to DOE Workshop on Software Productivity for Extreme-Scale 10798 Science, available via \url{http://www.orau.gov/swproductivity2014/papers.htm}}, 10799 year = {2013}, 10800 petsc_uses = {KSP} 10801} 10802 10803@Misc{ starforest11, 10804 title = {Star forests as a parallel communication model}, 10805 author = {Jed Brown}, 10806 url = {https://jedbrown.org/files/StarForest.pdf}, 10807 year = {2011}, 10808 petsc_uses = {KSP} 10809} 10810 10811@Misc{ brownknepleysmith13, 10812 author = {J. Brown and M. Knepley and B. Smith}, 10813 title = {Run-time Extensibility: Anything Less is Unsustainable}, 10814 note = {whitepaper submitted to DOE Workshop on Software Productivity for Extreme-Scale 10815 Science, available via \url{http://www.orau.gov/swproductivity2014/papers.htm}}, 10816 year = {2013}, 10817 petsc_uses = {KSP} 10818} 10819 10820@Article{ jzhaoyliwkliu15, 10821 author = {J. Zhao and Y. Li and W.K. Liu}, 10822 title = {Predicting band structure of 3{D} mechanical metamaterials with complex geometry 10823 via {XFEM}}, 10824 journal = {Computational Mechanics}, 10825 year = {2015}, 10826 url = {http://link.springer.com/article/10.1007/s00466-015-1129-2}, 10827 petsc_uses = {KSP} 10828} 10829 10830@Article{ alisic14, 10831 author = {L. Alisic and J.F. Rudge and R.F. Katz and G. Wells and S. Rhebergen}, 10832 title = {Compaction around a rigid, circular inclusion in partially molten rock}, 10833 journal = {J. Geophys. Res.}, 10834 year = {2014}, 10835 volume = {119}, 10836 number = {7}, 10837 pages = {5903-5920}, 10838 doi = {10.1002/2013JB010906}, 10839 petsc_uses = {KSP} 10840} 10841 10842@Article{ rhebergen14, 10843 author = {S. Rhebergen and G. Wells and R.F. Katz and A. Wathen}, 10844 title = {Analysis of block preconditioners for models of coupled magma mantle dynamics}, 10845 journal = {SIAM J. Sci. Comp.}, 10846 year = {2014}, 10847 volume = {36}, 10848 number = {4}, 10849 pages = {1960-1977}, 10850 doi = {10.1137/130946678}, 10851 petsc_uses = {KSP} 10852} 10853 10854@Article{ allwright14, 10855 author = {J. Allwright and R.F. Katz}, 10856 title = {Pipe Poiseuille flow of viscously anisotropic, partially molten rock}, 10857 journal = {Geophys. J. Int.}, 10858 year = {2014}, 10859 volume = {199}, 10860 number = {3}, 10861 pages = {1608--1624}, 10862 doi = {10.1093/gji/ggu345}, 10863 petsc_uses = {KSP} 10864} 10865 10866@Misc{ gropp10, 10867 author = {William D. Gropp}, 10868 title = {Update on libraries for {B}lue {W}aters}, 10869 address = {Bordeaux, France}, 10870 year = {2010}, 10871 url = {http://jointlab.ncsa.illinois.edu/events/workshop3/pdf/presentations/Gropp-Update-on-Libraries.pdf}, 10872 petsc_uses = {KSP} 10873} 10874 10875@InProceedings{ mayknepley2017, 10876 title = {{DMSwarm}: Particles in {PETSc}}, 10877 author = {Dave A May and Matthew G Knepley}, 10878 booktitle = {EGU General Assembly Conference Abstracts}, 10879 volume = {19}, 10880 pages = {10133}, 10881 year = {2017}, 10882 petsc_uses = {KSP} 10883} 10884 10885@InProceedings{ adamsbrownknepley2013, 10886 author = {Mark F. Adams and Jed Brown and Matthew G. Knepley}, 10887 title = {Low-communication techniques for extreme-scale multilevel solvers}, 10888 booktitle = {Exascale Mathematics Workshop, Aug 21--22, Washington, DC}, 10889 organization = {DOE Office of Advanced Scientific Computing Research}, 10890 year = {2013}, 10891 petsc_uses = {KSP} 10892} 10893 10894@Article{ bhallagriffithknepleyadamsguy2017, 10895 title = {Scalable smoothing strategies for a geometric multigrid method for the immersed 10896 boundary equations}, 10897 author = {Amneet Pal Singh Bhalla and Boyce E. Griffith and Matthew G. Knepley and Mark F. 10898 Adams and Robert D. Guy}, 10899 journal = {arXiv e-prints}, 10900 eprint = {1612.02208}, 10901 year = {2017}, 10902 note = {\url{http://arxiv.org/abs/1612.02208}}, 10903 petsc_uses = {KSP} 10904} 10905 10906@Article{ zampini2016pcbddc, 10907 title = {{PCBDDC}: a class of robust dual-primal methods in {PETSc}}, 10908 author = {Zampini, Stefano}, 10909 journal = {SIAM Journal on Scientific Computing}, 10910 volume = {38}, 10911 number = {5}, 10912 pages = {S282--S306}, 10913 year = {2016}, 10914 publisher = {SIAM}, 10915 petsc_uses = {KSP} 10916} 10917 10918@Article{ jolivetromanzampini2020, 10919 title = {{KSPHPDDM} and {PCHPDDM}: extending {PETSc} with advanced {Krylov} methods and 10920 robust multilevel overlapping {Schwarz} preconditioners}, 10921 author = {Pierre Jolivet and Jose Roman and Stefano Zampini}, 10922 journal = {Computers and Mathematics with Applications}, 10923 volume = {84}, 10924 pages = {277--295}, 10925 year = {2020} 10926} 10927 10928@Article{ zampinitu2017, 10929 title = {Multilevel {BDDC} deluxe algorithms with adaptive coarse spaces for flow in 10930 porous media}, 10931 author = {Stefano Zampini and Xuemin Tu}, 10932 journal = {SIAM Journal of Scientific Computing}, 10933 volume = {39}, 10934 number = {4}, 10935 pages = {A1389--A1415}, 10936 year = {2017} 10937} 10938 10939@Article{ ohwidlundzampinidohrmann2017, 10940 title = {{BDDC} algorithms with deluxe scaling and adaptive selection of primal 10941 constraints for {Raviart-Thomas} vector fields}, 10942 author = {D.-S. Oh and Olof B. Widlund and Stefano Zampini and Clark Dohrmann}, 10943 journal = {Mathematics of Computation}, 10944 volume = {87}, 10945 number = {310}, 10946 pages = {659--692}, 10947 year = {2017} 10948} 10949 10950@Article{ veigapavarinoscacchiwidlundzampini2016, 10951 title = {Adaptive selection of primal constraints for isogeometric {BDDC} deluxe 10952 preconditioners}, 10953 author = {L. Beirao Da Veiga and Luca F. Pavarino and S. Scacchi and Olof B. Widlund and 10954 Stefano Zampini}, 10955 journal = {SIAM Journal of Scientific Computing}, 10956 volume = {39}, 10957 number = {1}, 10958 pages = {A281--A302}, 10959 year = {2016} 10960} 10961 10962@Article{ pavarinoscacchiwidlundzampini2018, 10963 title = {Isogeometric {BDDC} deluxe preconditioners for linear elasticity for isogeometric 10964 analysis}, 10965 author = {Luca F. Pavarino and S. Scacchi and Olof B. Widlund and Stefano Zampini}, 10966 journal = {Mathematical Models and Methods in Applied Sciences}, 10967 volume = {28}, 10968 number = {7}, 10969 pages = {1337--1370}, 10970 year = {2018} 10971} 10972 10973@Article{ bergervergiatwaisman2017, 10974 title = {An overlapping Domain Decomposition preconditioning method for monolithic 10975 solution of shear bands}, 10976 author = {Luc Berger-Vergiat and Haim Waisman}, 10977 journal = {Computer Methods in Applied Mechanics and Engineering}, 10978 volume = {318}, 10979 pages = {33--60}, 10980 year = {2017}, 10981 petsc_uses = {KSP} 10982} 10983 10984@Article{ abhyankarmaldonadosmithzhang2020, 10985 title = {{PETSc} {DMNetwork}: A Library for Scalable Network PDE-Based Multiphysics 10986 Simulations}, 10987 author = {S. Abhyankar and G. Betrie and D.A. Maldonado and L.C. McInnes and B. Smith and 10988 H. Zhang}, 10989 journal = {ACM Transactions on Mathematical Software}, 10990 volume = {46}, 10991 number = {1}, 10992 year = {2020}, 10993 doi = {10.1145/3344587}, 10994 petsc_uses = {KSP} 10995} 10996 10997@InProceedings{ zhangellpack2018, 10998 author = {Hong Zhang and Richard T. Mills and Karl Rupp and Barry F. Smith}, 10999 title = {Vectorized Parallel Sparse Matrix-Vector Multiplication in {PETSc} Using 11000 {AVX-512}}, 11001 booktitle = {Proceedings of the 47th International Conference on Parallel Processing}, 11002 year = {2018}, 11003 petsc_uses = {KSP} 11004} 11005 11006@Misc{ petsc-user-meetings:website, 11007 title = {{PETSc User Meetings}}, 11008 key = {PETSc User Meetings}, 11009 howpublished = {\url{https://petsc.org/release/community/meetings/meeting}}, 11010 petsc_uses = {KSP} 11011} 11012 11013@Article{ flexible-bicgstab-chen16, 11014 title = {Analysis and Practical Use of Flexible {BiCGStab}}, 11015 author = {J. Chen and L.C. McInnes and H. Zhang}, 11016 journal = {Journal of Scientific Computing}, 11017 volume = {68}, 11018 number = {2}, 11019 month = jul, 11020 year = {2016}, 11021 pages = {803--825}, 11022 doi = {10.1007/s10915-015-0159-4}, 11023 petsc_uses = {KSP} 11024} 11025 11026@Misc{ petsc-extensibility2016, 11027 author = {M. Knepley and D. A. May and J. Brown and B. Smith}, 11028 title = {{Extensibility in PETSc}}, 11029 note = {SIAM News, available via 11030 \url{https://sinews.siam.org/Details-Page/extensibility-in-petsc}}, 11031 year = {2016}, 11032 petsc_uses = {KSP} 11033} 11034 11035@Misc{ error-estimation-whitepaper2017, 11036 author = {E. Constantinescu and O. Marin and T. Munson and B. Smith and H. Zhang}, 11037 title = {End-to-end error estimation and control}, 11038 note = {whitepaper for 2017 ASCR Applied Mathematics PI Meeting}, 11039 doi = {10.6084/m9.figshare.5339866}, 11040 year = {2017}, 11041 petsc_uses = {KSP} 11042} 11043 11044@Misc{ petsc-user-support15, 11045 title = {On the Evolution of User Support Topics in Computational Science and Engineering 11046 Software}, 11047 author = {K. Rupp and S. Balay and J. Brown and M. Knepley and L. C. McInnes and B. Smith}, 11048 note = {Workshop on CSE Software Sustainability and Productivity (CSESSP) Challenges, Oct 11049 15-16, 2015}, 11050 year = {2015}, 11051 petsc_uses = {KSP} 11052} 11053 11054@InBook{ petsc-mixed-language-support2016, 11055 title = {Numerical Library Support for High-Performance Mixed Language Applications and 11056 Legacy Code}, 11057 author = {S. Balay and J. Brown and M. Knepley and L.C. McInnes and B. Smith}, 11058 booktitle = {Software Engineering for Science}, 11059 editors = {J. Carver et al.}, 11060 publisher = {CRC Press}, 11061 pages = {201--214}, 11062 year = {2016}, 11063 petsc_uses = {KSP} 11064} 11065 11066@InProceedings{ konolige2018parallel, 11067 title = {A Parallel Solver for Graph {L}aplacians}, 11068 author = {Tristan Konolige and Jed Brown}, 11069 booktitle = {Proceedings of the Platform for Advanced Scientific Computing (PASC)}, 11070 doi = {10.1145/3218176.3218227}, 11071 note = {Best Paper Award}, 11072 archiveprefix = {arXiv}, 11073 eprint = {1705.06266}, 11074 year = {2018}, 11075 petsc_uses = {KSP} 11076} 11077 11078@InProceedings{ werner-kimn2019, 11079 title = {Parallel implementation of {AC} optimal power flow and time-constrained optimal 11080 power flow using high-performance computing}, 11081 author = {Alex Werner and Kapil Duwadi and Nicholas Stegmeier and Timothy M. Hansen and 11082 Jung-Han Kimn}, 11083 booktitle = {IEEE 9th Annual Computing and Communication Workshop and Conference (CCWC 2019)}, 11084 note = {Best Paper in Track}, 11085 year = {2019}, 11086 petsc_uses = {KSP} 11087} 11088 11089@MastersThesis{ rinaldo-ceresoli18, 11090 author = {Stefano Guido Rinaldo and Andrea Ceresoli}, 11091 title = {Newton–Krylov–Schwarz Methods for Distributed Power Flow and Related 11092 Applications}, 11093 school = {Politecnico di Milano}, 11094 year = {2018}, 11095 month = apr, 11096 petsc_uses = {KSP} 11097} 11098 11099@Article{ sananschneppmay2016, 11100 title = {Pipelined, Flexible {K}rylov Subspace Methods}, 11101 author = {P. Sanan and S. M. Schnepp and D. A. May}, 11102 journal = {SIAM Journal on Scientific Computing}, 11103 volume = {38}, 11104 number = {5}, 11105 pages = {C441-C470}, 11106 year = {2016}, 11107 doi = {10.1137/15M1049130}, 11108 petsc_uses = {KSP} 11109} 11110 11111@Article{ petscsf2022, 11112 author = {Zhang, Junchao and Brown, Jed and Balay, Satish and Faibussowitsch, Jacob and 11113 Knepley, Matthew and Marin, Oana and Mills, Richard Tran and Munson, Todd and 11114 Smith, Barry F. and Zampini, Stefano}, 11115 journal = {IEEE Transactions on Parallel and Distributed Systems}, 11116 title = {The {PetscSF} Scalable Communication Layer}, 11117 year = {2022}, 11118 volume = {33}, 11119 number = {4}, 11120 pages = {842-853}, 11121 doi = {10.1109/TPDS.2021.3084070} 11122} 11123 11124@Article{ brandt2000, 11125 title = {General highly accurate algebraic coarsening}, 11126 author = {Achi Brandt}, 11127 journal = {Electronic Transactions on Numerical Analysis}, 11128 volume = {10}, 11129 number = {9680}, 11130 pages = {1--20}, 11131 issn = {10689613}, 11132 year = {2000} 11133} 11134 11135@Article{ dalcinpazklercosimo2011, 11136 title = {Parallel distributed computing using Python}, 11137 author = {Lisandro D. Dalcin and Rodrigo R. Paz and Pablo A. Kler and Alejandro Cosimo}, 11138 journal = {Advances in Water Resources}, 11139 volume = {34}, 11140 number = {9}, 11141 pages = {1124 - 1139}, 11142 note = {New Computational Methods and Software Tools}, 11143 issn = {0309-1708}, 11144 doi = {10.1016/j.advwatres.2011.04.013}, 11145 year = {2011} 11146} 11147 11148@Article{ behnelbradshawcitrodalcinseljebotnsmith2011, 11149 title = {Cython: The Best of Both Worlds}, 11150 author = {Behnel,Stefan and Bradshaw,Robert and Citro,Craig and Dalcin,Lisandro and 11151 Seljebotn,Dag Sverre and Smith,Kurt }, 11152 journal = {Computing in Science \& Engineering}, 11153 volume = {13}, 11154 number = {2}, 11155 pages = {31-39}, 11156 doi = {10.1109/MCSE.2010.118}, 11157 year = {2011} 11158} 11159 11160@Article{ dalcinpazstorti2005, 11161 title = {MPI for Python}, 11162 author = {Lisandro Dalcín and Rodrigo Paz and Mario Storti}, 11163 journal = {Journal of Parallel and Distributed Computing}, 11164 volume = {65}, 11165 number = {9}, 11166 pages = {1108 - 1115}, 11167 issn = {0743-7315}, 11168 doi = {10.1016/j.jpdc.2005.03.010}, 11169 year = {2005} 11170} 11171 11172@Article{ dalcincolliervignalcortescalo2016, 11173 title = {PetIGA: A framework for high-performance isogeometric analysis}, 11174 author = {Lisandro Dalcin and Nathan Collier and P. Vignal and A.M.A. Cortes and Victor M. 11175 Calo}, 11176 journal = {Computer Methods in Applied Mechanics and Engineering}, 11177 volume = {308}, 11178 pages = {151 - 181}, 11179 issn = {0045-7825}, 11180 doi = {10.1016/j.cma.2016.05.011}, 11181 year = {2016} 11182} 11183 11184@Article{ collierpardodalcinpaszynskicalo2012, 11185 title = {The cost of continuity: A study of the performance of isogeometric finite 11186 elements using direct solvers}, 11187 author = {Nathan Collier and David Pardo and Lisandro Dalcin and Maciej Paszynski and V.M. 11188 Calo}, 11189 journal = {Computer Methods in Applied Mechanics and Engineering}, 11190 volume = {213-216}, 11191 pages = {353 - 361}, 11192 issn = {0045-7825}, 11193 doi = {10.1016/j.cma.2011.11.002}, 11194 year = {2012} 11195} 11196 11197@Article{ collierdalcinpardocalo2013, 11198 title = {The Cost of Continuity: Performance of Iterative Solvers on Isogeometric Finite 11199 Elements}, 11200 author = {Nathan Collier and Lisandro Dalcin and David Pardo and Victor M. Calo}, 11201 journal = {SIAM Journal on Scientific Computing}, 11202 volume = {35}, 11203 number = {2}, 11204 pages = {A767-A784}, 11205 doi = {10.1137/120881038}, 11206 year = {2013} 11207} 11208 11209@Article{ dunning2017jump, 11210 title = {{JuMP}: a modeling language for mathematical optimization}, 11211 author = {Dunning, Iain and Huchette, Joey and Lubin, Miles}, 11212 journal = {SIAM Review}, 11213 volume = {59}, 11214 number = {2}, 11215 pages = {295--320}, 11216 year = {2017}, 11217 publisher = {SIAM} 11218} 11219 11220@InProceedings{ prudencioschulz2011, 11221 title = {The parallel {C++} statistical library {QUESO}: Quantification of Uncertainty for 11222 Estimation, Simulation and Optimization}, 11223 author = {Ernesto E Prudencio and Karl W Schulz}, 11224 booktitle = {European Conference on Parallel Processing}, 11225 pages = {398--407}, 11226 year = {2011} 11227} 11228 11229@Misc{ rol-website, 11230 key = {ROL}, 11231 title = {{Rapid Optimization Library} Website}, 11232 howpublished = {\url{https://trilinos.org/packages/rol}}, 11233 year = {2018} 11234} 11235 11236@Article{ more1994line, 11237 title = {Line search algorithms with guaranteed sufficient decrease}, 11238 author = {Mor{\'e}, Jorge J and Thuente, David J}, 11239 journal = {ACM Transactions on Mathematical Software}, 11240 volume = {20}, 11241 number = {3}, 11242 pages = {286--307}, 11243 year = {1994}, 11244 publisher = {ACM} 11245} 11246 11247@Article{ griewank2000algorithm, 11248 title = {Algorithm 799: revolve: an implementation of checkpointing for the reverse or 11249 adjoint mode of computational differentiation}, 11250 author = {Griewank, Andreas and Walther, Andrea}, 11251 journal = {ACM Transactions on Mathematical Software}, 11252 volume = {26}, 11253 number = {1}, 11254 pages = {19--45}, 11255 year = {2000}, 11256 publisher = {ACM} 11257} 11258 11259@Article{ metcalf2011seven, 11260 title = {The seven ages of fortran}, 11261 author = {Metcalf, Michael}, 11262 journal = {Journal of Computer Science \& Technology}, 11263 volume = {11}, 11264 year = {2011} 11265} 11266 11267@Article{ giraldo_2013, 11268 title = {Implicit-explicit formulations of a three-dimensional nonhydrostatic unified 11269 model of the atmosphere {(NUMA)}}, 11270 author = {F.X. Giraldo and J.F. Kelly and E.M. Constantinescu}, 11271 journal = {SIAM Journal on Scientific Computing}, 11272 year = {2013}, 11273 number = {5}, 11274 pages = {B1162-B1194}, 11275 volume = {35}, 11276 doi = {10.1137/120876034} 11277} 11278 11279@Article{ constantinescu_tr2016b, 11280 author = {Constantinescu, E.M.}, 11281 title = {Estimating Global Errors in Time Stepping}, 11282 journal = {ArXiv e-prints}, 11283 archiveprefix = {arXiv}, 11284 eprint = {1503.05166}, 11285 primaryclass = {math.NA}, 11286 keywords = {Mathematics - Numerical Analysis, 65L05, 65L06, 65L20, 65L70}, 11287 year = {2016}, 11288 month = mar, 11289 adsurl = {http://adsabs.harvard.edu/abs/2015arXiv150305166C}, 11290 adsnote = {Provided by the SAO/NASA Astrophysics Data System} 11291} 11292 11293@Article{ pareschi_2005, 11294 title = {Implicit-Explicit {R}unge-{K}utta Schemes and Applications to Hyperbolic Systems 11295 with Relaxation}, 11296 author = {L. Pareschi and G. Russo}, 11297 journal = {Journal of Scientific Computing}, 11298 year = {2005}, 11299 number = {1}, 11300 pages = {129--155}, 11301 volume = {25} 11302} 11303 11304@Article{ kennedy_2003, 11305 title = {Additive {R}unge-{K}utta schemes for convection-diffusion-reaction equations}, 11306 author = {C.A. Kennedy and M.H. Carpenter}, 11307 journal = {Appl. Numer. Math.}, 11308 year = {2003}, 11309 number = {1-2}, 11310 pages = {139--181}, 11311 volume = {44}, 11312 doi = {10.1016/S0168-9274(02)00138-1}, 11313 publisher = {Elsevier Science Publishers B. V.} 11314} 11315 11316@Unpublished{ boscarino_tr2011, 11317 title = {Implicit-Explicit {R}unge-{K}utta schemes for hyperbolic systems and kinetic 11318 equations in the diffusion limit}, 11319 author = {Boscarino, S. and Pareschi, L. and Russo, G.}, 11320 note = {Arxiv preprint arXiv:1110.4375}, 11321 year = {2011} 11322} 11323 11324@Article{ ascher_1997, 11325 title = {Implicit-explicit {R}unge-{K}utta methods for time-dependent partial differential 11326 equations}, 11327 author = {U.M. Ascher and S.J. Ruuth and R.J. Spiteri}, 11328 journal = {Applied Numerical Mathematics}, 11329 year = {1997}, 11330 pages = {151--167}, 11331 volume = {25} 11332} 11333 11334@Book{ ascherpetzold1998, 11335 title = {Computer methods for ordinary differential equations and differential-algebraic 11336 equations}, 11337 author = {Uri M Ascher and Linda R Petzold}, 11338 volume = {61}, 11339 publisher = {SIAM}, 11340 year = {1998} 11341} 11342 11343@Article{ colomesbadia2016, 11344 title = {Segregated {Runge}--{Kutta} methods for the incompressible {Navier}--{Stokes} 11345 equations}, 11346 author = {Oriol Colom{\'e}s and Santiago Badia}, 11347 journal = {International Journal for Numerical Methods in Engineering}, 11348 volume = {105}, 11349 number = {5}, 11350 pages = {372--400}, 11351 year = {2016} 11352} 11353 11354@Article{ sandu_1997, 11355 title = {Benchmarking stiff {ODE} solvers for atmospheric chemistry problems {II}: 11356 {R}osenbrock solvers}, 11357 author = {A. Sandu and J.G. Verwer and J.G. Blom and E.J. Spee and G.R. Carmichael and F.A. 11358 Potra}, 11359 journal = {Atmospheric Environment}, 11360 year = {1997}, 11361 number = {20}, 11362 pages = {3459--3472}, 11363 volume = {31}, 11364 abstract = {In the numerical simulation of atmospheric transport-chemistry processes, a major 11365 task is the integration of the stiff systems of ordinary differential equations 11366 describing the chemical transformations. It is therefore of interest to 11367 systematically search for stiff solvers which can be identified as close to 11368 optimal for atmospheric applications. In this paper we continue our investigation 11369 from Sandu et al. (1996, CWI Report NM-R9603 and Report in Comput. Math., No. 85) 11370 and compare eight solvers on a set of seven box-models used in present day models. 11371 The focus is on Rosenbrock solvers. These turn out to be very well suited for our 11372 application when they are provided with highly efficient sparse matrix techniques 11373 to economize on the linear algebra. Two of the Rosenbrock solvers tested are from 11374 the literature, viz. and 4, and two are new and specially developed for air 11375 quality applications, viz. 3 and 3. } 11376} 11377 11378@Article{ rang_2005, 11379 title = {New {R}osenbrock {W}-methods of order 3 for partial differential algebraic 11380 equations of index 1}, 11381 author = {Rang, J. and Angermann, L.}, 11382 journal = {BIT Numerical Mathematics}, 11383 year = {2005}, 11384 number = {4}, 11385 pages = {761--787}, 11386 volume = {45}, 11387 publisher = {Springer}, 11388 doi = {10.1007/s10543-005-0035-y} 11389} 11390 11391@article{rang2015improved, 11392 title = {Improved traditional {R}osenbrock--{W}anner methods for stiff {ODE}s and {DAE}s}, 11393 author = {Rang, Joachim}, 11394 journal = {Journal of Computational and Applied Mathematics}, 11395 volume = {286}, 11396 pages = {128--144}, 11397 year = {2015}, 11398 publisher = {Elsevier}, 11399 doi = {10.1016/j.cam.2015.03.010} 11400} 11401 11402@Article{ gottliebketchesonshu2009, 11403 author = {Sigal Gottlieb and David I. Ketcheson and Chi Wang Shu}, 11404 title = {{High order strong stability preserving time discretizations}}, 11405 journal = {Journal of Scientific Computing}, 11406 volume = {38}, 11407 number = {3}, 11408 pages = {251--289}, 11409 doi = {10.1007/s10915-008-9239-z}, 11410 year = {2009} 11411} 11412 11413@Article{ ketcheson_2008, 11414 title = {Highly Efficient Strong Stability-Preserving {R}unge--{K}utta Methods with 11415 Low-Storage Implementations}, 11416 author = {D.I. Ketcheson}, 11417 journal = {SIAM Journal on Scientific Computing}, 11418 year = {2008}, 11419 number = {4}, 11420 pages = {2113--2136}, 11421 volume = {30}, 11422 doi = {10.1137/07070485X}, 11423 keywords = {method of lines, strong stability-preserving, monotonicity, low-storage, 11424 RungeKutta methods}, 11425 publisher = {SIAM} 11426} 11427 11428@Article{ jansen_2000, 11429 title = {A generalized-alpha method for integrating the filtered {N}avier--{S}tokes 11430 equations with a stabilized finite element method}, 11431 author = {Jansen, K.E. and Whiting, C.H. and Hulbert, G.M.}, 11432 journal = {Computer Methods in Applied Mechanics and Engineering}, 11433 year = {2000}, 11434 number = {3}, 11435 pages = {305--319}, 11436 volume = {190}, 11437 publisher = {Elsevier} 11438} 11439 11440@Article{ butcher_2007, 11441 title = {Error propagation of general linear methods for ordinary differential equations}, 11442 author = {J.C. Butcher and Z. Jackiewicz and W.M. Wright}, 11443 journal = {Journal of Complexity}, 11444 year = {2007}, 11445 number = {4-6}, 11446 pages = {560--580}, 11447 volume = {23}, 11448 abstract = {We discuss error propagation for general linear methods for ordinary differential 11449 equations up to terms of order p+2, where p is the order of the method. These 11450 results are then applied to the estimation of local discretization errors for 11451 methods of order p and for the adjacent order p+1. The results of numerical 11452 experiments confirm the reliability of these estimates. This research has 11453 applications in the design of robust stepsize and order changing strategies for 11454 algorithms based on general linear methods.}, 11455 doi = {10.1016/j.jco.2007.01.009}, 11456 issn = {0885-064X} 11457} 11458 11459@Article{ constantinescu_a2010a, 11460 title = {Extrapolated implicit-explicit time stepping}, 11461 author = {E.M. Constantinescu and A. Sandu}, 11462 journal = {SIAM Journal on Scientific Computing}, 11463 year = {2010}, 11464 number = {6}, 11465 pages = {4452-4477}, 11466 volume = {31}, 11467 comment = {Preprint \# ANL/MCS-P1612-0409}, 11468 doi = {10.1137/080732833} 11469} 11470 11471@InProceedings{ devito2011liszt, 11472 title = {Liszt: a domain specific language for building portable mesh-based PDE solvers}, 11473 author = {DeVito, Zachary and Joubert, Niels and Palacios, Francisco and Oakley, Stephen 11474 and Medina, Montserrat and Barrientos, Mike and Elsen, Erich and Ham, Frank and 11475 Aiken, Alex and Duraisamy, Karthik and others}, 11476 booktitle = {Proceedings of 2011 International Conference for High Performance Computing, 11477 Networking, Storage and Analysis}, 11478 pages = {9}, 11479 year = {2011}, 11480 organization = {ACM} 11481} 11482 11483@Article{ devito2011designing, 11484 title = {Designing the Language Liszt for Building Portable Mesh-based PDE Solvers}, 11485 author = {DeVito, Zachary and Hanrahan, Pat}, 11486 journal = {Scientific Discovery through Advanced Computing Program (SciDAC)}, 11487 year = {2011} 11488} 11489 11490@Misc{ pgasintro, 11491 author = {Tim Stitt}, 11492 title = {An Introduction to the Partitioned Global Address Space (PGAS) Programming 11493 Model}, 11494 note = {\url{http://cnx.org/content/m20649/latest/}} 11495} 11496 11497@InProceedings{ el2006upc, 11498 title = {UPC: unified parallel C}, 11499 author = {El-Ghazawi, Tarek and Smith, Lauren}, 11500 booktitle = {Proceedings of the 2006 ACM/IEEE conference on Supercomputing}, 11501 pages = {27}, 11502 year = {2006}, 11503 organization = {ACM} 11504} 11505 11506@InProceedings{ numrich1998co, 11507 title = {Co-Array Fortran for parallel programming}, 11508 author = {Numrich, Robert W and Reid, John}, 11509 booktitle = {ACM Sigplan Fortran Forum}, 11510 volume = {17}, 11511 number = {2}, 11512 pages = {1--31}, 11513 year = {1998}, 11514 organization = {ACM} 11515} 11516 11517@Article{ aiken1997titanium, 11518 title = {Titanium: A high-performance Java dialect}, 11519 author = {Aiken, Alex and Colella, Phil and Gay, David and Graham, Susan and Hilfinger, 11520 Paul and Krishnamurthy, Arvind and Liblit, Ben and Miyamoto, Carleton and Pike, 11521 Geoff and Semenzato, Luigi and others}, 11522 year = {1997} 11523} 11524 11525@Article{ charles2005x10, 11526 title = {X10: an object-oriented approach to non-uniform cluster computing}, 11527 author = {Charles, Philippe and Grothoff, Christian and Saraswat, Vijay and Donawa, 11528 Christopher and Kielstra, Allan and Ebcioglu, Kemal and Von Praun, Christoph and 11529 Sarkar, Vivek}, 11530 journal = {Acm Sigplan Notices}, 11531 volume = {40}, 11532 number = {10}, 11533 pages = {519--538}, 11534 year = {2005}, 11535 publisher = {ACM} 11536} 11537 11538@Article{ chamberlain2007parallel, 11539 title = {Parallel programmability and the chapel language}, 11540 author = {Chamberlain, Bradford L and Callahan, David and Zima, Hans P}, 11541 journal = {International Journal of High Performance Computing Applications}, 11542 volume = {21}, 11543 number = {3}, 11544 pages = {291--312}, 11545 year = {2007}, 11546 publisher = {SAGE Publications} 11547} 11548 11549@InProceedings{ charmppoopsla93, 11550 author = {{Kal\'{e}}, L.V. and Krishnan, S.}, 11551 title = {{CHARM++: A Portable Concurrent Object Oriented System Based on C++}}, 11552 editor = {Paepcke, A.}, 11553 fulleditor = {Paepcke, Andreas}, 11554 pages = {91--108}, 11555 month = sep, 11556 year = {1993}, 11557 booktitle = {{Proceedings of OOPSLA'93}}, 11558 publisher = {{ACM Press}} 11559} 11560 11561@InProceedings{ hewitt1973universal, 11562 title = {A universal modular actor formalism for artificial intelligence}, 11563 author = {Hewitt, Carl and Bishop, Peter and Steiger, Richard}, 11564 booktitle = {Proceedings of the 3rd international joint conference on Artificial 11565 intelligence}, 11566 pages = {235--245}, 11567 year = {1973}, 11568 organization = {Morgan Kaufmann Publishers Inc.} 11569} 11570 11571@Book{ yonezawa1990abcl, 11572 title = {ABCL: an object-oriented concurrent system}, 11573 author = {Yonezawa, Akinori}, 11574 year = {1990}, 11575 publisher = {MIT press} 11576} 11577 11578@InProceedings{ dally1988object, 11579 title = {Object-oriented concurrent programming in CST}, 11580 author = {Dally, William J and Chien, Andrew A}, 11581 booktitle = {Proceedings of the third conference on Hypercube concurrent computers and 11582 applications: Architecture, software, computer systems, and general issues-Volume 11583 1}, 11584 pages = {434--439}, 11585 year = {1988}, 11586 organization = {ACM} 11587} 11588 11589@Article{ grimshaw1993easy, 11590 title = {Easy-to-use object-oriented parallel processing with Mentat}, 11591 author = {Grimshaw, Andrew S.}, 11592 journal = {Computer}, 11593 volume = {26}, 11594 number = {5}, 11595 pages = {39--51}, 11596 year = {1993}, 11597 publisher = {IEEE} 11598} 11599 11600@InProceedings{ gannon1991object, 11601 title = {Object oriented parallelism: pC++ ideas and experiments}, 11602 author = {Gannon, Dennis and Lee, JK}, 11603 booktitle = {Proceedings of}, 11604 pages = {13--23}, 11605 year = {1991} 11606} 11607 11608@InProceedings{ lau1992object, 11609 title = {An object-oriented class library for scalable parallel heuristic search}, 11610 author = {Lau, Wing-cheong and Singh, Vineet}, 11611 booktitle = {ECOOP’92 European Conference on Object-Oriented Programming}, 11612 pages = {252--267}, 11613 year = {1992}, 11614 organization = {Springer} 11615} 11616 11617@Book{ chase1989amber, 11618 title = {The Amber system: Parallel programming on a network of multiprocessors}, 11619 author = {Chase, Jeffery and Amador, Franz and Lazowska, Edward and Levy, Henry and 11620 Littlefield, Richard}, 11621 volume = {23}, 11622 number = {5}, 11623 year = {1989}, 11624 publisher = {ACM} 11625} 11626 11627@InProceedings{ kaiser2009parallex, 11628 title = {Parallex an advanced parallel execution model for scaling-impaired applications}, 11629 author = {Kaiser, Hartmut and Brodowicz, Maciej and Sterling, Thomas}, 11630 booktitle = {Parallel Processing Workshops, 2009. ICPPW'09. International Conference on}, 11631 pages = {394--401}, 11632 year = {2009}, 11633 organization = {IEEE} 11634} 11635 11636@TechReport{ ipm, 11637 author = {Barry F. Smith}, 11638 title = {A New Parallel Programming Model for Computer Simulation}, 11639 institution = {Argonne National Laboratory}, 11640 year = {2014}, 11641 number = {ANL/MCS-P5135-0414} 11642} 11643 11644@Article{ groppsnir, 11645 author = {William Gropp and Marc Snir}, 11646 title = {Programming for Exascale Computers}, 11647 journal = {Computing in Science and Engineering}, 11648 volume = {15}, 11649 number = {6}, 11650 issn = {1521-9615}, 11651 year = {2013}, 11652 pages = {27-35}, 11653 doi = {10.1109/MCSE.2013.96}, 11654 publisher = {IEEE Computer Society}, 11655 address = {Los Alamitos, CA} 11656} 11657 11658@Book{ mpi3, 11659 title = {MPI: A Message-Passing Interface Standard, Version 3.0}, 11660 author = {Message Passing Interface Forum}, 11661 year = {2012}, 11662 publisher = {High Performance Computing Center Stuttgart (HLRS)} 11663} 11664 11665@Book{ openmp4, 11666 title = {OpenMP Application Program Interface, Version 4.0}, 11667 year = {2013}, 11668 publisher = {OpenMP Architecture Review Board} 11669} 11670 11671@InProceedings{ hartono2009annotation, 11672 title = {Annotation-based empirical performance tuning using {Orio}}, 11673 author = {Hartono, Albert and Norris, Boyana and Sadayappan, Ponnuswamy}, 11674 booktitle = {Parallel \& Distributed Processing, 2009. IPDPS 2009. IEEE International 11675 Symposium on}, 11676 pages = {1--11}, 11677 year = {2009}, 11678 organization = {IEEE} 11679} 11680 11681@Book{ toselli2005domain, 11682 title = {Domain Decomposition Methods: Algorithms and Theory}, 11683 author = {Toselli, Andrea and Widlund, Olof B}, 11684 volume = {34}, 11685 year = {2005}, 11686 publisher = {Springer} 11687} 11688 11689@InBook{ st2016, 11690 author = {Barry F. Smith and Xumin Tu}, 11691 chapter = {Domain Decomposition}, 11692 title = {Encyclopedia of Applied and Computational Mathematics}, 11693 bookeditor = {B. Engquist}, 11694 publisher = {Springer}, 11695 pages = {375--381}, 11696 year = {2016} 11697} 11698 11699@TechReport{ saws, 11700 author = {Matt Otten and Jed Brown and Barry F. Smith}, 11701 title = {Scientific Application Web Server {(SAWs)} Users Manual}, 11702 institution = {Argonne National Laboratory}, 11703 year = {2013} 11704} 11705 11706@Article{ smith1997domain, 11707 title = {Domain Decomposition Methods for Partial Differential Equations}, 11708 author = {Smith, B.F.}, 11709 journal = {ICASE LARC Interdisciplinary Series in Science and Engineering}, 11710 volume = {4}, 11711 pages = {225--244}, 11712 year = {1997}, 11713 publisher = {Citeseer} 11714} 11715 11716@Article{ spillane2011abstract, 11717 title = {Abstract robust coarse spaces for systems of {PDEs} via generalized eigenproblems 11718 in the overlaps}, 11719 author = {Spillane, N and Dolean, V and Hauret, P and Nataf, F and Pechstein, C and 11720 Scheichl, R}, 11721 journal = {NuMa-Report}, 11722 volume = {7}, 11723 pages = {2007}, 11724 year = {2011} 11725} 11726 11727@InProceedings{ jolivet2013scalabledd, 11728 title = {Scalable domain decomposition preconditioners for heterogeneous elliptic 11729 problems}, 11730 author = {Jolivet, Pierre and Hecht, Fr{\'e}d{\'e}ric and Nataf, Fr{\'e}d{\'e}ric and 11731 Prud'homme, Christophe}, 11732 booktitle = {Proceedings of SC13: International Conference for High Performance Computing, 11733 Networking, Storage and Analysis}, 11734 pages = {80}, 11735 year = {2013}, 11736 organization = {ACM} 11737} 11738 11739@Book{ ks2000, 11740 author = {D. Kinderlehrer and G. Stampacchia}, 11741 publisher = {Society for Industrial Mathematics}, 11742 title = {An Introduction to Variational Inequalities and Their Applications}, 11743 year = {2000} 11744} 11745 11746@Article{ wan2000energy, 11747 title = {An energy-minimizing interpolation for robust multigrid methods}, 11748 author = {Wan, W.L. and Chan, T.F. and Smith, B. F.}, 11749 journal = {SIAM Journal on Scientific Computing}, 11750 volume = {21}, 11751 number = {4}, 11752 pages = {1632--1649}, 11753 year = {2000}, 11754 publisher = {Philadelphia, PA: SIAM, c1993-} 11755} 11756 11757@Article{ chansmith1994, 11758 title = {Domain decomposition and multigrid algorithms for elliptic problems on 11759 unstructured meshes}, 11760 author = {Chan, T.F. and Smith, B.F.}, 11761 journal = {Electronic Transactions on Numerical Analysis}, 11762 volume = {2}, 11763 pages = {171--182}, 11764 year = {1994} 11765} 11766 11767@TechReport{ proto-fsp, 11768 author = {Venkatramani Balaji and Barry Smith and Brian Van Straalen and Priya Vashishta 11769 and Michael Zarnstorff and Michael Zika}, 11770 title = {Report of the {Proto-FSP} {Assessment Panel for the FSP}}, 11771 institution = {Princeton Plasma Physics Laboratory}, 11772 year = {2010}, 11773 url = {http://www.pppl.gov/fsp/documents/Proto-FSPAssessmentReport.pdf} 11774} 11775 11776@Article{ hirvijoki2021, 11777 title = {Structure-preserving marker-particle discretizations of {Coulomb} collisions for 11778 particle-in-cell codes}, 11779 journal = {Plasma Phys. Control. Fusion}, 11780 author = {Eero Hirvijoki}, 11781 note = {in press}, 11782 doi = {10.1088/1361-6587/abe884}, 11783 year = {2021} 11784} 11785 11786@Article{ ipsen2001, 11787 author = {Ilse C. F. Ipsen}, 11788 journal = {SIAM J. Sci. Comput.}, 11789 pages = {1050--1051}, 11790 volume = {23}, 11791 publisher = {SIAM}, 11792 title = {A Note on Preconditioning Nonsymmetric Matrices}, 11793 year = {2001} 11794} 11795 11796% Random papers on solvers for GPUs 11797@InProceedings{ gpus-suck, 11798 author = {Vuduc, R. and Chandramowlishwaran, A. and Choi, J. and Guney M. }, 11799 title = { On the Limits of {GPU} Acceleration}, 11800 booktitle = {HOTPAR: Proceedings of the 2nd USENIX Workshop on Hot Topics in Parallelism}, 11801 year = {2010}, 11802 publisher = {USENIX} 11803} 11804 11805@InProceedings{ 882364, 11806 author = {Bolz, Jeff and Farmer, Ian and Grinspun, Eitan and Schr\"{o}oder, Peter}, 11807 title = {Sparse matrix solvers on the {GPU}: conjugate gradients and multigrid}, 11808 booktitle = {SIGGRAPH '03: ACM SIGGRAPH 2003 Papers}, 11809 year = {2003}, 11810 isbn = {1-58113-709-5}, 11811 pages = {917--924}, 11812 location = {San Diego, California}, 11813 doi = {10.1145/1201775.882364}, 11814 publisher = {ACM}, 11815 address = {New York, NY} 11816} 11817 11818@Conference{ feng2008multigrid, 11819 author = {Feng, Z. and Li, P.}, 11820 booktitle = {IEEE/ACM International Conference on Computer-Aided Design, 2008. ICCAD 2008}, 11821 date-added = {2010-08-19 15:57:06 -0500}, 11822 date-modified = {2010-08-19 15:57:06 -0500}, 11823 pages = {647--654}, 11824 title = {Multigrid on {GPU}: Tackling power grid analysis on parallel SIMT platforms}, 11825 year = {2008} 11826} 11827 11828@Conference{ goodnight2003multigrid, 11829 author = {Goodnight, N. and Woolley, C. and Lewin, G. and Luebke, D. and Humphreys, G.}, 11830 booktitle = {Proceedings of the ACM SIGGRAPH/EUROGRAPHICS conference on Graphics hardware}, 11831 date-added = {2010-08-19 15:45:20 -0500}, 11832 date-modified = {2010-08-19 15:45:20 -0500}, 11833 organization = {Eurographics Association}, 11834 pages = {102--111}, 11835 title = {A multigrid solver for boundary value problems using programmable graphics 11836 hardware}, 11837 year = {2003} 11838} 11839 11840@Article{ buatois2007concurrent, 11841 author = {Buatois, L. and Caumon, G. and L{\'e}vy, B.}, 11842 date-added = {2010-08-19 15:45:02 -0500}, 11843 date-modified = {2010-08-19 15:45:02 -0500}, 11844 journal = {High Performance Computing and Communications}, 11845 pages = {358--371}, 11846 publisher = {Citeseer}, 11847 title = {Concurrent number cruncher: {A}n efficient sparse linear solver on the {GPU}}, 11848 year = {2007} 11849} 11850 11851@Article{ joldes2010real, 11852 author = {Joldes, G.R. and Wittek, A. and Miller, K.}, 11853 date-added = {2010-08-19 15:44:41 -0500}, 11854 date-modified = {2010-08-19 15:44:41 -0500}, 11855 journal = {Computer Methods in Applied Mechanics and Engineering}, 11856 publisher = {Elsevier}, 11857 title = {Real-time nonlinear finite element computations on {GPU}-application to 11858 neurosurgical simulation}, 11859 year = {2010} 11860} 11861 11862@Misc{ aharon2005gpu, 11863 author = {Aharon, S.}, 11864 date-added = {2010-08-19 15:44:32 -0500}, 11865 date-modified = {2010-08-19 15:44:32 -0500}, 11866 month = apr, 11867 note = {US Patent App. 11/115,642}, 11868 publisher = {Google Patents}, 11869 title = {{GPU}-based Finite Element}, 11870 year = {2005} 11871} 11872 11873@Article{ cevahir2009fast, 11874 author = {Cevahir, A. and Nukada, A. and Matsuoka, S.}, 11875 date-added = {2010-08-19 15:44:01 -0500}, 11876 date-modified = {2010-08-19 15:44:01 -0500}, 11877 journal = {Computational Science--ICCS 2009}, 11878 pages = {893--903}, 11879 publisher = {Springer}, 11880 title = {Fast conjugate gradients with multiple {GPU}s}, 11881 year = {2009} 11882} 11883 11884@Article{ maier1995symmetric, 11885 author = {Maier, G. and Miccoli, S. and Perego, U. and Novati, G.}, 11886 date-added = {2010-08-19 15:43:57 -0500}, 11887 date-modified = {2010-08-19 15:43:57 -0500}, 11888 journal = {Computational Mechanics}, 11889 number = {1}, 11890 pages = {115--129}, 11891 publisher = {Springer}, 11892 title = {Symmetric {G}alerkin boundary element method in plasticity and gradient 11893 plasticity}, 11894 volume = {17}, 11895 year = {1995} 11896} 11897 11898@Article{ corrigan-running, 11899 author = {Corrigan, A. and Camelli, F. and L{\\"o}hner, R. and Wallin, J.}, 11900 date-added = {2010-08-19 15:43:47 -0500}, 11901 date-modified = {2010-08-19 15:43:47 -0500}, 11902 journal = {International Journal for Numerical Methods in Fluids}, 11903 publisher = {John Wiley \& Sons}, 11904 title = {Running unstructured grid based CFD solvers on modern graphics hardware} 11905} 11906 11907@InProceedings{ volkov08, 11908 author = {Vasily Volkov and James W. Demmel}, 11909 title = {Benchmarking GPUs to tune dense linear algebra}, 11910 booktitle = {Proceedings of the 2008 ACM/IEEE Conference on Supercomputing (SC08)}, 11911 note = {\url{http://mc.stanford.edu/cgi-bin/images/6/65/SC08_Volkov_GPU.pdf}}, 11912 year = {2008} 11913} 11914 11915@TechReport{ cray-mvmult, 11916 author = {Guy~E. Blelloch and Michael~A. Heroux and Marco Zagha}, 11917 title = {Segmented Operations for Sparse Matrix Computation on Vector Multiprocessors}, 11918 institution = {School of Computer Science, Carnegie Mellon University}, 11919 number = {CMU-CS-93-173}, 11920 month = aug, 11921 year = {1993} 11922} 11923 11924@Conference{ bell2009implementing, 11925 author = {Bell, N. and Garland, M.}, 11926 booktitle = {Proceedings of the Conference on High Performance Computing Networking, Storage 11927 and Analysis}, 11928 date-added = {2010-08-19 15:43:42 -0500}, 11929 date-modified = {2010-08-19 15:43:42 -0500}, 11930 organization = {ACM}, 11931 pages = {1--11}, 11932 title = {Implementing sparse matrix-vector multiplication on throughput-oriented 11933 processors}, 11934 year = {2009} 11935} 11936 11937@Article{ bell2008efficient, 11938 author = {Bell, N. and Garland, M.}, 11939 date-added = {2010-08-19 15:43:36 -0500}, 11940 date-modified = {2010-08-19 15:43:36 -0500}, 11941 journal = {{NVIDIA} Corporation, {NVIDIA} Technical Report NVR-2008-004}, 11942 title = {Efficient sparse matrix-vector multiplication on {CUDA}}, 11943 year = {2008} 11944} 11945 11946@Article{ cohen-fast, 11947 author = {Cohen, J. and Molemaker, M.J.}, 11948 date-added = {2010-08-19 15:43:34 -0500}, 11949 date-modified = {2010-08-19 15:43:34 -0500}, 11950 journal = {Parallel Computational Fluid Dynamics: Recent Advances and Future Directions}, 11951 pages = {414}, 11952 publisher = {DEStech Publications}, 11953 title = {A fast double precision CFD code using CUDA} 11954} 11955 11956@Article{ kazhdan2008streaming, 11957 author = {Kazhdan, M. and Hoppe, H.}, 11958 date-added = {2010-08-19 15:43:32 -0500}, 11959 date-modified = {2010-08-19 15:43:32 -0500}, 11960 journal = {ACM Transactions on Graphics (TOG)}, 11961 number = {3}, 11962 pages = {21}, 11963 publisher = {ACM}, 11964 title = {Streaming multigrid for gradient-domain operations on large images}, 11965 volume = {27}, 11966 year = {2008} 11967} 11968 11969@Article{ bonnet1998symmetric, 11970 author = {Bonnet, M. and Maier, G. and Polizzotto, C.}, 11971 date-added = {2010-08-19 15:43:18 -0500}, 11972 date-modified = {2010-08-19 15:43:18 -0500}, 11973 journal = {Appl. Mech. Rev}, 11974 pages = {669--704}, 11975 title = {Symmetric {G}alerkin boundary element method.}, 11976 volume = {51}, 11977 year = {1998} 11978} 11979 11980@Conference{ zamith2007gpu, 11981 author = {Zamith, M. and Clua, E. and Pagliosa, P. and Conci, A. and Montenegro, A. and 11982 Valente, L.}, 11983 booktitle = {Proceedings of the VI Brazilian Symposium on Computer Games and Digital 11984 Entertainment}, 11985 date-added = {2010-08-19 15:43:14 -0500}, 11986 date-modified = {2010-08-19 15:43:14 -0500}, 11987 pages = {37--43}, 11988 title = {The {GPU} used as a math co-processor in real time applications}, 11989 year = {2007} 11990} 11991 11992@Article{ baskaran2009optimizing, 11993 author = {Baskaran, M.M. and Bordawekar, R.}, 11994 date-added = {2010-08-19 15:42:56 -0500}, 11995 date-modified = {2010-08-19 15:42:56 -0500}, 11996 journal = {IBM Research Report RC24704, IBM}, 11997 title = {Optimizing sparse matrix-vector multiplication on {GPU}s}, 11998 year = {2009} 11999} 12000 12001@Misc{ szeliski2006locally, 12002 author = {Szeliski, R.}, 12003 date-added = {2010-08-19 15:42:45 -0500}, 12004 date-modified = {2010-08-19 15:42:45 -0500}, 12005 month = jul, 12006 note = {US Patent App. 11/459,724}, 12007 publisher = {Google Patents}, 12008 title = {Locally adapted hierarchical basis preconditioning}, 12009 year = {2006} 12010} 12011 12012@Article{ jung2006cholesky, 12013 author = {Jung, J.H. and O'Leary, D.P.}, 12014 date-added = {2010-08-19 15:42:34 -0500}, 12015 date-modified = {2010-08-19 15:42:34 -0500}, 12016 journal = {Scholarly Paper, University of Maryland}, 12017 publisher = {Citeseer}, 12018 title = {Cholesky decomposition and linear programming on a {GPU}}, 12019 year = {2006} 12020} 12021 12022@Conference{ filipovic2009gpu, 12023 author = {Filipovic, J. and Peterlik, I. and Fousek, J.}, 12024 booktitle = {SAAHPC: Symposium on Application Accelerators in HPC}, 12025 date-added = {2010-08-19 15:42:33 -0500}, 12026 date-modified = {2010-08-19 15:42:33 -0500}, 12027 title = {{GPU} Acceleration of Equations Assembly in Finite Elements Method-Preliminary 12028 Results}, 12029 year = {2009} 12030} 12031 12032@Article{ taylor2009modelling, 12033 author = {Taylor, ZA and Comas, O. and Cheng, M. and Passenger, J. and Hawkes, DJ and 12034 Atkinson, D. and Ourselin, S.}, 12035 date-added = {2010-08-19 15:42:23 -0500}, 12036 date-modified = {2010-08-19 15:42:23 -0500}, 12037 journal = {Medical Image Analysis}, 12038 number = {2}, 12039 pages = {234--244}, 12040 publisher = {Elsevier}, 12041 title = {On modelling of anisotropic viscoelasticity for soft tissue simulation: Numerical 12042 solution and {GPU} execution}, 12043 volume = {13}, 12044 year = {2009} 12045} 12046 12047@Conference{ owens2007survey, 12048 author = {Owens, J.D. and Luebke, D. and Govindaraju, N. and Harris, M. and Kr{\\"u}ger, J. 12049 and Lefohn, A.E. and Purcell, T.J.}, 12050 booktitle = {Computer Graphics Forum}, 12051 date-added = {2010-08-19 15:42:21 -0500}, 12052 date-modified = {2010-08-19 15:42:21 -0500}, 12053 number = {1}, 12054 organization = {John Wiley \& Sons}, 12055 pages = {80--113}, 12056 title = {A survey of general-purpose computation on graphics hardware}, 12057 volume = {26}, 12058 year = {2007} 12059} 12060 12061@Article{ strzodka2005scientific, 12062 author = {Strzodka, R. and Doggett, M. and Kolb, A.}, 12063 date-added = {2010-08-19 15:42:18 -0500}, 12064 date-modified = {2010-08-19 15:42:18 -0500}, 12065 journal = {Simulation Modelling Practice and Theory}, 12066 number = {8}, 12067 pages = {667--680}, 12068 publisher = {Elsevier}, 12069 title = {Scientific computation for simulations on programmable graphics hardware}, 12070 volume = {13}, 12071 year = {2005} 12072} 12073 12074@Conference{ rumpf2001using, 12075 author = {Rumpf, M. and Strzodka, R.}, 12076 booktitle = {Proc. of IASTED Visualization, Imaging and Image Processing Conference 12077 (VIIP-01)}, 12078 date-added = {2010-08-19 15:42:15 -0500}, 12079 date-modified = {2010-08-19 15:42:15 -0500}, 12080 organization = {Citeseer}, 12081 pages = {193--202}, 12082 title = {Using graphics cards for quantized FEM computations}, 12083 year = {2001} 12084} 12085 12086@Article{ sirtori1992galerkin, 12087 author = {Sirtori, S. and Maier, G. and Novati, G. and Miccoli, S.}, 12088 date-added = {2010-08-19 15:42:14 -0500}, 12089 date-modified = {2010-08-19 15:42:14 -0500}, 12090 journal = {International Journal for Numerical Methods in Engineering}, 12091 number = {2}, 12092 pages = {255--282}, 12093 publisher = {John Wiley \& Sons}, 12094 title = {A {G}alerkin symmetric boundary-element method in elasticity: formulation and 12095 implementation}, 12096 volume = {35}, 12097 year = {1992} 12098} 12099 12100@Article{ tejada2005large, 12101 author = {Tejada, E. and Ertl, T.}, 12102 date-added = {2010-08-19 15:42:09 -0500}, 12103 date-modified = {2010-08-19 15:42:09 -0500}, 12104 journal = {Simulation Modelling Practice and Theory}, 12105 number = {8}, 12106 pages = {703--715}, 12107 publisher = {Elsevier}, 12108 title = {Large steps in {GPU}-based deformable bodies simulation}, 12109 volume = {13}, 12110 year = {2005} 12111} 12112 12113@Article{ goddeke2008using, 12114 author = {Goddeke, D. and Strzodka, R. and Mohd-Yusof, J. and McCormick, P. and Wobker, H. 12115 and Becker, C. and Turek, S.}, 12116 date-added = {2010-08-19 15:42:06 -0500}, 12117 date-modified = {2010-08-19 15:42:06 -0500}, 12118 journal = {International Journal of Computational Science and Engineering}, 12119 number = {1}, 12120 pages = {36--55}, 12121 publisher = {Inderscience}, 12122 title = {Using {GPU}s to improve multigrid solver performance on a cluster}, 12123 volume = {4}, 12124 year = {2008} 12125} 12126 12127@Article{ garland2008parallel, 12128 author = {Garland, M. and Le Grand, S. and Nickolls, J. and Anderson, J. and Hardwick, J. 12129 and Morton, S. and Phillips, E. and Zhang, Y. and Volkov, V.}, 12130 date-added = {2010-08-19 15:41:51 -0500}, 12131 date-modified = {2010-08-19 15:41:51 -0500}, 12132 journal = {IEEE Micro}, 12133 number = {4}, 12134 pages = {13--27}, 12135 title = {Parallel computing experiences with CUDA}, 12136 volume = {28}, 12137 year = {2008} 12138} 12139 12140@Article{ wong1985method, 12141 author = {Wong, SH and Ciric, IR}, 12142 date-added = {2010-08-19 15:41:48 -0500}, 12143 date-modified = {2010-08-19 15:41:48 -0500}, 12144 journal = {COMPEL: The International Journal for Computation and Mathematics in Electrical 12145 and Electronic Engineering}, 12146 publisher = {MCB UP Ltd}, 12147 title = {Method of conformal transformation for the finite-element solution of 12148 axisymmetric exterior-field problems}, 12149 volume = {4}, 12150 year = {1985} 12151} 12152 12153@Article{ turek-feast, 12154 author = {Turek, S. and G{\\"o}ddeke, D. and Becker, C. and Buijssen, S.H.M. and Wobker, 12155 H.}, 12156 date-added = {2010-08-19 15:41:47 -0500}, 12157 date-modified = {2010-08-19 15:41:47 -0500}, 12158 journal = {Concurrency and Computation: Practice and Experience}, 12159 publisher = {John Wiley \& Sons}, 12160 title = {FEAST-realization of hardware-oriented numerics for HPC simulations with finite 12161 elements} 12162} 12163 12164@Article{ abedi2006space, 12165 author = {Abedi, R. and Petracovici, B. and Haber, R.B.}, 12166 date-added = {2010-08-19 15:41:46 -0500}, 12167 date-modified = {2010-08-19 15:41:46 -0500}, 12168 journal = {Computer Methods in Applied Mechanics and Engineering}, 12169 number = {25-28}, 12170 pages = {3247--3273}, 12171 publisher = {Elsevier}, 12172 title = {A space-time discontinuous {G}alerkin method for linearized elastodynamics with 12173 element-wise momentum balance}, 12174 volume = {195}, 12175 year = {2006} 12176} 12177 12178@Conference{ georgii2005interactiveb, 12179 author = {Georgii, J. and Westermann, R.}, 12180 booktitle = {Proceedings of VMV}, 12181 date-added = {2010-08-19 15:41:36 -0500}, 12182 date-modified = {2010-08-19 15:41:36 -0500}, 12183 title = {Interactive simulation and rendering of heterogeneous deformable bodies}, 12184 year = {2005} 12185} 12186 12187@Article{ mosegaard2005gpu, 12188 author = {Mosegaard, J. and others}, 12189 date-added = {2010-08-19 15:41:35 -0500}, 12190 date-modified = {2010-08-19 15:41:35 -0500}, 12191 publisher = {IEEE Computer Society}, 12192 title = {{GPU} accelerated surgical simulators for complex morphology}, 12193 year = {2005} 12194} 12195 12196@Article{ meyer2007particle, 12197 author = {Meyer, M. and Nelson, B. and Kirby, R. and Whitaker, R.}, 12198 date-added = {2010-08-19 15:41:33 -0500}, 12199 date-modified = {2010-08-19 15:41:33 -0500}, 12200 journal = {IEEE Transactions on Visualization and Computer Graphics}, 12201 pages = {1015--1026}, 12202 publisher = {Published by the IEEE Computer Society}, 12203 title = {Particle systems for efficient and accurate high-order finite element 12204 visualization}, 12205 year = {2007} 12206} 12207 12208@Conference{ rumpf2001nonlinear, 12209 author = {Rumpf, M. and Strzodka, R.}, 12210 booktitle = {Data Visualization 2001: proceedings of the Joint Eurographics-IEEE TCVG 12211 Symposium on Visualization in Ascona, Switzerland, May 28-30, 2001}, 12212 date-added = {2010-08-19 15:41:29 -0500}, 12213 date-modified = {2010-08-19 15:41:29 -0500}, 12214 organization = {Springer Verlag Wien}, 12215 pages = {75}, 12216 title = {Nonlinear diffusion in graphics hardware}, 12217 year = {2001} 12218} 12219 12220@Article{ georgii2005interactive, 12221 author = {Georgii, J. and Echtler, F. and Westermann, R.}, 12222 date-added = {2010-08-19 15:41:28 -0500}, 12223 date-modified = {2010-08-19 15:41:28 -0500}, 12224 journal = {Simulation and Visualisation}, 12225 pages = {247--258}, 12226 publisher = {Citeseer}, 12227 title = {Interactive simulation of deformable bodies on {GPU}s}, 12228 volume = {2005}, 12229 year = {2005} 12230} 12231 12232@Article{ harish2007accelerating, 12233 author = {Harish, P. and Narayanan, P.}, 12234 date-added = {2010-08-19 15:41:27 -0500}, 12235 date-modified = {2010-08-19 15:41:27 -0500}, 12236 journal = {High Performance Computing--HiPC 2007}, 12237 pages = {197--208}, 12238 publisher = {Springer}, 12239 title = {Accelerating large graph algorithms on the {GPU} using CUDA}, 12240 year = {2007} 12241} 12242 12243@Article{ keunings1995parallel, 12244 author = {Keunings, R.}, 12245 date-added = {2010-08-19 15:41:19 -0500}, 12246 date-modified = {2010-08-19 15:41:19 -0500}, 12247 journal = {Computers and Chemical Engineering}, 12248 number = {6}, 12249 pages = {647--670}, 12250 publisher = {Oxford; New York: Pergamon Press, 1977-}, 12251 title = {Parallel finite element algorithms applied to computational rheology}, 12252 volume = {19}, 12253 year = {1995} 12254} 12255 12256@Conference{ taylor2007real, 12257 author = {Taylor, Z.A. and Cheng, M. and Ourselin, S.}, 12258 booktitle = {Proceedings of the 10th international conference on Medical image computing and 12259 computer-assisted intervention-Volume Part I}, 12260 date-added = {2010-08-19 15:41:17 -0500}, 12261 date-modified = {2010-08-19 15:41:17 -0500}, 12262 organization = {Springer-Verlag}, 12263 pages = {701--708}, 12264 title = {Real-time nonlinear finite element analysis for surgical simulation using 12265 graphics processing units}, 12266 year = {2007} 12267} 12268 12269@Article{ liu2000finite, 12270 author = {Liu, R. and Li, DY}, 12271 date-added = {2010-08-19 15:41:16 -0500}, 12272 date-modified = {2010-08-19 15:41:16 -0500}, 12273 journal = {Materials Science and Engineering A}, 12274 number = {1-2}, 12275 pages = {169--175}, 12276 publisher = {Elsevier}, 12277 title = {A finite element model study on wear resistance of pseudoelastic {TiNi} alloy}, 12278 volume = {277}, 12279 year = {2000} 12280} 12281 12282@Conference{ kakadiaris1994active, 12283 author = {Kakadiaris, I.A. and Metaxas, D. and Bajcsy, R.}, 12284 booktitle = {IEEE Computer Society Conference on Computer Vision and Pattern Recognition}, 12285 date-added = {2010-08-19 15:41:15 -0500}, 12286 date-modified = {2010-08-19 15:41:15 -0500}, 12287 organization = {Citeseer}, 12288 pages = {980--980}, 12289 title = {Active part-decomposition, shape, and motion estimation of articulated objects: A 12290 physics-based approach}, 12291 year = {1994} 12292} 12293 12294@Conference{ de2004gpu, 12295 author = {De Pascale, M. and De Pascale, G. and Prattichizzo, D. and Barbagli, F.}, 12296 booktitle = {Proceedings of Eurohaptics}, 12297 date-added = {2010-08-19 15:41:14 -0500}, 12298 date-modified = {2010-08-19 15:41:14 -0500}, 12299 organization = {Citeseer}, 12300 pages = {44--51}, 12301 title = {A {GPU}-friendly method for haptic and graphic rendering of deformable objects}, 12302 volume = {2004}, 12303 year = {2004} 12304} 12305 12306@Book{ taflove1995computational, 12307 author = {Taflove, A. and Hagness, S.C.}, 12308 date-added = {2010-08-19 15:41:14 -0500}, 12309 date-modified = {2010-08-19 15:41:14 -0500}, 12310 publisher = {Artech House Norwood, MA}, 12311 title = {Computational electrodynamics}, 12312 year = {1995} 12313} 12314 12315@Conference{ galoppo2005lu, 12316 author = {Galoppo, N. and Govindaraju, N.K. and Henson, M. and Manocha, D.}, 12317 booktitle = {Proceedings of the 2005 ACM/IEEE conference on Supercomputing}, 12318 date-added = {2010-08-19 15:41:13 -0500}, 12319 date-modified = {2010-08-19 15:41:13 -0500}, 12320 organization = {IEEE Computer Society}, 12321 pages = {3}, 12322 title = {{LU-GPU}: Efficient algorithms for solving dense linear systems on graphics 12323 hardware}, 12324 year = {2005} 12325} 12326 12327@Conference{ ryoo2008optimization, 12328 author = {Ryoo, S. and Rodrigues, C.I. and Baghsorkhi, S.S. and Stone, S.S. and Kirk, D.B. 12329 and Hwu, W.W.}, 12330 booktitle = {Proceedings of the 13th ACM SIGPLAN Symposium on Principles and practice of 12331 parallel programming}, 12332 date-added = {2010-08-19 15:41:12 -0500}, 12333 date-modified = {2010-08-19 15:41:12 -0500}, 12334 organization = {ACM}, 12335 pages = {73--82}, 12336 title = {Optimization principles and application performance evaluation of a multithreaded 12337 {GPU} using CUDA}, 12338 year = {2008} 12339} 12340 12341@Conference{ micikevicius20093d, 12342 author = {Micikevicius, P.}, 12343 booktitle = {Proceedings of 2nd Workshop on General Purpose Processing on Graphics Processing 12344 Units}, 12345 date-added = {2010-08-19 15:41:11 -0500}, 12346 date-modified = {2010-08-19 15:41:11 -0500}, 12347 organization = {ACM}, 12348 pages = {79--84}, 12349 title = {3D finite difference computation on {GPU}s using {CUDA}}, 12350 year = {2009} 12351} 12352 12353@Conference{ zhou2004pixel, 12354 author = {Zhou, Y. and Garland, M. and Haber, R.}, 12355 booktitle = {IEEE Visualization, 2004}, 12356 date-added = {2010-08-19 15:41:03 -0500}, 12357 date-modified = {2010-08-19 15:41:03 -0500}, 12358 pages = {425--432}, 12359 title = {Pixel-exact rendering of spacetime finite element solutions}, 12360 year = {2004} 12361} 12362 12363@Article{ komatitsch2009porting, 12364 author = {Komatitsch, D. and Mich{\'e}a, D. and Erlebacher, G.}, 12365 date-added = {2010-08-19 15:41:01 -0500}, 12366 date-modified = {2010-08-19 15:41:01 -0500}, 12367 journal = {Journal of Parallel and Distributed Computing}, 12368 number = {5}, 12369 pages = {451--460}, 12370 publisher = {Elsevier}, 12371 title = {Porting a high-order finite-element earthquake modeling application to NVIDIA 12372 graphics cards using CUDA}, 12373 volume = {69}, 12374 year = {2009} 12375} 12376 12377@Article{ komatitsch1998spectral, 12378 author = {Komatitsch, D. and Vilotte, J.P.}, 12379 date-added = {2010-08-19 15:40:59 -0500}, 12380 date-modified = {2010-08-19 15:40:59 -0500}, 12381 journal = {Bulletin of the Seismological Society of America}, 12382 number = {2}, 12383 pages = {368--392}, 12384 publisher = {[El Cerrito, Calif., etc., Seismological Society of America, etc.]}, 12385 title = {The spectral element method: {A}n efficient tool to simulate the seismic response 12386 of 2D and 3D geological structures}, 12387 volume = {88}, 12388 year = {1998} 12389} 12390 12391@Article{ wu2005improved, 12392 author = {Wu, W. and Heng, P.A.}, 12393 date-added = {2010-08-19 15:40:59 -0500}, 12394 date-modified = {2010-08-19 15:40:59 -0500}, 12395 journal = {The Visual Computer}, 12396 number = {8}, 12397 pages = {707--716}, 12398 publisher = {Springer}, 12399 title = {An improved scheme of an interactive finite element model for 3D soft-tissue 12400 cutting and deformation}, 12401 volume = {21}, 12402 year = {2005} 12403} 12404 12405@Article{ taylor2008high, 12406 author = {Taylor, Z.A. and Cheng, M. and Ourselin, S.}, 12407 date-added = {2010-08-19 15:40:57 -0500}, 12408 date-modified = {2010-08-19 15:40:57 -0500}, 12409 journal = {IEEE transactions on medical imaging}, 12410 number = {5}, 12411 pages = {650}, 12412 title = {High-speed nonlinear finite element analysis for surgical simulation using 12413 graphics processing units.}, 12414 volume = {27}, 12415 year = {2008} 12416} 12417 12418@Conference{ bolz2003sparse, 12419 author = {Bolz, J. and Farmer, I. and Grinspun, E. and Schr{\\"o}oder, P.}, 12420 booktitle = {ACM SIGGRAPH 2003 Papers}, 12421 date-added = {2010-08-19 15:40:55 -0500}, 12422 date-modified = {2010-08-19 15:40:55 -0500}, 12423 organization = {ACM}, 12424 pages = {924}, 12425 title = {Sparse matrix solvers on the {GPU}: conjugate gradients and multigrid}, 12426 year = {2003} 12427} 12428 12429@Article{ wu2004hybrid, 12430 author = {Wu, W. and Heng, P.A.}, 12431 date-added = {2010-08-19 15:40:54 -0500}, 12432 date-modified = {2010-08-19 15:40:54 -0500}, 12433 journal = {Computer Animation and Virtual Worlds}, 12434 number = {3-4}, 12435 pages = {219--227}, 12436 publisher = {John Wiley \& Sons}, 12437 title = {A hybrid condensed finite element model with {GPU} acceleration for interactive 12438 3D soft tissue cutting}, 12439 volume = {15}, 12440 year = {2004} 12441} 12442 12443% ---------------------------------------------------------------------------------------------------------------- 12444@TechReport{ davis97, 12445 author = {T. Davis}, 12446 title = {The {U}niversity of {F}lorida Sparse Matrix Collection}, 12447 institution = {University of Florida}, 12448 year = {1997} 12449} 12450 12451@Article{ davis2011, 12452 author = {Davis, T. A. and Hu, Y.}, 12453 title = {The {U}niversity of {F}lorida sparse matrix collection}, 12454 journal = {ACM Transactions on Mathematical Software}, 12455 volume = {38}, 12456 issue = {1}, 12457 year = {2011}, 12458 pages = {1--25} 12459} 12460 12461@Article{ davis2004algorithm, 12462 title = {Algorithm 832: {UMFPACK} V4.3---An Unsymmetric-Pattern Multifrontal Method}, 12463 author = {Davis, Timothy A}, 12464 journal = {ACM Transactions on Mathematical Software}, 12465 volume = {30}, 12466 number = {2}, 12467 pages = {196--199}, 12468 year = {2004}, 12469 publisher = {ACM} 12470} 12471 12472@TechReport{ streams, 12473 author = {J. D. McCalpin}, 12474 title = {{STREAM}: Sustainable memory bandwidth in high performance computers}, 12475 institution = {University of Virginia}, 12476 url = {http://www.cs.virginia.edu/stream}, 12477 year = {1995} 12478} 12479 12480@Article{ areusken_1988b, 12481 author = {A. Reusken}, 12482 title = {Convergence of the multigrid full approximation scheme for a class of elliptic 12483 mildly nonlinear boundary value problems}, 12484 journal = {Numer. Math.}, 12485 volume = {52}, 12486 year = {1988}, 12487 pages = {251--277} 12488} 12489 12490@Article{ areusken_1988c, 12491 author = {A. Reusken}, 12492 title = {Convergence of the multigrid full approximation scheme including the {V}--cycle}, 12493 journal = {Numer. Math.}, 12494 volume = {53}, 12495 year = {1988}, 12496 pages = {663--686} 12497} 12498 12499@Unpublished{ mgnet, 12500 title = {Multigrid Net; http://www.mgnet.org/}, 12501 author = {Craig Douglas}, 12502 note = {Contains enormous bibliography on multigrid publications}, 12503 year = {2009} 12504} 12505 12506@Unpublished{ copper, 12507 title = {Fourteenth Copper Mountain Conference on Multigrid Methods}, 12508 author = {}, 12509 note = {Held bi-annually}, 12510 year = {2009} 12511} 12512 12513@Book{ wessling1992, 12514 author = {Pieter Wesseling}, 12515 title = {An Introduction to Multigrid Methods}, 12516 year = {2004}, 12517 publisher = {R. T. Edwards} 12518} 12519 12520@Book{ bhm2000, 12521 author = {William L. Briggs and Van Emden Henson and Steve F. McCormick}, 12522 title = {A Multigrid Tutorial}, 12523 year = {2000}, 12524 publisher = {SIAM} 12525} 12526 12527@Book{ trottenberg2001multigrid, 12528 title = {{Multigrid}}, 12529 author = {Trottenberg, U. and Oosterlee, C.W. and Sch{\"u}ller, A.}, 12530 isbn = {012701070X}, 12531 year = {2001}, 12532 publisher = {Academic Press} 12533} 12534 12535@TechReport{ brandt1984, 12536 author = {Achi Brandt}, 12537 title = {Multigrid Techniques: 1984 Guide with Applications for Fluid Dynamics}, 12538 institution = {Gesellschaft fur Mathematik und Dataenverarbeitung}, 12539 number = {GMD-Studien Nr. 85}, 12540 year = {1984} 12541} 12542 12543@Article{ yavneh1998coarse, 12544 title = {Coarse-Grid Correction for Nonelliptic and Singular Perturbation Problems}, 12545 author = {Yavneh, I.}, 12546 journal = {SIAM Journal on Scientific Computing}, 12547 volume = {19}, 12548 number = {5}, 12549 pages = {1682--1699}, 12550 year = {1998}, 12551 publisher = {Society for Industrial and Applied Mathematics} 12552} 12553 12554@Article{ wan2003phase, 12555 title = {A Phase Error Analysis of Multigrid Methods for Hyperbolic Equations}, 12556 author = {Wan, WL and Chan, T.F.}, 12557 journal = {SIAM Journal on Scientific Computing}, 12558 volume = {25}, 12559 pages = {857}, 12560 year = {2003} 12561} 12562 12563@Article{ imex, 12564 author = {Uri M. Ascher and Steven J. Ruuth and Brian T. R. Wetton}, 12565 title = {Implicit-Explicit Methods for Time-Dependent Partial Differential Equations}, 12566 journal = {SIAM Journel on Numerical Analysis}, 12567 volume = {32}, 12568 number = {3}, 12569 pages = {797--823}, 12570 year = {1995} 12571} 12572 12573@Article{ ow1, 12574 author = {T. Washio and C. W. Oosterlee}, 12575 title = {Krylov Subspace Acceleration for Nonlinear Multigrid Schemes with Application to 12576 Recirculating Flow}, 12577 journal = {SIAM Journal on Scientific Computing}, 12578 volume = {21}, 12579 number = {5}, 12580 pages = {1670--1690}, 12581 year = {2000} 12582} 12583 12584@Article{ vm1, 12585 author = {V. A. Mousseau}, 12586 title = {Implicitly Balanced Solution of the Two-Phase Flow Equations Coupled to Nonlinear 12587 Heat Conduction}, 12588 journal = {Journal Of Computational Physics}, 12589 volume = {200}, 12590 pages = {104--132}, 12591 year = {2004} 12592} 12593 12594@Article{ vm2, 12595 author = {V. A. Mousseau}, 12596 title = {A Fully Implicit Hybrid Solution Method for a Two-Phase Thermal-Hydraulic Model}, 12597 journal = {Journal Of Heat Transfer}, 12598 volume = {127}, 12599 pages = {531--539}, 12600 year = {2005} 12601} 12602 12603@Misc{ salome1, 12604 author = {Laurent Dada and Daniel Caruge}, 12605 title = {The {SALOME} Open Source {CAE} Platform Application to Reactor Physics 12606 Simulation}, 12607 year = {2005}, 12608 url = {http://conferences.esa.int/05c26/Seminar-2005-09-28-SALOME.pdf}, 12609 note = {Presentation at an ESA/ESTEC conference} 12610} 12611 12612@InProceedings{ downar1, 12613 author = {D. A. Barber and W. Wang and R. M. Miller and T. J. Downar and H. G. Joe and V. 12614 A. Mousseau and D. E. Ebert}, 12615 title = {Application of a generalized interface module to the coupling of {PARCS} with 12616 both {RELAP5} and {TRAC-M}}, 12617 booktitle = {Proceedings of 1999 annual meeting of the American Nuclear Society}, 12618 year = {1999} 12619} 12620 12621@Article{ lopez1, 12622 author = {A. P. Lopez and J. B. Sandova}, 12623 title = {A methodology for the coupling of {RAMONA-3B} neutron kinetics and {TRAC-BF1} 12624 thermal-hydraulics}, 12625 journal = {Annals of Nuclear Energy}, 12626 volume = {32(6)}, 12627 pages = {621--634}, 12628 year = {2005} 12629} 12630 12631@InProceedings{ og-1996, 12632 author = {C. R. E. de Oliveira and A. J. H. Goddard}, 12633 title = {{EVENT}: A Multidimensional Finite Element-Spherical Harmonics Radiation 12634 Transport Code}, 12635 booktitle = {Proceedings of the OECD International Seminar on 3D Deterministic Radiation 12636 Transport Codes}, 12637 editor = {}, 12638 publisher = {}, 12639 pages = {}, 12640 note = {Paris, France}, 12641 month = dec, 12642 year = {1996} 12643} 12644 12645@Article{ wo-2000, 12646 author = {P. Warner and C. R. E. de Oliveira}, 12647 title = {Verification and Validation of the 3D Finite Element Transport Theory Code 12648 {EVENT} for Shielding Applications}, 12649 journal = {J. Nucl. Sci. and Tech.}, 12650 volume = {Supplement 1}, 12651 pages = {466--470}, 12652 year = {2000} 12653} 12654 12655@Unpublished{ gnep-web, 12656 author = {{U.S. Department of Energy}}, 12657 title = {Global Nuclear Energy Partnership ({GNEP})}, 12658 note = {\url{ http://www.gnep.energy.gov}}, 12659 year = {2007} 12660} 12661 12662@Book{ lewis-miller-1984, 12663 author = {E. E. Lewis and W. F. Miller, Jr.}, 12664 title = {Computational Methods of Neutron Transport}, 12665 address = {}, 12666 publisher = {Wiley}, 12667 year = {1984} 12668} 12669 12670@Article{ couple1, 12671 author = {J. M. Cook and D. Okrent and D. Satkus and R. B. Lazarus and M. B. Wells}, 12672 title = {{AX-1}, A COMPUTING PROGRAM FOR COUPLED NEUTRONICS-HYDRODYNAMICS CALCULATIONS ON 12673 THE {IBM-704}}, 12674 journal = {Nuclear Sci. and Eng.}, 12675 year = {1959}, 12676 pages = {113--115}, 12677 volume = {2(1)} 12678} 12679 12680@InProceedings{ weber1, 12681 author = {D. P. Weber and S. S. Chen and C. Y. Wang and T. Y. C. Wei and S. Jansson}, 12682 title = {Coupled {CFD/CSM} vibration design methodology for generation {IV} long-life fuel 12683 and component design}, 12684 booktitle = {4th International Conference on Supercomputing in Nuclear Applications}, 12685 year = {2000} 12686} 12687 12688@Misc{ gnep:report, 12689 author = {Phillip Finck and David Keyes and Rick Stevens}, 12690 title = {{Report on the {DOE} Joint {NE/SC} Workshop Simulation and Modeling for Advanced 12691 Nuclear Energy Systems}}, 12692 year = {2006} 12693} 12694 12695@Misc{ subsurface-workshop-ref, 12696 author = {D. {Zachman (Chair)}}, 12697 title = {{Computational Subsurface Sciences Workshop}}, 12698 note = {January 9--12, 2007, Bethesda, MD, see \url{http://subsurface2007.labworks.org/}} 12699} 12700 12701@Misc{ fusion:report, 12702 title = {{Report of the Fusion Energy Sciences Advisory Committee Burning Plasma Strategy 12703 Panel}}, 12704 author = {{Fusion Energy Sciences Advisory Committee}}, 12705 year = {2002}, 12706 note = {see \url{http://www.ofes.fusion.doe.gov/More_HTML/FESAC/Austinfinal.pdf}} 12707} 12708 12709@Misc{ hecrtf:report, 12710 title = {{Report of the High End Computing Revitalization Task Force (HECRTF)}}, 12711 key = {HECRTF}, 12712 year = {2004}, 12713 howpublished = {see \url{http://www.ostp.gov/nstc/html/HECRTF-FINAL_051004.pdf}} 12714} 12715 12716@Misc{ doesc20years, 12717 title = {{Facilities for the Future of Science: A Twenty-Year Outlook}}, 12718 key = {Office of Science, U.S. Department of Energy}, 12719 year = {2003}, 12720 howpublished = {Office of Science, U.S. Department of Energy, see 12721 \url{http://www.sc.doe.gov/Scientific_User_Facilities/History/20-Year-Outlook-screen.pdf}} 12722} 12723 12724@PhDThesis{ karpeev-thesis, 12725 author = {D. A. Karpeyev}, 12726 title = {Geometric Integrators for Hamiltonian PDEs}, 12727 school = {Old Dominion University}, 12728 year = {2002} 12729} 12730 12731@InCollection{ fjp:ima, 12732 author = {Lori Freitag and Mark Jones and Paul Plassmann}, 12733 title = {The Scalability of Mesh Improvement Algorithms}, 12734 booktitle = {Algorithms for Parallel Processing}, 12735 publisher = {Springer-Verlag}, 12736 volume = {105}, 12737 series = {The IMA Volumes in Mathematics and Its Applications}, 12738 editor = {Michael T.\ Heath and Abhiram Ranade and Robert S.\ Schreiber}, 12739 year = {1998}, 12740 pages = {185--212} 12741} 12742 12743@InProceedings{ poet, 12744 author = {Rob Armstrong and Alex Cheung}, 12745 title = {{POET} ({P}arallel {O}bject-Oriented {E}nvironment and {T}oolkit) and Frameworks 12746 for Scientific Distributed Computing}, 12747 booktitle = {Proceedings of {HICSS97}}, 12748 year = {1997} 12749} 12750 12751@Misc{ pseware-web-page, 12752 author = {}, 12753 title = {{PSEware} {Web} page}, 12754 note = {\url{http://www.extreme.indiana.edu/pseware}, Indiana University}, 12755 key = {{PSEware} {Web} page} 12756} 12757 12758@Article{ epperly2011high, 12759 title = {High-performance language interoperability for scientific computing through 12760 {B}abel}, 12761 author = {Epperly, Thomas GW and Kumfert, Gary and Dahlgren, Tamara and Ebner, Dietmar and 12762 Leek, Jim and Prantl, Adrian and Kohn, Scott}, 12763 journal = {International Journal of High Performance Computing Applications}, 12764 pages = {1094342011414036}, 12765 year = {2011}, 12766 publisher = {SAGE Publications} 12767} 12768 12769@Misc{ babel-web-page, 12770 author = {Tom Epperly and Tamara Dahlgren and Gary Kumfert}, 12771 title = {{Babel} {Web} page}, 12772 note = {\url{http://www.llnl.gov/CASC/components/babel.html}} 12773} 12774 12775@Misc{ infospheres-web-page, 12776 author = {K.~M. {Chandy et al.}}, 12777 title = {{Infospheres} {W}eb page}, 12778 note = {\url{http://www.infospheres.caltech.edu}}, 12779 key = {{Infospheres} {Web} page} 12780} 12781 12782@Misc{ hammond, 12783 author = {Glenn Hammond}, 12784 title = {{Sandia National Laboratory}, {C}omputations on {R}eactive {F}low, private 12785 communication} 12786} 12787 12788@Misc{ ornl, 12789 author = {Oak Ridge National Laboratory}, 12790 title = {Private communication via petsc-maint email support} 12791} 12792 12793@Unpublished{ cumulvs-web-page, 12794 author = {}, 12795 title = {{Cumulvs} {W}eb page}, 12796 note = {http://www.epm.ornl.gov/cs/cumulvs.html}, 12797 key = {{Cumulvs} {W}eb page} 12798} 12799 12800@Article{ nonlineargmres, 12801 author = {T. Washio and C. W. Oosterlee}, 12802 title = {Krylov Subspace Acceleration for Nonlinear Multigrid Schemes}, 12803 journal = {ETNA}, 12804 year = {1997}, 12805 pages = {271--290}, 12806 volume = {6} 12807} 12808 12809@Article{ pcice, 12810 author = {Richard C. Martineau and Ray A. Berry}, 12811 title = {The pressure-corrected ICE finite element method for compressible flows on 12812 unstructured meshes}, 12813 journal = {Journal of Computational Physics}, 12814 year = {2004}, 12815 pages = {659--685}, 12816 volume = {198(2)} 12817} 12818 12819@Article{ cumulvs97, 12820 author = {G. A. Geist and J. A. Kohl and P. M. Papadopoulos}, 12821 title = {{CUMULVS}: Providing Fault-Tolerance, Visualization, and Steering of Parallel 12822 Applications}, 12823 journal = {International Journal of Supercomputing Applications}, 12824 year = {1997} 12825} 12826 12827@TechReport{ daly2012interagency, 12828 author = {John Daly and Bill Harrod and Thuc Hoang and Lucy Nowell and Bob Adolf and 12829 Shekhar Borkar and Nathan DeBardeleben and Mootaz Elnozahy and Mike Heroux and 12830 David Rogers and Rob Ross and Vivek Sarkar and Martin Schulz and Marc Snir and 12831 Paul Woodward}, 12832 title = {Inter-Agency Workshop on HPC Resilience at Extreme Scale}, 12833 year = {2012}, 12834 publisher = {US Department of Defense} 12835} 12836 12837@Article{ karpeev1, 12838 author = {A. L. Islas and D. A. Karpeev and C. M. Schober}, 12839 title = {Geometric Integrators for the Nonlinear Schr\"odinger Equation}, 12840 journal = {J. Comp. Phys.}, 12841 year = {2001}, 12842 pages = {116--148}, 12843 volume = {173} 12844} 12845 12846@InProceedings{ scirun97, 12847 author = {S. G. Parker and D. W. Weinstein and C. R. Johnson}, 12848 title = {The {SCIRun} Computational Steering System}, 12849 booktitle = {Modern Software Tools in Scientific Computing}, 12850 editor = {E. Arge and A. M. Bruaset and H. P. Langtangen}, 12851 publisher = {Birkhauser Press}, 12852 year = {1997} 12853} 12854 12855@TechReport{ szyld, 12856 author = {Valeria Simoncini and Daniel B. Szyld}, 12857 title = { Theory of Inexact Krylov Subspace Methods and Applications to Scientific 12858 Computing}, 12859 year = {2002}, 12860 institution = {Department of Mathematics, Temple University}, 12861 number = {02-4-12} 12862} 12863 12864@TechReport{ pdelab, 12865 author = {S. Weerawarana and E. N. Houstis and J. R. Rice and A. C. Catlin and C. Crabill 12866 and C. C. Chui and S. Markus}, 12867 title = {{PDELab}: An Object-Oriented Framework for Building Problem Solving Environments 12868 for {PDE} Based Applications}, 12869 year = {1994}, 12870 institution = {Department of Computer Sciences, Purdue University}, 12871 number = {CSD-TR-94-021} 12872} 12873 12874@Unpublished{ ilu-web-page, 12875 author = {Bill Janssen and Mike Spreitzer and Dan Larner and Chris Jacobi}, 12876 title = {{I}nter-{L}anguage {U}nification Reference Manual}, 12877 note = {ftp://ftp.parc.xerox.com/ilu/ilu.html, Xerox Corporation} 12878} 12879 12880@Unpublished{ doe2k-web-page, 12881 title = {{DOE2000 Initiative} {W}eb page}, 12882 note = {http://www.mcs.anl.gov/DOE2000}, 12883 key = {DOE2000 Initiative} 12884} 12885 12886@Misc{ pvode-web-page, 12887 title = {{PVODE} {W}eb Page}, 12888 note = {\url{http://www.llnl.gov/CASC/PVODE}, Lawrence Livermore National Laboratory}, 12889 author = {A. {Hindmarsh et al.}} 12890} 12891 12892@Book{ szyperski97, 12893 author = {Clemens Szyperski}, 12894 title = {Component Software: Beyond Object-Oriented Programming}, 12895 publisher = {ACM Press}, 12896 address = {New York}, 12897 year = {1997} 12898} 12899 12900@Unpublished{ petsc:coloringuse, 12901 title = {Code for computing sparse {J}acobians}, 12902 note = {\url{http://www.mcs.anl.gov/petsc/miscellaneous/external.html}}, 12903 institution = {Argonne National Laboratory} 12904} 12905 12906@Unpublished{ petsc:external, 12907 author = {B. F. {Smith et al.}}, 12908 title = {{External Software Used by PETSc}}, 12909 note = {\url{http://www.mcs.anl.gov/petsc/miscellaneous/external.html}}, 12910 institution = {Argonne National Laboratory} 12911} 12912 12913@Unpublished{ petsc:use-by-external-packages, 12914 author = {B. F. {Smith et al.}}, 12915 title = {{Software Packages that Use or Interface to PETSc}}, 12916 note = {\url{http://www.mcs.anl.gov/petsc/publications/petscapps.html#packages}}, 12917 institution = {Argonne National Laboratory} 12918} 12919 12920@Unpublished{ petsc:prizes, 12921 author = {B. F. {Smith et al.}}, 12922 title = {{Prizes Won Using PETSc}}, 12923 note = {\url{http://www.mcs.anl.gov/petsc/publications/prizes.html}}, 12924 institution = {Argonne National Laboratory} 12925} 12926 12927@Unpublished{ petsc:csgf, 12928 author = {B. F. {Smith et al.}}, 12929 title = {{DOE Computational Science Graduate Fellowship (CSGF) Users of PETSc}}, 12930 note = {\url{http://www.mcs.anl.gov/petsc/publications/prizes.html}}, 12931 institution = {Argonne National Laboratory} 12932} 12933 12934@Unpublished{ flash-web-page, 12935 title = {{U}niversity of {C}hicago {C}enter on {A}strophysical {T}hermonuclear {F}lashes 12936 {W}eb Page}, 12937 note = {http://www.asci.uchicago.edu}, 12938 author = {R. {Rosner et al.}}, 12939 institution = {University of Chicago} 12940} 12941 12942@Unpublished{ esi-web-page, 12943 title = {{E}quation {S}olver {I}nterface {F}orum {W}eb Page}, 12944 note = {http://z.ca.sandia.gov/esi}, 12945 author = {R. {Clay et al.}} 12946} 12947 12948@Unpublished{ infobus-web-page, 12949 title = {{I}nfo{B}us {W}eb Page}, 12950 note = {http://www.java.sun.com/beans/infobus}, 12951 key = {infobus} 12952} 12953 12954@Unpublished{ xray-web-page, 12955 title = {{S}upercomputer {S}olution of {M}assive {C}rystallographic and {M}icrotomographic 12956 {S}tructural {P}roblems {W}eb Page ({DOE} Grand Challenge Project)}, 12957 note = {http://www.mcs.anl.gov/xray/}, 12958 institution = {Argonne National Laboratory} 12959} 12960 12961@InProceedings{ kohn98, 12962 author = {Andrew Cleary and Scott Kohn and Steven Smith and Brent Smolinski}, 12963 title = {Language Interoperability Mechanisms for High-Performance Scientific 12964 Applications}, 12965 publisher = {SIAM}, 12966 booktitle = {Proceedings of the SIAM Workshop on Object Oriented Methods for Inter-operable 12967 Scientific and Engineering Computing}, 12968 year = {1999}, 12969 pages = {30-39} 12970} 12971 12972@InProceedings{ kohn01, 12973 author = {Scott Kohn and Gary Kumfert and Jeff Painter and Cal Ribbens}, 12974 title = {Divorcing Language Dependencies from a Scientific Software Library}, 12975 publisher = {SIAM}, 12976 booktitle = {Proceedings of the Tenth SIAM Conference on Parallel Processing}, 12977 year = {2001} 12978} 12979 12980@InProceedings{ freitag_jones_plassmann98, 12981 author = {Lori Freitag and Mark Jones and Paul Plassmann}, 12982 title = {Component Integration for Unstructured Mesh Algorithms and Software}, 12983 publisher = {SIAM}, 12984 booktitle = {Proceedings of the SIAM Workshop on Object Oriented Methods for Inter-operable 12985 Scientific and Engineering Computing}, 12986 year = {1999}, 12987 pages = {215-224} 12988} 12989 12990@Book{ templates, 12991 author = {R. Barrett and M. Berry and T. F. Chan and J. Demmel and J. Donato and J. 12992 Dongarra and V. Eijkhout and R. Pozo and C. Romine and H. Van der Vorst }, 12993 title = {Templates for the Solution of Linear Systems: Building Blocks for Iterative 12994 Methods}, 12995 publisher = {SIAM}, 12996 year = {1994}, 12997 address = {Philadelphia, PA} 12998} 12999 13000@InProceedings{ parasha2, 13001 author = {M. Parashar and J. C. Browne and C. Edwards and K. Klimkowski}, 13002 title = { A Common Data Management Infrastructure for Parallel Adaptive Algorithms for 13003 {PDE} Solutions}, 13004 booktitle = {SC97 Proceedings}, 13005 publisher = {IEEE Computer Society Press}, 13006 year = {1997} 13007} 13008 13009@TechReport{ parasha, 13010 author = {M. Parashar and J. C. Browne}, 13011 title = {{DAGH}: A Data-Management Infrastructure for Parallel Adaptive Mesh Refinement 13012 Techniques}, 13013 institution = {Department of Computer Science, University of Texas at Austin}, 13014 year = {1995} 13015} 13016 13017@Article{ parti, 13018 author = {R. Das and M. Uysal and J. Saltz and Y. S. Hwang}, 13019 title = {Communication Optimizations for Irregular Scientific Computations on Distributed 13020 Memory Architectures}, 13021 journal = {Journal of Parallel and Distributed Computing}, 13022 year = {1994}, 13023 volume = {22}, 13024 pages = {462--478} 13025} 13026 13027@Article{ mparti, 13028 author = {G. Agrawal and A. Sussman and J. Saltz}, 13029 title = {An Integrated Runtime and Compile-time Approach for Parallelizing Structured and 13030 Block Structured Applications}, 13031 journal = {IEEE Trans. on Parallel and Distributed Systems}, 13032 volume = {6}, 13033 number = {7}, 13034 year = {1995} 13035} 13036 13037@Article{ gropp-lusk-doss-skjellum, 13038 author = { William Gropp and Ewing Lusk and Nathan Doss and Anthony Skjellum}, 13039 title = {A high-performance, portable implementation of the {MPI} Message Passing 13040 Interface standard}, 13041 journal = {Parallel Computing}, 13042 year = {1996}, 13043 volume = {22}, 13044 pages = {789--828} 13045} 13046 13047@InProceedings{ lam, 13048 author = {Greg Burns and Raja Daoud and James Vaigl}, 13049 title = {{LAM}: An Open Cluster Environment for {MPI}}, 13050 booktitle = {Proceedings of Supercomputing Symposium '94}, 13051 editor = {John W. Ross}, 13052 publisher = {University of Toronto}, 13053 pages = {379--386}, 13054 year = {1994} 13055} 13056 13057@Article{ cs99, 13058 author = {X.-C. Cai and M. Sarkis}, 13059 title = {A restricted additive {S}chwarz preconditioner for general sparse linear 13060 systems}, 13061 journal = {SIAM J. Scientific Computing}, 13062 year = {1999}, 13063 volume = {21}, 13064 pages = {792-797} 13065} 13066 13067@Article{ cai2003restricted, 13068 title = {Restricted additive {S}chwarz preconditioners with harmonic overlap for symmetric 13069 positive definite linear systems}, 13070 author = {Cai, X.C. and Dryja, M. and Sarkis, M.}, 13071 journal = {SIAM Journal on Numerical Analysis}, 13072 volume = {41}, 13073 issue = {1}, 13074 pages = {1209--1231}, 13075 year = {2003}, 13076 doi = {10.1137/S0036142901389621} 13077} 13078 13079@TechReport{ caisaad, 13080 author = {Xiao-Chuan Cai and Youcef Saad}, 13081 title = {Overlapping domain decomposition algorithms for general sparse matrices}, 13082 institution = {Army High Performance Computing Research Center, University of Minnesota }, 13083 year = {1993}, 13084 number = {Preprint 93-027 }, 13085 note = {SIAM J. Sci. Comp. (submitted)} 13086} 13087 13088@Book{ ruminations, 13089 author = {Andrew Koenig and Barbara Moo}, 13090 title = {Ruminations on C++}, 13091 year = {1996}, 13092 publisher = {Addison-Wesley} 13093} 13094 13095@Book{ mpi-complete, 13096 author = {Marc Snir and Steve Otto and Steven Huss-Lederman and David Walker and Jack 13097 Dongarra}, 13098 title = {{MPI}: The Complete Reference}, 13099 year = {1995}, 13100 publisher = {MIT Press} 13101} 13102 13103@Unpublished{ tcl-tk-web-page, 13104 title = {{Tcl/Tk} {W}orld {W}ide {W}eb page}, 13105 note = {http://www.sunlabs.com/research/tcl/}, 13106 year = {1996}, 13107 month = aug 13108} 13109 13110@Misc{ mpich-web-page, 13111 author = {William Gropp and {et. al.}}, 13112 title = {{MPICH} {W}eb page}, 13113 key = {MPICH}, 13114 url = {http://www.mpich.org}, 13115 howpublished = {\url{http://www.mpich.org}} 13116} 13117 13118@Article{ mpi-final, 13119 author = {MPI Forum}, 13120 title = {{MPI}: A Message-Passing Interface Standard}, 13121 journal = {International J. Supercomputing Applications}, 13122 volume = {8}, 13123 number = {3/4}, 13124 year = {1994}, 13125 key = {MPI Standard - final} 13126} 13127 13128@Unpublished{ npb-web-page, 13129 key = {NAS Parallel Benchmarks}, 13130 title = {{NAS} {P}arallel {B}enchmarks {W}eb page}, 13131 note = {http://www.nas.nasa.\-gov/\-NAS/\-NPB/\-index.html}, 13132 year = {1996}, 13133 month = dec 13134} 13135 13136@Book{ george81, 13137 title = {Computer Solution of Large Sparse Positive Definite Systems}, 13138 author = {Alan George and Joseph W. Liu}, 13139 publisher = {Prentice-Hall}, 13140 year = {1981}, 13141 key = {SparseDirect} 13142} 13143 13144@Book{ p4-book, 13145 title = {Portable Programs for Parallel Processors}, 13146 publisher = {Holt, Rinehart, {and} Winston}, 13147 year = {1987}, 13148 author = {James Boyle and Ralph Butler and Terrence Disz and Barnett Glickfeld and Ewing 13149 Lusk and Ross Overbeek and James Patterson and Rick Stevens}, 13150 key = {P4Book} 13151} 13152 13153@Article{ stones, 13154 author = {H. L. Stone}, 13155 title = {Iterative solution of implicit approximations of multidimensional partial 13156 differential equations}, 13157 journal = {SIAM J. Numerical Analysis}, 13158 pages = {87--113}, 13159 volumne = {5}, 13160 year = {1968} 13161} 13162 13163@Article{ parallelstones, 13164 author = {J. S. Reeve and A. D. Scurr and J. H. Merlin}, 13165 title = {Parallel versions of {S}tones strongly implicit algorithm}, 13166 journal = {Concurrency and Computation: Practice and Experience}, 13167 pages = {1049--1062}, 13168 volumne = {13}, 13169 year = {2001} 13170} 13171 13172@Article{ p4-paper, 13173 author = {Ralph Butler and Ewing Lusk}, 13174 title = {Monitors, Messages, and Clusters: {T}he p4 Parallel Programming System}, 13175 journal = {Journal of Parallel Computing}, 13176 note = {To appear (Also Argonne National Laboratory Mathematics and Computer Science 13177 Division preprint P362-0493)}, 13178 year = {1993} 13179} 13180 13181@TechReport{ picl, 13182 author = {G.~A.~Geist and Michael~T.~Heath and B.~W.~Peyton and Patrick~H.~Worley}, 13183 title = {{PICL}: A portable instrumented communications library}, 13184 institution = {Oak Ridge National Laboratory}, 13185 number = {TM-11130}, 13186 year = {1990}, 13187 key = {PICL} 13188} 13189 13190@TechReport{ upshot, 13191 author = {Virginia Herrarte and Ewing Lusk}, 13192 title = {Studying Parallel Program Behavior with {U}pshot}, 13193 institution = {Argonne National Laboratory}, 13194 number = {ANL-91/15}, 13195 month = aug, 13196 year = {1991}, 13197 key = {Upshot} 13198} 13199 13200@TechReport{ p4-manual, 13201 author = {Ralph Butler and Ewing Lusk}, 13202 title = {User's Guide to the p4 Parallel Programming System}, 13203 institution = {Argonne National Laboratory}, 13204 number = {ANL-92/17}, 13205 month = oct, 13206 year = {1992}, 13207 key = {p4-Manual} 13208} 13209 13210@InProceedings{ oldparti, 13211 author = {Gagan Agrawal and Alan Sussman and Joel Saltz}, 13212 title = {Compiler and Runtime Support for Unstructured and Block Structured Problems}, 13213 booktitle = {Proceedings of Supercomputing '93}, 13214 pages = {578--587}, 13215 year = {1993} 13216} 13217 13218@Article{ parti2, 13219 author = {S. S. Mukherjee and S. D. Sharma and M. DF. Hill and J. R. Larus and A. Rogers 13220 and J. Saltz}, 13221 title = {Efficient Support for Irregular Applications on Distributed Memory Machines}, 13222 journal = {ACM SIGPLAN Notices}, 13223 year = {1995}, 13224 pages = {68-79}, 13225 volume = {30}, 13226 number = {8} 13227} 13228 13229@Article{ parti3, 13230 author = {J. Saltz and R. Mirchandaney and K. Crowley}, 13231 title = {Run-Time Parallelization and Scheduling of Loops}, 13232 journal = {IEEE Trans. Computers}, 13233 year = {1991}, 13234 pages = {604-612}, 13235 volume = {40}, 13236 number = {5} 13237} 13238 13239@InProceedings{ disz-lusk:wamtrace, 13240 author = {Terrence Disz and Ewing Lusk}, 13241 title = {A Graphical Tool for Observing the Behavior of Parallel Logic Programs}, 13242 booktitle = {Proceedings of the 1987 Symposium on Logic Programming}, 13243 year = {1987}, 13244 pages = {46--53} 13245} 13246 13247@InProceedings{ gorlick-kesselman:gauge, 13248 author = {Michael Gorlick and Carl Kesselman}, 13249 title = {Timing {Prolog} programs without Clocks}, 13250 booktitle = {Proceedings of the 1987 Symposium on Logic Programming}, 13251 year = {1996}, 13252 publisher = {Birkhauser} 13253} 13254 13255@TechReport{ aztec, 13256 author = {Scott A. Hutchinson and John N. Shadid and Ray S. Tuminaro}, 13257 title = {Aztec User's Guide Version 1.1}, 13258 institution = {Sandia National Laboratories}, 13259 month = oct, 13260 year = {1995}, 13261 number = {SAND95/1559} 13262} 13263 13264@TechReport{ aztec2, 13265 author = {Ray S. Tuminaro and Micheal Heroux and Scott A. Hutchinson and John N. Shadid}, 13266 title = {Official {Aztec} User's Guide Version 2.1}, 13267 institution = {Sandia National Laboratories}, 13268 year = {1999} 13269} 13270 13271@Book{ taylor-chandy:pcn, 13272 author = {Chandy, M. and Taylor, S.}, 13273 title = {An Introduction to Parallel Programming}, 13274 year = {1991}, 13275 publisher = {Jones and Bartlett} 13276} 13277 13278@Book{ foster-taylor:strand, 13279 title = {Strand: New Concepts in Parallel Programming}, 13280 author = {Ian Foster and Stephen Taylor}, 13281 publisher = {Prentice-Hall}, 13282 adress = { Englewood Cliffs, New Jersey}, 13283 year = {1990} 13284} 13285 13286@Article{ aurora, 13287 author = {E. Lusk and R. Butler and T. Disz and R. Olson and R. Overbeek and R. Stevens and 13288 D.H.D. Warren and A. Calderwood and P. Szeredi and S. Haridi and P. Brand and M. 13289 Carlsson and A. Ciepielewski and B. Hausman}, 13290 title = {The Aurora OR-Parallel Prolog System}, 13291 journal = {New Generation Computing}, 13292 volume = {7}, 13293 number = {3}, 13294 year = {1990}, 13295 pages = {243--271} 13296} 13297 13298@TechReport{ roo, 13299 author = {E. Lusk and W. McCune and J. Slaney}, 13300 title = {Roo---a Parallel Theorem Prover}, 13301 institution = {Argonne National Laboratory}, 13302 number = {MCS--TM--149}, 13303 year = {1991} 13304} 13305 13306@TechReport{ heath-etheridge:vppp, 13307 author = {M. T. Heath and J. A. Etheridge}, 13308 title = {Visualizing the Performance of Parallel Programs}, 13309 institution = {Oak Ridge National Laboratory}, 13310 number = {ORNL TM-11813}, 13311 year = {1991} 13312} 13313 13314@TechReport{ chem:vis, 13315 author = {Ewing L. Lusk}, 13316 title = {Performance Visualization for Parallel Programs}, 13317 institution = {Argonne National Laboratory}, 13318 number = {ANL/MCS--P287--0192}, 13319 year = {1991}, 13320 note = {(to appear in {\em Theoretica Chimica Acta})} 13321} 13322 13323@TechReport{ picltrace, 13324 author = {P.~H.~Worley}, 13325 title = {A new {PICL} trace file format}, 13326 institution = {Oak Ridge National Laboratory}, 13327 number = {ORNL TM-12125}, 13328 month = jun, 13329 year = {1992} 13330} 13331 13332@InProceedings{ hideo, 13333 author = {Gary Olsen and Carl Woese and Ray Hagstrom and Hideo Matsuda and Ross Overbeek}, 13334 title = {Inference of Phylogenetic trees using maximum likelihood}, 13335 booktitle = {Proceedings of the First Intel Delta Applications Workshop}, 13336 year = {1992}, 13337 pages = {247--262} 13338} 13339 13340@InProceedings{ dw90, 13341 author = {M. Dryja and O. Widlund}, 13342 title = {Towards a Unified Theory of Domain Decomposition Algorithms for Elliptic 13343 Problems}, 13344 booktitle = {Third International Symposium on Domain Decomposition Methods}, 13345 editor = {T. F. Chan and R. Glowinski and J. P\'eriaux and O. B. Widlund}, 13346 year = {1990}, 13347 pages = {3-21}, 13348 publisher = {SIAM}, 13349 address = {Philadelphia}, 13350 annote = {Additive {S}chwarz. Surveys recent (1989) results; some comments on 3-d and how 13351 many approaches may be cast in the form of additive {S}chwarz-subspace form. 58 13352 references, good introduction to the theory. No computations}, 13353 key = {DryjaWidlund90 !AS} 13354} 13355 13356@Unpublished{ rosing, 13357 author = {Matt Rosing and Joel Saltz}, 13358 title = {Low Latency Messages on Distributed Memory Multiprocessors}, 13359 key = {LowLatency}, 13360 note = {manuscript, 1992} 13361} 13362 13363@TechReport{ jp:incomplete, 13364 author = {Mark T. Jones and Paul E. Plassmann}, 13365 title = {An Improved Incomplete {C}holesky Factorization}, 13366 institution = {Argonne National Laboratory}, 13367 address = {Argonne, IL}, 13368 type = {Preprint}, 13369 note = {(to appear in {\em ACM Trans. on Mathematical Software, 1995})}, 13370 number = {MCS-P206-0191}, 13371 year = {1991}, 13372 key = {jones} 13373} 13374 13375@InCollection{ jp:ima, 13376 author = {Mark Jones and Paul Plassmann}, 13377 title = {The Efficient Parallel Iterative Solution of Large Sparse Linear Systems}, 13378 booktitle = {Graph Theory and Sparse Matrix Computation}, 13379 publisher = {Springer-Verlag}, 13380 series = {The IMA Volumes in Mathematics and Its Applications}, 13381 editor = {Alan George and John Gilbert and Joseph W.H.~Liu}, 13382 volume = {56}, 13383 year = {1993}, 13384 pages = {229--245} 13385} 13386 13387@Article{ pw98, 13388 author = {M. Pernice and H. F. Walker}, 13389 title = {{NITSOL}: A {Newton} Iterative Solver for Nonlinear Systems}, 13390 journal = {SIAM J. Sci. Stat. Comput.}, 13391 year = {1998}, 13392 volume = {19}, 13393 pages = {302--318} 13394} 13395 13396@TechReport{ ysmp83, 13397 key = {Eisenstat}, 13398 author = {S.~C.~Eisenstat and H.~C.~Elman and M.~H.~Schultz and A.~H.~Sherman}, 13399 title = {The (New) {Y}ale {S}parse {M}atrix {P}ackage}, 13400 institution = {Department of Computer Science, Yale University}, 13401 number = {YALE/DCS/RR-265}, 13402 month = apr, 13403 year = {1983} 13404} 13405 13406@InBook{ ysmp84, 13407 author = {S.~C.~Eisenstat and H.~C.~Elman and M.~H.~Schultz and A.~H.~Sherman}, 13408 chaptertitle = {The (New) {Y}ale {S}parse {M}atrix {P}ackage}, 13409 title = {Elliptic Problem Solvers II}, 13410 publisher = {Academic Press}, 13411 pages = {45--52}, 13412 editors = {G. Birkhoff and A. Schoenstadt}, 13413 year = {1984} 13414} 13415 13416@TechReport{ sparsekit, 13417 key = {Saad}, 13418 author = {Youcef Saad}, 13419 title = {{SPARSKIT}, a basic tool kit for sparse matrix computations}, 13420 institution = {Center for Supercomputing Research and Development, University of Illinois at 13421 Urbana-Champaign}, 13422 number = {1029}, 13423 year = {1990} 13424} 13425 13426@TechReport{ pde-user-ref, 13427 author = {Barry F. Smith}, 13428 title = {Extensible {PDE} Solvers Package Users Manual}, 13429 institution = {Argonne National Laboratory}, 13430 month = sep, 13431 year = {1994}, 13432 number = {ANL-93/40}, 13433 key = {Smith94 ! PDE} 13434} 13435 13436@TechReport{ bs-user-ref, 13437 author = {Mark T. Jones and Paul E. Plassmann}, 13438 title = {{BlockSolve95} Users Manual: Scalable Library Software for the Parallel Solution 13439 of Sparse Linear Systems}, 13440 institution = {Argonne National Laboratory}, 13441 month = dec, 13442 year = {1995}, 13443 number = {ANL-95/48} 13444} 13445 13446@TechReport{ snes-user-ref, 13447 author = {William D. Gropp and Lois Curfman McInnes and Barry F. Smith}, 13448 title = {Using the {S}calable {N}onlinear {E}quations {S}olvers Package}, 13449 institution = {Argonne National Laboratory}, 13450 month = feb, 13451 year = {1995}, 13452 number = {ANL/MCS-TM-193}, 13453 key = {GroppMcInnesSmith95 ! SNES} 13454} 13455 13456@TechReport{ sles-user-ref, 13457 author = {William D. Gropp and Barry F. Smith}, 13458 title = {{S}implified {L}inear {E}quation {S}olvers Users Manual}, 13459 institution = {Argonne National Laboratory}, 13460 month = mar, 13461 year = {1993}, 13462 number = {ANL-93/8}, 13463 key = {GroppSmith93 ! SLES} 13464} 13465 13466@TechReport{ chameleon-user-ref, 13467 author = {William D. Gropp and Barry F. Smith}, 13468 title = {Chameleon Parallel programming tools Users Manual}, 13469 institution = {Argonne National Laboratory}, 13470 month = mar, 13471 year = {1993}, 13472 number = {ANL-93/23}, 13473 key = {GroppSmith93 ! Chameleon} 13474} 13475 13476@Article{ euclid2, 13477 author = {D. Hysom and A. Pothen}, 13478 title = {A Scalable Parallel Algorithm For Incomplete Factor Preconditioning}, 13479 journal = {SIAM J. Sci. Comput.}, 13480 volume = {22}, 13481 number = {6}, 13482 pages = {2194--2215} 13483} 13484 13485@TechReport{ euclid1, 13486 author = {D. Hysom and A. Pothen}, 13487 title = {Euclid User Manual (A Scalable {ILU} Preconditioning Library for the Parallel 13488 Solution of Sparse Linear Systems)}, 13489 institution = {Old Dominion University}, 13490 year = {2001} 13491} 13492 13493@TechReport{ ksp-user-ref, 13494 author = {William D. Gropp and Barry F. Smith}, 13495 title = {Users Manual for {KSP}: Data-Structure-Neutral Codes Implementing {K}rylov Space 13496 Methods}, 13497 institution = {Argonne National Laboratory}, 13498 month = aug, 13499 year = {1993}, 13500 number = {ANL-93/30}, 13501 key = {GroppSmith93 ! KSP} 13502} 13503 13504@TechReport{ mpi-chameleon, 13505 author = {William D. Gropp and Ewing Lusk}, 13506 title = {A Test Implementation of the {MPI} Draft Message-Passing Standard}, 13507 institution = {Argonne National Laboratory}, 13508 month = dec, 13509 year = {1992}, 13510 number = {ANL-92/47}, 13511 key = {GroppLusk92 ! MPI} 13512} 13513 13514@TechReport{ blockcomm-fortran, 13515 author = {William D. Gropp}, 13516 title = {Block{C}omm for {F}ortran}, 13517 institution = {Argonne National Laboratory}, 13518 month = may, 13519 year = {1993}, 13520 number = {ANL-93/00 (to appear)}, 13521 key = {Gropp93 ! BlockComm} 13522} 13523 13524@TechReport{ autodocument, 13525 author = {William D. Gropp}, 13526 title = {Automatic documentation of {C} programs}, 13527 institution = {Argonne National Laboratory}, 13528 month = may, 13529 year = {1993}, 13530 number = {ANL-93/00}, 13531 key = {Gropp93 ! Autodoc} 13532} 13533 13534@TechReport{ zipcode, 13535 author = {Anthony Skjellum and Steven G. Smith and Charles H Still and Alvin P. Leung and 13536 Manfred Morari}, 13537 title = {The {Z}ipcode message-passing system}, 13538 institution = {Lawrence Livermore National Laboratory}, 13539 month = sep, 13540 year = {1992}, 13541 number = {Unpublished}, 13542 key = {Skjellum92 ! Zipcode} 13543} 13544 13545@Article{ paragraph, 13546 author = {Michael T. Heath and Jennifer Etheridge Finger}, 13547 title = {Visualizing performance of parallel programs}, 13548 journal = {IEEE Software}, 13549 volume = {8}, 13550 number = {5}, 13551 month = sep, 13552 year = {1991}, 13553 pages = {29--39}, 13554 key = {Heath91 ! Paragraph} 13555} 13556 13557@Article{ gropp90, 13558 author = {William Gropp and Edward Smith}, 13559 title = {Computational Fluid Dynamics on Parallel Processors}, 13560 journal = {Computers and Fluids}, 13561 volume = {18}, 13562 year = {1990}, 13563 pages = {289--304}, 13564 key = {Gropp90 ! performance} 13565} 13566 13567@Article{ foster92, 13568 author = {Ian Foster and William Gropp and Rick Stevens}, 13569 title = {The parallel scalability of the spectral transform method}, 13570 journal = {Monthly Weather Review}, 13571 volume = {120}, 13572 year = {1992}, 13573 pages = {835--850}, 13574 key = {Foster92 ! performance} 13575} 13576 13577@InBook{ fgn, 13578 author = {R. Freund and G. H. Golub and N. Nachtigal}, 13579 title = {Iterative Solution of Linear Systems}, 13580 series = {Acta Numerica}, 13581 year = {1992}, 13582 publisher = {Cambridge University Press}, 13583 pages = {57--100} 13584} 13585 13586@TechReport{ nachtigal90, 13587 author = {No{\"e}l M. Nachtigal and Satish C. Reddy and Lloyd N. Trefethen}, 13588 title = {How Fast are Nonsymmetric Matrix Iterations?}, 13589 institution = {Massachusetts Institute of Technology}, 13590 month = mar, 13591 year = {1990}, 13592 number = {90-2}, 13593 key = {Nachtigal | Krylov} 13594} 13595 13596@Article{ nachtigal1992fnm, 13597 title = {How Fast are Nonsymmetric Matrix Iterations?}, 13598 author = {Nachtigal, N.M. and Reddy, S.C. and Trefethen, L.N.}, 13599 journal = {SIAM Journal on Matrix Analysis and Applications}, 13600 volume = {13}, 13601 pages = {778}, 13602 year = {1992}, 13603 publisher = {SIAM} 13604} 13605 13606@TechReport{ embree1999descriptive, 13607 title = {How descriptive are {GMRES} convergence bounds}, 13608 author = {Embree, M.}, 13609 year = {1999}, 13610 number = {08}, 13611 institution = {Oxford University Computing Laboratory} 13612} 13613 13614@Article{ vorst92, 13615 author = {H. van der Vorst}, 13616 title = {Bi-{CGSTAB}: A fast and smoothly converging variant of {Bi-CG} for the solution 13617 of nonsymmetric linear systems}, 13618 journal = {SIAM J. Sci. Stat. Comput.}, 13619 year = {1992}, 13620 volume = {13}, 13621 pages = {631--644} 13622} 13623 13624@Article{ eisenstat81, 13625 author = {S. Eisenstat}, 13626 title = {Efficient Implementation of a Class of {CG} Methods}, 13627 journal = {SIAM J. Sci. Stat. Comput.}, 13628 year = {1981}, 13629 volume = {2}, 13630 pages = {1--4} 13631} 13632 13633@Manual{ ibm-essl, 13634 title = {{E}ngineering and {S}cientific {S}ubroutine {L}ibrary Version 2: Guide and 13635 Reference}, 13636 organization = {IBM}, 13637 year = {1992}, 13638 key = {IBM-ESSL} 13639} 13640 13641@Manual{ ibm-eui, 13642 title = {{IBM} {AIX} Parallel Environment Parallel Programming Subroutine Reference 13643 Release 2.0}, 13644 organization = {IBM}, 13645 month = jun, 13646 year = {1994}, 13647 key = {IBM-EUI} 13648} 13649 13650@Manual{ ibm-euih, 13651 title = {Using {EUIH}: An Experimental {EUI} Implementation}, 13652 organization = {IBM}, 13653 author = {Peter Hochschild}, 13654 year = {1993}, 13655 key = {IBM-EUIH} 13656} 13657 13658@TechReport{ mpi, 13659 title = {Document for a Standard Message-Passing Interface}, 13660 author = {Message Passing Interface Forum}, 13661 institution = {University of Tennessee}, 13662 number = {CS-93-214}, 13663 month = nov, 13664 year = {1993}, 13665 key = {MPI Standard} 13666} 13667 13668@Unpublished{ mpi-final-web, 13669 author = {Message Passing Interface Forum}, 13670 title = {{MPI}: A Message-Passing Interface Standard}, 13671 note = {http://www.mcs.anl.gov/mpi/mpi-report/mpi-report.html}, 13672 year = {1994}, 13673 month = may 13674} 13675 13676@Book{ hockney-jesshope, 13677 author = {R. W. Hockney and C. R. Jesshope}, 13678 title = {Parallel Computers 2}, 13679 publisher = {Adam Hilger}, 13680 year = {1988} 13681} 13682 13683@Book{ cm-fortran, 13684 author = {{Thinking Machines Corporation}}, 13685 title = {Users Manual for CM-Fortran}, 13686 publisher = {Thinking Machines Corporation}, 13687 year = {1993} 13688} 13689 13690@TechReport{ chang93, 13691 title = {Experiments and Bounds on Block Diagonal Preconditioning}, 13692 author = {Mark Yan-Ming Chang and Martin H. Schultz}, 13693 institution = {Yale Department of Computer Science}, 13694 number = {YALEU/DCS/RR-994}, 13695 month = nov, 13696 year = {1993}, 13697 key = {BDD|diag} 13698} 13699 13700@InProceedings{ gropplevine93, 13701 author = {N. Galbreath and W. Gropp and D. Levine}, 13702 title = {Applications-Driven Parallel {I/O}}, 13703 booktitle = {Proceedings of Supercomputing '93}, 13704 year = {1993}, 13705 pages = {462--471} 13706} 13707 13708@Book{ siegle85, 13709 author = {H. J. Siegel}, 13710 title = {Interconnection Networks for Large Scale Parallel Processing}, 13711 publisher = {Lexington Books}, 13712 year = {1985}, 13713 key = {Network Comparison} 13714} 13715 13716@Article{ lawrie75, 13717 author = {D. H. Lawrie}, 13718 title = {Access and alignment of data in an array processor}, 13719 journal = {IEEE Transactions on Computers}, 13720 volume = {C-24}, 13721 number = {12}, 13722 month = dec, 13723 year = {1975}, 13724 pages = {1145--1155}, 13725 key = {Omega Network} 13726} 13727 13728@Book{ knuth1986, 13729 title = {The {\TeX}{Book}}, 13730 author = {Donald Ervin Knuth and Duane Bibby}, 13731 volume = {1993}, 13732 year = {1986}, 13733 publisher = {Addison-Wesley Reading, Massachusetts} 13734} 13735 13736@Book{ lamport86, 13737 author = {Leslie Lamport}, 13738 title = {{LaTeX}: A document preparation system}, 13739 publisher = {Addison-Wesley}, 13740 year = {1986}, 13741 key = {Latex Manual} 13742} 13743 13744@InProceedings{ gropp-lusk:unix-tools, 13745 author = {William Gropp and Ewing Lusk}, 13746 title = {Scalable {U}nix Tools on Parallel Processors}, 13747 booktitle = {Proceedings of the 1994 Scalable High Performanc Computing Conference}, 13748 publisher = {IEEE}, 13749 pages = {56--62} 13750} 13751 13752@InProceedings{ jp:bell_prize, 13753 author = {Mark Jones and Paul Plassmann}, 13754 title = {Solution of Large, Sparse Systems of Linear Equations in Massively Parallel 13755 Applications}, 13756 booktitle = {Proceedings of Supercomputing '92}, 13757 publisher = {IEEE Computer Society Press}, 13758 year = {1992}, 13759 pages = {551--560} 13760} 13761 13762@COMMENT{WEB, CWEB references (for doctext)} 13763@TechReport{ web, 13764 author = {Donald E. Knuth}, 13765 title = {The {\tt WEB} system of structured documentation}, 13766 institution = {Computer Science Department, Stanford University}, 13767 year = {1983}, 13768 number = {980}, 13769 month = sep 13770} 13771 13772@Article{ literatepgm, 13773 author = {Donald E. Knuth}, 13774 title = {Literate Programming}, 13775 journal = {Computer Journal}, 13776 year = {1984}, 13777 volume = {27}, 13778 number = {2}, 13779 pages = {91--111} 13780} 13781 13782@Unpublished{ cweb-code, 13783 author = {Silvio Levy and Donald E. Knuth}, 13784 title = {CWEB}, 13785 note = {CWEB is available at ftp://pip.shsu.edu/tex-archive/web/c\_cpp/cweb} 13786} 13787 13788@Article{ jp:scalable, 13789 author = {Mark Jones and Paul Plassmann}, 13790 title = {Scalable Iterative Solution of Sparse Linear Systems}, 13791 journal = {Parallel Computing}, 13792 volume = {20}, 13793 number = {5}, 13794 month = may, 13795 year = {1994}, 13796 pages = {753--773} 13797} 13798 13799@Article{ jp:pcolor, 13800 author = {Mark T. Jones and Paul E. Plassmann}, 13801 title = {A Parallel Graph Coloring Heuristic}, 13802 journal = {SIAM J. Sci. Comput.}, 13803 volume = {14}, 13804 number = {3}, 13805 pages = {654-669}, 13806 year = {1993} 13807} 13808 13809@TechReport{ block_solve, 13810 author = {Mark T. Jones and Paul E. Plassmann}, 13811 title = {{B}lock{S}olve v1.1: Scalable Library Software for the Parallel Solution of 13812 Sparse Linear Systems}, 13813 institution = {Argonne National Laboratory}, 13814 year = {1992}, 13815 number = {ANL-92/46}, 13816 key = {JonesPlassmann92 ! block_solve} 13817} 13818 13819@InProceedings{ supercond, 13820 author = {Lois Curfman Mc{I}nnes and Mario Palumbo}, 13821 title = {Parallel Solution of the Anisotropic {G}inzburg-{L}andau Model}, 13822 booktitle = {Proceedings of the Toward Teraflop Computing and New Grand Challenge Applications 13823 Conference}, 13824 month = feb, 13825 year = {1994}, 13826 key = {McInnesPalumbo94 ! superconductivity } 13827} 13828 13829@Unpublished{ preosti:93, 13830 author = {Gianfranco Preosti}, 13831 title = { }, 13832 note = {Unpublished information, {P}hysics {D}epartment, {P}urdue {U}niversity}, 13833 year = {1993}, 13834 key = {preosti93 ! GL-tilt3d} 13835} 13836 13837@Unpublished{ more:93, 13838 author = {Jorge J. Mor\'{e}}, 13839 title = { }, 13840 note = {Unpublished information, {M}athematics and {C}omputer {S}cience {D}ivision, 13841 {A}rgonne {N}ational {L}aboratory}, 13842 year = {1993}, 13843 key = {more93 ! MINPACK-2} 13844} 13845 13846@Article{ brownsaad:90, 13847 author = {Peter N. Brown and Youcef Saad}, 13848 title = {Hybrid {K}rylov Methods for Nonlinear Systems of Equations}, 13849 journal = {SIAM J. Sci. Stat. Comput.}, 13850 year = {1990}, 13851 volume = {11}, 13852 pages = {450-481} 13853} 13854 13855@Book{ using-mpi, 13856 author = {William Gropp and Ewing Lusk and Anthony Skjellum}, 13857 title = {Using MPI: Portable Parallel Programming with the Message Passing Interface}, 13858 publisher = {MIT Press}, 13859 year = {1994} 13860} 13861 13862@Book{ using-mpi2, 13863 author = {William Gropp and Ewing Lusk and Rajeev Thakur}, 13864 title = {Using MPI 2: Advanced Features of the Message Passing Interface}, 13865 publisher = {MIT Press}, 13866 year = {1999} 13867} 13868 13869@Article{ hs:52, 13870 author = {Magnus R. Hestenes and Eduard Steifel}, 13871 title = {Methods of Conjugate Gradients for Solving Linear Systems}, 13872 journal = {J. Research of the National Bureau of Standards}, 13873 year = {1952}, 13874 volume = {49}, 13875 pages = {409-436} 13876} 13877 13878@Article{ so:89, 13879 author = {Peter Sonneveld}, 13880 title = {{CGS}, A Fast {L}anczos-type Solver for Nonsymmetric Linear Systems}, 13881 journal = {SIAM J. Sci. Stat. Comput.}, 13882 year = {1989}, 13883 volume = {10}, 13884 pages = {36-52} 13885} 13886 13887@Article{ v:92, 13888 author = {{H. A.} {van der Vorst}}, 13889 title = {{B}i{CGSTAB}: A fast and smoothly converging variant of {B}i{CG} for the solution 13890 of nonsymmetric linear systems}, 13891 journal = {SIAM J. Sci. Stat. Comput.}, 13892 volume = {13}, 13893 year = {1992}, 13894 pages = {631-644} 13895} 13896 13897@Article{ f:93, 13898 author = {Roland W. Freund}, 13899 title = {A Transpose-Free Quasi-Minimal Residual Algorithm for Non-{H}ermitian Linear 13900 Systems}, 13901 journal = {SIAM J. Sci. Stat. Comput.}, 13902 volume = {14}, 13903 year = {1993}, 13904 pages = {470-482} 13905} 13906 13907@Article{ ish:89, 13908 author = {S. Ishizuka}, 13909 title = {An Experimental Study on Extinction and Stablity of Tubular Flames}, 13910 journal = {Combustion and Flame}, 13911 volume = {75}, 13912 year = {1989}, 13913 pages = {367-379} 13914} 13915 13916@Book{ williams89, 13917 title = {Combustion Theory, The Fundamental Theory of Chemically Reacting Flow Systems}, 13918 author = {F.A. Williams}, 13919 publisher = {Addison-Wesley}, 13920 year = {1989}, 13921 pages = {367-379} 13922} 13923 13924@Book{ ra75, 13925 author = {R. Aris}, 13926 title = {The Mathematical Theory of Diffusion and Reaction in Permeable Catalysts}, 13927 publisher = {Oxford}, 13928 year = {1975} 13929} 13930 13931@Book{ bebernes89, 13932 author = {J. Bebernes and D. Eberly}, 13933 title = {Mathematical Problems from Combustion Theory}, 13934 publisher = {Springer-Verlag}, 13935 series = {Applied Mathematical Sciences 83}, 13936 year = {1989} 13937} 13938 13939@InProceedings{ kikuchi89, 13940 author = {F. Kikuchi}, 13941 booktitle = { Computing Methods in Applied Sciences and Engineering}, 13942 editor = {R. Glowinski and J. L. Lions}, 13943 publisher = {Springer-Verlag}, 13944 series = {Lecture Notes in Mathematics}, 13945 title = {Finite element approximations to bifurcation problems of turning point type}, 13946 year = {1977} 13947} 13948 13949@Article{ rg85, 13950 author = {R. Glowinski and H.B. Keller and L. Reinhart}, 13951 title = {Continuation-conjugate Gradient Methods for the Least Squares Solution of 13952 Nonlinear Boundary Problems}, 13953 journal = {SIAM J. Sci. Stat. Comput.}, 13954 volume = {6}, 13955 year = {1985}, 13956 pages = {793-832} 13957} 13958 13959@InProceedings{ whitfield91, 13960 author = {D. Whitfield and L. Taylor}, 13961 title = {Discretized {N}ewton-Relaxation Solution of High Resolution Flux-Difference Split 13962 Schemes}, 13963 booktitle = {Proceedings of the AIAA Tenth Computational Fluid Dynamics Conference}, 13964 misc = {AIAA-91-1539}, 13965 pages = {134-145}, 13966 year = {1991} 13967} 13968 13969@InProceedings{ quinlan1, 13970 author = {M. Lemke and D. Quinlan}, 13971 title = {P++, a {C}++ Virtual Shared Grids Based Programming Environment for 13972 Architecture-Independent Development of Structured Grid Applications}, 13973 booktitle = {CONPAR/VAPP V, Lecture Notes in Computer Science}, 13974 publisher = {Springer Verlag}, 13975 year = {1992} 13976} 13977 13978@InProceedings{ quinlan2, 13979 author = {R. Parsons and D. Quinlan}, 13980 title = {A++/{P}++ Array Classes for Architecture Independent Finite Difference 13981 Computations}, 13982 booktitle = {Proceedings of the Second Annual Object-Oriented Numerics Conference}, 13983 year = {1994} 13984} 13985 13986% ***** Overview of functionality in Diffpack 13987@InBook{ dpoverview, 13988 author = {Bruaset, A. M. and Langtangen, H. P.}, 13989 booktitle = {Mathematical Models and Software Tools in Industrial Mathematics}, 13990 title = {A Comprehensive Set of Tools for Solving Partial Differential Equations; 13991 {Diffpack}}, 13992 publisher = {Birkh{\"{a}}user}, 13993 pages = {61--90}, 13994 year = {1997} 13995} 13996 13997% ***** Short overview of Diffpack 13998@InCollection{ dpoverview2, 13999 author = {Bruaset, A. M. and Langtangen, H. P.}, 14000 editor = {A. Sydow}, 14001 booktitle = {Proceedings of the 15th IMACS World Congress on Scientific Computation, Modelling 14002 and Applied Mathematics}, 14003 title = {Diffpack: A Software Environment for Rapid Prototyping of {PDE} Solvers}, 14004 pages = {553--558}, 14005 volume = {4}, 14006 year = {1997} 14007} 14008 14009% ***** Comprehensive documentation of Diffpack and 14010% associated numerical methods: 14011@Book{ dpbook, 14012 author = {H. P. Langtangen}, 14013 title = {Numerical Solution of Partial Differential Equations; Models, Algorithms and 14014 Software. Part I}, 14015 series = {Lecture Notes in Computational Science and Engineering}, 14016 publisher = {Springer-Verlag}, 14017 year = {1998} 14018} 14019 14020% ***** Design issues of the linear solvers in Diffpack, serves also as a 14021% collection of examples on O-O in numerical computing 14022@Article{ ambhpl97a, 14023 author = {A. M. Bruaset and H. P. Langtangen }, 14024 title = {Object-Oriented Design of Preconditioned Iterative Methods in {Diffpack}}, 14025 journal = {Transactions on Mathematical Software}, 14026 volume = {23 }, 14027 pages = {50--80}, 14028 year = {1997} 14029} 14030 14031@Misc{ dpurl, 14032 author = {{Diffpack Web page}}, 14033 howpublished = {\url{http://www.diffpack.com}} 14034} 14035 14036% ***** General intro to object-oriented numerics for "FORTRAN programmers" 14037@InCollection{ oonintro, 14038 author = {Arge, E. and Bruaset, A. M. and H. P. Langtangen}, 14039 editor = {D{\ae}hlen, M. and Tveito, A.}, 14040 booktitle = {Mathematical Models and Software Tools in Industrial Mathematics}, 14041 title = {Object-Oriented Numerics}, 14042 publisher = {Birkh{\"{a}}user}, 14043 year = {1997} 14044} 14045 14046% ***** Efficiency comparison: BLAS 1, Diffpack, C, 14047% and finite element applications (F77 vs Diffpack) 14048@InCollection{ dpefficiency, 14049 author = {Arge, E. and Bruaset, A. M. and Calvin, P. B. and Kanney, J. F. and Langtangen, 14050 H. P. and Miller, C. T.}, 14051 editor = {D{\ae}hlen, M. and Tveito, A.}, 14052 booktitle = {Mathematical Models and Software Tools in Industrial Mathematics}, 14053 title = {On the Efficiency of {C++} in Scientific Computing}, 14054 publisher = {Birkh{\"{a}}user}, 14055 pages = {91--118}, 14056 year = {1997} 14057} 14058 14059% ***** Parallel concept in Diffpack: 14060@InCollection{ dpparallel, 14061 author = {A.~M.~Bruaset and X. Cai and H. P. Langtangen and A. Tveito}, 14062 editor = {Y. Ishikawa and R. R. Oldehoeft and J. V. W. Reynders and M. Tholburn}, 14063 booktitle = {Scientific Computing in Object-Oriented Parallel Environments}, 14064 title = {Numerical Solution of {PDE}s on Parallel Computers Utilizing Sequential 14065 Simulators}, 14066 publisher = {Springer--Verlag}, 14067 series = {Lecture Notes in Computer Science}, 14068 pages = {161--168}, 14069 year = {1997} 14070} 14071 14072% ***** DD and ML methods in Diffpack: 14073@InCollection{ dpddml, 14074 author = {A.~M.~Bruaset and H. P. Langtangen and G. W. Zumbusch}, 14075 editor = {P. Bj{\o}rstad and M. Espedal and D. Keyes}, 14076 booktitle = {Proceedings of the 9th Conference on Domain Decomposition}, 14077 title = {Domain decomposition and multilevel methods in Diffpack}, 14078 year = {1997} 14079} 14080 14081@InProceedings{ bsca98, 14082 author = {David L. Bruhwiler and Svetlana G. Shasharina and John R. Cary and David 14083 Alexander}, 14084 title = {Design and Implementation of an Object Oriented C++ Library for Nonlinear 14085 Optimization}, 14086 booktitle = {Proceedings of the SIAM Workshop on Object Oriented Methods for Inter-operable 14087 Scientific and Engineering Computing}, 14088 editor = {Mike Henderson et al.}, 14089 pages = {165-173}, 14090 year = {1998} 14091} 14092 14093@Book{ scalapack-user-guide, 14094 author = {L. S. Blackford and J. Choi and A. Cleary and E. D'Azevedo and J. Demmel and I. 14095 Dhillon and J. Dongarra and S. Hammarling and G. Henry and A. Petitet and K. 14096 Stanley and D. Walker and R. C. Whaley}, 14097 title = {Sca{LAPACK} Users' Guide}, 14098 publisher = {SIAM}, 14099 address = {Philadelphia, PA}, 14100 year = {1997} 14101} 14102 14103@InProceedings{ keyes99, 14104 author = {D. E. Keyes}, 14105 title = {How Scalable is Domain Decomposition in Practice?}, 14106 booktitle = {Proceedings of the 11th International Conference on Domain Decomposition 14107 Methods}, 14108 editor = {C.-H. Lai et al.}, 14109 publisher = {Domain Decomposition Press, Bergen}, 14110 note = {To appear}, 14111 year = {1999} 14112} 14113 14114@Article{ fun3d, 14115 author = {W. K. Anderson and D. L. Bonhaus}, 14116 title = {An implicit upwind algorithm for computing turbulent flows on unstructured 14117 grids}, 14118 journal = {Computers and Fluids}, 14119 year = {1994}, 14120 volume = {23}, 14121 pages = {1--21} 14122} 14123 14124% ------------------------------------------------------------------------- 14125% ------------------------------------------------------------------------- 14126@Article{ torczon, 14127 author = {Dennis, Jr., J. E. and V.~Torczon}, 14128 title = {Direct Search Methods on Parallel Machines}, 14129 journal = {SIAM J. Optimization}, 14130 volume = {1}, 14131 pages = {448--474}, 14132 year = {1991}, 14133 key = {Torczon !PDS} 14134} 14135 14136@InProceedings{ wt91, 14137 author = {D. L. Whitfield and L. K. Taylor}, 14138 title = {Discretized {N}ewton-Relaxation Solution of High Resolution Flux-Difference Split 14139 Schemes}, 14140 booktitle = {Proceedings of the AIAA Tenth Annual Computational Fluid Dynamics Conference}, 14141 misc = {AIAA-91-1539}, 14142 pages = {134-145}, 14143 year = {1991} 14144} 14145 14146@Article{ ew96, 14147 author = {S. C. Eisenstat and H. F. Walker}, 14148 title = {Choosing the forcing terms in an inexact {N}ewton method}, 14149 journal = {SIAM J. Scientific Computing}, 14150 volume = {17}, 14151 year = {1996}, 14152 pages = {16--32} 14153} 14154 14155@Book{ thi93, 14156 author = {{Thinking Machines Corporation}}, 14157 title = {Users Manual for CM-Fortran}, 14158 publisher = {Thinking Machines Corporation}, 14159 year = {1993} 14160} 14161 14162@Book{ mortonmayers94, 14163 author = {K. W. Morton and D. F. Mayers}, 14164 title = {Numerical Solution of Partial Differential Equations}, 14165 publisher = {Press Syndicate of the University of Cambridge}, 14166 year = {1994} 14167} 14168 14169@Book{ heath97, 14170 author = {Michael T. Heath}, 14171 title = {Scientific Computing: An Introductory Survey}, 14172 publisher = {McGraw Hill}, 14173 year = {1997} 14174} 14175 14176@Article{ captools96, 14177 author = {C. S. Ierotheou and S. P Johnson and M. Cross and P. F. Leggett}, 14178 title = {Computer Aided Parallelization Tools ({CAPTools}) - Conceptual Overview and 14179 Performance on the Parallelization of Structured Mesh Codes}, 14180 journal = {Parallel Computing}, 14181 volume = {22}, 14182 pages = {197-226}, 14183 year = {1996} 14184} 14185 14186@Misc{ nastran-web-page, 14187 author = {{MSC Software Corporation}}, 14188 title = {{NASTRAN} {W}eb page}, 14189 howpublished = {\url{http://www.mechsolutions.com/products/nastran/}}, 14190 year = {2024} 14191} 14192 14193@Book{ hpf, 14194 author = {C. H. Koelbel and D. B. Loveman and R. S. Schreiber and G. L. Steele and M. E. 14195 Zosel}, 14196 title = {The High Performance Fotran Handbook}, 14197 publisher = {MIT Press}, 14198 year = {1994} 14199} 14200 14201@InProceedings{ keyes98, 14202 author = {D. E. Keyes}, 14203 title = {Trends in Algorithms for Nonuniform Applications on Hierarchical Distributed 14204 Architectures}, 14205 booktitle = {Proceedings of the Workshop on Computational Aerosciences for the 21st Century}, 14206 editors = {M. D. Salas and W. K. Anderson}, 14207 ppublisher = {Elsevier}, 14208 year = {1998} 14209} 14210 14211@InProceedings{ pooma-atlas, 14212 author = {S. Atlas and S. Banerjee and J. C. Cummings and P. J. Hinker and M. Srikant and 14213 J. V. W. Reynders and M. Tholburn}, 14214 title = {{POOMA}: A High-Performance Distributed Simulation Environment for Scientific 14215 Applications}, 14216 year = {1995}, 14217 month = dec, 14218 booktitle = {Supercomputing '95 Proceedings} 14219} 14220 14221% --------------------------------------------------------------------------------- 14222% New bib entries for CRPC paper 14223@Misc{ mgnet-web-page, 14224 author = {Craig C. Douglas}, 14225 title = {{MGNet Web page}}, 14226 note = {See {\tt http://\-www.mgnet.org}} 14227} 14228 14229@Misc{ dagh-web-page, 14230 author = {M. Parashar and J. C. Browne}, 14231 title = {{DAGH Web page}}, 14232 note = {\url{http://www.caip.rutgers.edu/~parashar/DAGH}} 14233} 14234 14235@Misc{ parasol-web-page, 14236 key = {PARASOL}, 14237 title = {{PARASOL Web page}}, 14238 note = {See {\tt http://\-www.genias.de/\-projects/\-parasol}} 14239} 14240 14241@Misc{ pooma-web-page, 14242 author = {{POOMA Web page}}, 14243 note = {See {\tt http://\-www.acl.lanl.gov/pooma}} 14244} 14245 14246@Misc{ mudpack-web-page, 14247 author = {John C. Adams}, 14248 title = {{MUDPACK Web page}}, 14249 note = {See {\tt http://\-www.scd.ucar.edu/\-css/\-software/\-mudpack}} 14250} 14251 14252@Misc{ pellpack-web-page, 14253 author = {Elias Houstis and John Rice and Apostolos Hadjidimos}, 14254 title = {{Parallel ELLPACK Web page}}, 14255 note = {See {\tt http://\-www.cs.purdue.edu/\-research/\-cse/\-pellpack/}} 14256} 14257 14258@InProceedings{ pellpack95, 14259 author = {E. N. Houstis and S. B. Kim and S. Markus and P. Wu and N. E. Houstis and A.C. 14260 Catlin and S. Weerawarana and T.S. Papatheodorou}, 14261 title = {Parallel {ELLPACK} Elliptic {PDE} Solvers}, 14262 booktitle = {Proceedings of INTEL Supercomputer User's Group Conference}, 14263 address = {Albuquerque, NM}, 14264 year = {1995} 14265} 14266 14267@Misc{ nhse-web-page, 14268 author = {{National High-Performance Software Exchange Web page}}, 14269 note = {See {\tt http://\-www.nhse.org}} 14270} 14271 14272@Misc{ doug-web-page, 14273 author = {Mark J. Hagger and Linda Stals}, 14274 title = {{DOUG Web Page}}, 14275 note = {See {\tt http://\-www.maths.bath.ac.uk/\~{ }parsoft/\-doug/}} 14276} 14277 14278@TechReport{ doug97, 14279 author = {Mark J. Hagger}, 14280 title = {Automatic Domain Decomposition on Unstructured Grids {(DOUG)}}, 14281 institution = {Mathematical Sciences, University of Bath}, 14282 year = {1997}, 14283 number = {9706}, 14284 note = {Advances in Computational Mathematics (to appear)} 14285} 14286 14287@Misc{ ug-web-page, 14288 author = {{UG Web Page}}, 14289 note = {See {\tt http://\-cox.iwr.uni-heidelberg.de/\~{ }ug/}} 14290} 14291 14292@Article{ ug97, 14293 author = {P. Bastian and K. Birken and K. Johannsen and S. Lang and N. Neuss and H. 14294 Rentz-Reichert and C. Wieners}, 14295 title = {{UG} -- A Flexible Software Toolbox for Solving Partial Differential Equations}, 14296 journal = {Computing and Visualization in Science}, 14297 year = {1997}, 14298 volume = {}, 14299 pages = {} 14300} 14301 14302@Misc{ vecfem-web-page, 14303 author = {Lutz Grosz}, 14304 title = {{VECFEM Web Page}}, 14305 note = {See {\tt http://\-wwwmaths.anu.edu.au/\-\~{ }vecfem/}} 14306} 14307 14308@Misc{ atlas-web-page, 14309 author = {R. Clint {Whaley et al.}}, 14310 title = {{ATLAS Web Page}}, 14311 howpublished = {\url{http://math-atlas.sourceforge.net}} 14312} 14313 14314@Misc{ fenics-web-page, 14315 author = {Todd Dupont and Johan Hoffman and Johan Jansson and Claes Johnson and Robert C. 14316 Kirby and Matthew Knepley and Mats Larson and Anders Logg and Ridgway Scott}, 14317 title = {{FEniCS Web Page}}, 14318 note = {\url{http://www.fenicsproject.org}}, 14319 year = {2005} 14320} 14321 14322@Misc{ matlab-web-page, 14323 author = {{The} {MathWorks}}, 14324 title = {{Matlab} {Web} page}, 14325 url = {http://www.mathworks.com} 14326} 14327 14328@Misc{ phipac-web-page, 14329 author = {J. A. Bilmes and K. Asanovic and R. Vudoc and S. Iyer and J. Demmel and C. Chin 14330 and D. Lam}, 14331 title = {{PHiPAC Web Page}}, 14332 note = {See {\tt http://\-www.icsi.berkeley.edu/\-\~{ }bilmes/\-phipac/}} 14333} 14334 14335@InProceedings{ kelp, 14336 author = {Stephan J. Fink and Scott B. Baden and Scott R. Kohn}, 14337 title = {Flexible Communication Mechanisms for Dynamic Structured Applications}, 14338 booktitle = {Irregular '96}, 14339 year = {1996} 14340} 14341 14342@Unpublished{ kelp-web-page, 14343 author = {Scott Baden}, 14344 title = {{KeLP} {W}eb page}, 14345 note = {See {\tt http://\-www-cse.ucsd.edu/\-groups/\-hpcl/\-scg/\-kelp/}} 14346} 14347 14348@InProceedings{ hk99, 14349 author = {R. Hornung and S. Kohn}, 14350 title = {The Use of Object-Oriented Design Patterns in the {SAMRAI} Structured {AMR} 14351 Framework}, 14352 booktitle = {Proceedings of the SIAM Workshop on Object-Oriented Methods for Inter-Operable 14353 Scientific and Engineering Computing}, 14354 pages = {235-244}, 14355 year = {1999}, 14356 note = {See \url{http://www.llnl.gov/CASC/samrai}} 14357} 14358 14359@Unpublished{ samrai-web-page, 14360 title = {{SAMRAI} {W}eb Page}, 14361 author = {Scott Kohn and Xabier Garaiza and Rich Hornung and Steve Smith}, 14362 note = {See {\tt http://www.llnl.gov/\-CASC/SAMRAI}} 14363} 14364 14365@Misc{ overture-web-page, 14366 author = {William Henshaw and Kyle Chand}, 14367 title = {{Overture} {W}eb page}, 14368 howpublished = {\url{http://www.llnl.gov/CASC/Overture}} 14369} 14370 14371@InProceedings{ overture99, 14372 author = {D.L. Brown and W.D. Henshaw and D.J. Quinlan}, 14373 title = {Overture: An Object-Oriented Framework for Solving Partial Differential Equations 14374 on Overlapping Grids}, 14375 publisher = {SIAM}, 14376 booktitle = {Proceedings of the SIAM Workshop on Object Oriented Methods for Inter-operable 14377 Scientific and Engineering Computing}, 14378 year = {1999}, 14379 pages = {215-224}, 14380 note = {See \url{http://www.llnl.gov/CASC/Overture}} 14381} 14382 14383@InProceedings{ diffpack, 14384 author = {A.M. Bruaset and H.P. Langtangen}, 14385 title = {A Comprehensive Set of Tools for Solving Partial Differential Equations: 14386 {D}iffpack}, 14387 booktitle = {Numerical Methods and Software Tools in Industrial Mathematics}, 14388 year = {1997}, 14389 pages = {61--90}, 14390 publisher = {Birkhauser Press} 14391} 14392 14393@Article{ dongarra:1984:ila, 14394 author = {J. J. Dongarra and F. G. Gustavson and A. Karp}, 14395 title = {Implementing Linear Algebra Algorithms for Dense Matrices on a Vector Pipeline 14396 Machine}, 14397 journal = {SIAM Review}, 14398 volume = {26}, 14399 number = {1}, 14400 pages = {91--112}, 14401 month = jan, 14402 year = {1984}, 14403 coden = {SIREAD}, 14404 issn = {0036-1445 (print), 1095-7200 (electronic)}, 14405 mrclass = {65F10 (65F30)}, 14406 mrnumber = {85c:65032}, 14407 bibdate = {Mon Jan 20 1997}, 14408 abstract = {The authors examine common implementations of linear algebra algorithms, such as 14409 matrix-vector multiplication, matrix-matrix multiplication and the solution of 14410 linear equations. The different versions are examined for efficiency on a computer 14411 architecture which uses vector processing and has pipelined instruction execution. 14412 By using the advanced architectural features of such machines, one can usually 14413 achieve maximum performance, and tremendous improvements in terms of execution 14414 speed can be seen over conventional computers.}, 14415 classification= {723; 921}, 14416 journalabr = {SIAM Rev}, 14417 keywords = {computer programming --- Algorithms; dense matrices; linear algebra algorithms; 14418 mathematical programming; vector pipeline machine} 14419} 14420 14421@Book{ qv99, 14422 author = {Alfio Quarteroni and Alberto Valli}, 14423 title = {Domain Decomposition Methods for Partial Differential Equations}, 14424 publisher = {Oxford Science Publications}, 14425 address = {Oxford}, 14426 year = {1999} 14427} 14428 14429@Book{ ksv97, 14430 editor = {David E. Keyes and Ahmed Sameh and V. Venkatakrishnan}, 14431 title = {Parallel Numerical Algorithms}, 14432 publisher = {Kluwer Academic Publishers}, 14433 address = {the Netherlands}, 14434 year = {1997} 14435} 14436 14437@Book{ hackbusch94, 14438 author = {Wolfgang Hackbusch}, 14439 title = {Iterative Solution of Large Sparse Systems of Equations}, 14440 publisher = {Springer-Verlag}, 14441 address = {New York}, 14442 year = {1994} 14443} 14444 14445@Article{ hackbusch1980fast, 14446 title = {Fast solution of elliptic control problems}, 14447 author = {Hackbusch, W.}, 14448 journal = {Journal of Optimization Theory and Applications}, 14449 volume = {31}, 14450 number = {4}, 14451 pages = {565--581}, 14452 year = {1980}, 14453 publisher = {Springer} 14454} 14455 14456@Book{ hackbusch1985multi, 14457 title = {{Multi-grid methods and applications}}, 14458 author = {Hackbusch, W.}, 14459 isbn = {3540127615}, 14460 issn = {0179-3632}, 14461 year = {1985}, 14462 publisher = {Springer Verlag} 14463} 14464 14465@Book{ axelsson94, 14466 author = {Owe Axelsson}, 14467 title = {Iterative Solution Methods}, 14468 publisher = {Cambridge University Press}, 14469 address = {Cambridge}, 14470 year = {1994} 14471} 14472 14473@Book{ saad96, 14474 author = {Yousef Saad}, 14475 title = {Iterative Methods for Sparse Linear Systems}, 14476 publisher = {PWS Publishing Company}, 14477 address = {Boston}, 14478 year = {1996} 14479} 14480 14481@Book{ saad2003, 14482 title = {Iterative Methods for Sparse Linear Systems}, 14483 author = {Saad, Yousef}, 14484 doi = {10.1016/S1570-579X(01)80025-2}, 14485 edition = {2nd}, 14486 publisher = {SIAM}, 14487 year = {2003} 14488} 14489 14490@Book{ vandervorst03, 14491 author = {Henk A. {van der Vorst}}, 14492 title = {Iterative Krylov Methods for Large Linear Systems}, 14493 publisher = {Cambridge Monographs on Applied ahd Computational Mathematics}, 14494 year = {2003} 14495} 14496 14497@Book{ koniges00, 14498 editor = {Alice E. Koniges}, 14499 title = {Industrial Strength Parallel Computing}, 14500 publisher = {Morgan Kaufmann Publishers}, 14501 address = {San Francisco}, 14502 year = {2000} 14503} 14504 14505@Misc{ fftw-web-page, 14506 key = {Fftw}, 14507 title = {{FFTW} {Web} page}, 14508 note = {\texttt{http://www.fftw.org/}}, 14509 annote = {fast FFT. Parallel versions with MPI and Cilk} 14510} 14511 14512@InProceedings{ frigojohnson93, 14513 author = {Matteo Frigo and Steven G. Johnson}, 14514 title = {The Design and Implementation of {FFTW3}}, 14515 booktitle = {Proceedings of the IEEE}, 14516 volume = {93}, 14517 number = {2}, 14518 pages = {216--231}, 14519 year = {2005} 14520} 14521 14522@Book{ kelley95, 14523 author = {C. T. Kelley}, 14524 title = {Iterative Methods for Linear and Nonlinear Equations}, 14525 year = {1995}, 14526 publisher = {SIAM}, 14527 address = {Philadelphia} 14528} 14529 14530@Unpublished{ spai-web-page, 14531 title = {{SPAI} {W}eb {P}age}, 14532 note = {http://www.sam.math.ethz.ch/\~{ }grote/spai/}, 14533 author = {Steven Bernard and Marcus Grote}, 14534 institution = {NASA Ames Research Center and ETH Zurich} 14535} 14536 14537@Article{ gh97, 14538 author = {M. J. Grote and T. Huckle}, 14539 title = {Parallel Preconditioning with Sparse Approximate Inverses}, 14540 year = {1997}, 14541 journal = {SIAM J. of Scient. Comput.}, 14542 volume = {18}, 14543 pages = {838-853} 14544} 14545 14546@Article{ zhang96, 14547 author = {Wen Zhang}, 14548 title = {Using {MOL} to Solve a high order nonlinear {PDE} with a moving boundary in the 14549 simulation of a sintering process}, 14550 year = {1996}, 14551 journal = {Appl. Numer. Math.}, 14552 volume = {20}, 14553 pages = {235-244} 14554} 14555 14556@Article{ zhang98, 14557 author = {Wen Zhang and Ian Gladwell}, 14558 title = {The sintering of two particles by surface and grain boundary diffusion - a 14559 three-dimensional numerical study}, 14560 journal = {Comp. Mater. Sci.}, 14561 year = {1998}, 14562 volume = {12} 14563} 14564 14565@InProceedings{ mollerschwartzbach01, 14566 author = {Anders M\o{}ller and Michael I. Schwartzbach}, 14567 title = {The Pointer Assertion Logic Engine}, 14568 booktitle = {ACM Proceedings of PLDI'01}, 14569 year = {2001} 14570} 14571 14572@InProceedings{ klarlandschwartzbach97, 14573 author = {Nils Klarland and Michael I. Schwartzbach}, 14574 title = {A Domain-Specific Languages for Regular Sets of Strings and Trees}, 14575 booktitle = {Proceedings of the Conference on Domain-Specific Languages}, 14576 publisher = {USENIX}, 14577 month = oct, 14578 year = {1997}, 14579 address = {Santa Barbara, CA} 14580} 14581 14582@InProceedings{ conselmarlet98, 14583 author = {C. Consel and R. Marlet}, 14584 title = {Architecturing software using a methodology for language development}, 14585 booktitle = {Proceedings of the 10th International Symposium on Programming Languages, 14586 Implementations, Logics and Programs}, 14587 year = {1998}, 14588 pages = {170-174}, 14589 month = sep, 14590 address = {Pisa, Italy} 14591} 14592 14593@Misc{ sundials:homepage, 14594 author = {C. {Woodward et al.}}, 14595 title = {{SUNDIALS {W}eb page}}, 14596 howpublished = {\url{https://computation.llnl.gov/casc/sundials/main.html}} 14597} 14598 14599@article{gardner2022sundials, 14600 title = {Enabling new flexibility in the {SUNDIALS} suite of nonlinear and differential/algebraic equation solvers}, 14601 author = {Gardner, David J and Reynolds, Daniel R and Woodward, Carol S and Balos, Cody J}, 14602 journal = {ACM Transactions on Mathematical Software (TOMS)}, 14603 publisher = {ACM}, 14604 year = {2022}, 14605 doi = {10.1145/3539801} 14606} 14607 14608@Misc{ sundials-user-ref, 14609 title = {{SUNDIALS}: Suite of Nonlinear and Differential/Algebraic Equation Solvers}, 14610 note = {See \url{http://www.llnl.gov/CASC/sundials}}, 14611 author = {Allan Hindmarsh and Peter Brown and Keith Grant and Steven Lee and Radu Serban 14612 and Dan Shumaker and Carol Woodward}, 14613 institution = {Center for Applied Scientific Computing, Lawrence Livermore National Laboratory}, 14614 number = {UCRL-JP-200037}, 14615 year = {2003} 14616} 14617 14618@Article{ sundials05, 14619 author = {A. Hindmarsh and P. Brown and K. Grant and S. Lee and R. Serban and D. Shumaker 14620 and C. Woodward}, 14621 title = {{SUNDIALS:} Suite of Nonlinear and Differential/Algebraic Equation Solvers}, 14622 journal = {ACM Transactions on Mathematical Software}, 14623 volume = {31}, 14624 number = {3}, 14625 pages = {363--396}, 14626 year = {2005} 14627} 14628 14629@InProceedings{ serban2005cvodes, 14630 title = {{CVODES}, the sensitivity-enabled {ODE} solver in {SUNDIALS}}, 14631 author = {Serban, Radu and Hindmarsh, Alan C}, 14632 booktitle = {Proceedings of the 5th International Conference on Multibody Systems, Nonlinear 14633 Dynamics and Control, Long Beach, CA}, 14634 year = {2005} 14635} 14636 14637@Article{ pvode99, 14638 author = {G. Byrne and A. Hindmarsh}, 14639 title = {{PVODE}, An {ODE} Solver for Parallel Computers}, 14640 journal = {Int. J. High Perf. Comput. Apps.}, 14641 volume = {13}, 14642 number = {4}, 14643 year = {1999}, 14644 pages = {354 -- 365} 14645} 14646 14647@Article{ cvode95, 14648 author = {S. Cohen and A. Hindmarsh}, 14649 title = {{CVODE}, A Stiff/Nonstiff {ODE} Solver in {C}}, 14650 journal = {Computers in Physics}, 14651 volume = {10}, 14652 number = {2}, 14653 year = {1996}, 14654 pages = {138 -- 143} 14655} 14656 14657@TechReport{ ifpack, 14658 title = {Robust Algebraic Preconditioners using {IFPACK} 3.0}, 14659 author = {Marzio Sala and Michael Heroux}, 14660 institution = {Sandia National Laboratories}, 14661 number = {SAND2005-0662}, 14662 year = {2005} 14663} 14664 14665@TechReport{ kinsol-user-ref, 14666 title = {User Documentation for {KINSOL}, A Nonlinear Solver for Sequential and Parallel 14667 Computers}, 14668 author = {Allan Taylor and Alan Hindmarsh}, 14669 institution = {Center for Applied Scientific Computing, Lawrence Livermore National Laboratory}, 14670 number = {UCRL-ID-131185}, 14671 year = {1998} 14672} 14673 14674@Article{ fiardmanteuffelmccormick98, 14675 author = {J.-M. Fiard and T. Manteuffel and S. McCormick}, 14676 title = {First-order system least squares {(FOSLS)} for convection-diffusion problems: 14677 numerical results}, 14678 journal = {SIAM J. Sci. Comp.}, 14679 year = {1998}, 14680 volume = {19}, 14681 pages = {1958--1979} 14682} 14683 14684@InProceedings{ vuduc02, 14685 author = {Richard Vuduc and James W. Demmel and Katherine A. Yelick and Shoaib Kamil and 14686 Rajesh Nishtala and Benjamin Lee}, 14687 title = {Performance Optimizations and Bounds for Sparse Matrix-Vector Multiply}, 14688 booktitle = {Proceedings of Supercomputing}, 14689 year = {2002}, 14690 month = nov, 14691 address = {Baltimore} 14692} 14693 14694@Article{ beckerbraackrannacher1999, 14695 title = {Numerical simulation of laminar flames at low Mach number by adaptive finite 14696 elements}, 14697 author = {Roland Becker and Malte Braack and Rolf Rannacher}, 14698 journal = {Combustion Theory and Modelling}, 14699 volume = {3}, 14700 pages = {503--534}, 14701 year = {1999} 14702} 14703 14704@Article{ beckerrannacher01, 14705 author = {R. Becker and R. Rannacher}, 14706 title = {An optimal control approach to a posteriori error estimation in finite element 14707 methods}, 14708 journal = {Acta Numerica}, 14709 year = {2001}, 14710 volume = {10}, 14711 pages = {1--102} 14712} 14713 14714@Article{ babuskamiller84a, 14715 author = {I. Babu$\check{s}$ka and A.D. Miller}, 14716 title = {The post-processing approach in the finite element method, {I}: Calculations of 14717 displacements, stresses, and other higher derivatives of the displacements}, 14718 journal = {Int. J. Numer. Meth. Eng.}, 14719 year = {1984}, 14720 volume = {20}, 14721 pages = {1085--1109} 14722} 14723 14724@Article{ babuskamiller84b, 14725 author = {I. Babu$\check{s}$ka and A.D. Miller}, 14726 title = {The post-processing approach in the finite element method, {II}: The calculation 14727 of stress intensity factors}, 14728 journal = {Int. J. Numer. Meth. Eng.}, 14729 year = {1984}, 14730 volume = {20}, 14731 pages = {1111--1129} 14732} 14733 14734@Article{ babuskamiller84c, 14735 author = {I. Babu$\check{s}$ka and A.D. Miller}, 14736 title = {The post-processing approach in the finite element method, {III}: A posteriori 14737 error estimation and adaptive mesh refinement}, 14738 journal = {Int. J. Numer. Meth. Eng.}, 14739 year = {1984}, 14740 volume = {20}, 14741 pages = {2311--2324} 14742} 14743 14744@Unpublished{ jtb-web-page, 14745 title = {{The Java Tree Builder}}, 14746 note = {See \url{http://www.cs.purdue.edu/jtb}}, 14747 author = {Jens Palsberg}, 14748 institution = {Purdue University} 14749} 14750 14751@Unpublished{ palsberg98, 14752 title = {Why Visitors?}, 14753 note = {See \url{http://www.cs.purdue.edu/jtb/whyvisitors}}, 14754 author = {Jens Palsberg}, 14755 institution = {Purdue University}, 14756 year = {1998} 14757} 14758 14759@Unpublished{ ply-web-page, 14760 title = {{PLY (Python Lex-Yacc)}}, 14761 note = {\url{http://systems.cs.chicago.edu/ply}}, 14762 author = {David Beazley}, 14763 institution = {University of Chicago} 14764} 14765 14766@Misc{ adic-web-page, 14767 title = {{ADIC Web page}}, 14768 note = {\url{http://www.mcs.anl.gov/autodiff}}, 14769 author = {Paul Hovland and Uwe Naumann and Boyana Norris}, 14770 institution = {Argonne National Laboratory} 14771} 14772 14773@Article{ naumann02, 14774 author = {Uwe Naumann}, 14775 title = {Optimal accumulation of {J}acobian matrices by elimination methods on the dual 14776 computational graph}, 14777 journal = {Mathematical Programming (to appear)}, 14778 note = {Preprint ANL/MCS-P944-0402, Argonne National Laboratory, April 2002}, 14779 year = {2003} 14780} 14781 14782@Article{ kaper1, 14783 author = {H. G. Kaper and T. J. Kaper}, 14784 title = {Asymptotic Analysis of Two Reduction Methods for Systems of Chemical Reactions}, 14785 journal = {Physica D}, 14786 year = {2002}, 14787 pages = {66--93}, 14788 volume = {165} 14789} 14790 14791@Misc{ veltisto-web-page, 14792 author = {George Biros}, 14793 title = {{Veltisto Web page}}, 14794 note = {\url{http://www.cs.nyu.edu/~biros/veltisto}} 14795} 14796 14797@Article{ karypiskumar98, 14798 author = {George Karypis and Vipin Kumar}, 14799 title = {A Parallel Algorithm for Multilevel Graph Partitioning and Sparse Matrix 14800 Ordering}, 14801 journal = {Journal of Parallel and Distributed Computing}, 14802 volume = {48}, 14803 pages = {71--85}, 14804 year = {1998} 14805} 14806 14807@TechReport{ karypiskumar97, 14808 author = {Karypis, George and Kumar, V.}, 14809 institution = {Department of Computer Science, University of Minnesota}, 14810 keywords = {graph partitioning; ParMetis}, 14811 note = {http://www.cs.umn.edu/~metis}, 14812 number = {97-060}, 14813 title = {{ParMETIS}: Parallel graph partitioning and sparse matrix ordering library}, 14814 year = {1997} 14815} 14816 14817@Misc{ parmetis-web-page, 14818 author = {George {Karypis et al.}}, 14819 title = {{ParMETIS Web page}}, 14820 note = {\url{http://www.cs.umn.edu/~karypis/metis/parmetis}}, 14821 year = {2005} 14822} 14823 14824@Misc{ sparskit-web-page, 14825 author = {Yousef {Saad et al.}}, 14826 title = {{SPARSKIT Web page}}, 14827 note = {\url{http://www.cs.umn.edu/~saad/software/SPARSKIT/sparskit.html}} 14828} 14829 14830@Misc{ dscpack-web-page, 14831 author = {Padma Raghavan}, 14832 title = {{DSCPACK Web page}}, 14833 note = {\url{http://www.cse.psu.edu/~raghavan/Dscpack}} 14834} 14835 14836@Misc{ gaussian-web-page, 14837 author = {}, 14838 title = {{Gaussian Web page}}, 14839 note = {\url{http://gaussian.com}}, 14840 key = {{Gaussian} {Web} page} 14841} 14842 14843@Book{ lapack-user-guide, 14844 author = {E. Anderson and Z. Bai and C. Bischof and S. Blackford and J. Demmel and J. 14845 Dongarra and J. Du Cris and A. Greenbaum and S. Hammarling and A. McKenney and D. 14846 Sorensen}, 14847 title = {LAPACK Users' Guide, Third Edition}, 14848 publisher = {SIAM}, 14849 year = {1999} 14850} 14851 14852@Manual{ nwchem4.1, 14853 author = {High Performance Computational Chemistry Group}, 14854 title = {{NWChem}, A Computational Chemistry Package for Parallel Computers, Version 4.1}, 14855 year = {2002}, 14856 organization = {Pacific Northwest National Laboratory}, 14857 address = {Richland, Washington 99325-0999 USA}, 14858 note = {See \url{http://www.emsl.pnl.gov/pub/docs/nwchem/}} 14859} 14860 14861@TechReport{ tchem, 14862 title = {{TC}hem: {A} Software Toolkit for the Analysis of Complex Kinetic Models}, 14863 author = {Cosmin Safta and Habib Najm and Omar Knio}, 14864 institution = {Sandia National Laboratories}, 14865 number = {SAND2011-3282}, 14866 year = {2011} 14867} 14868 14869@Misc{ scidac-web-page, 14870 author = {}, 14871 title = {{{SciDAC Initiative Web page}}}, 14872 note = {\url{http://www.osti.gov/scidac}}, 14873 key = {{SciDAC Initiative Web page}} 14874} 14875 14876@Misc{ cmrs:homepage, 14877 author = {Amitava {Bhattacharjee (PI)}}, 14878 title = {{Center for Magnetic Reconnection Studies}}, 14879 howpublished = {\url{http://www.physics.uiowa.edu/cmrs}} 14880} 14881 14882@Misc{ tops:homepage, 14883 author = {David {Keyes (PI)}}, 14884 title = {{Towards Optimal Petascale Simulations (TOPS) Center}}, 14885 howpublished = {\url{http://scalablesolvers.org}} 14886} 14887 14888@Misc{ tstt:homepage, 14889 author = {David Brown and Jim Glimm and Lori Freitag}, 14890 title = {{Terascale Simulation Tools and Technology (TSTT) Center}}, 14891 howpublished = {\url{http://www.tstt-scidac.org}}, 14892 year = {2005} 14893} 14894 14895@Misc{ petsc:applications, 14896 author = {B. F. {Smith et al.}}, 14897 title = {{Scientific Applications Using {PETSc}}}, 14898 howpublished = {\url{http://www.mcs.anl.gov/petsc/publications}} 14899} 14900 14901@Misc{ petsc:users, 14902 author = {B. F. {Smith et al.}}, 14903 title = {{PETSc User Statistics}}, 14904 howpublished = {\url{http://www.mcs.anl.gov/petsc/miscellaneous/usage.html}} 14905} 14906 14907@Misc{ cemm:homepage, 14908 author = {Steve {Jardin (PI)}}, 14909 title = {{Center for Extended MHD Modeling}}, 14910 howpublished = {\url{http://w3.pppl.gov/CEMM}} 14911} 14912 14913@Misc{ m3d:homepage, 14914 author = {Steve {Jardin et al.}}, 14915 title = {{M3D Web page}}, 14916 howpublished = {\url{http://w3.pppl.gov/m3d}} 14917} 14918 14919@Misc{ nimrod:homepage, 14920 author = {Carl R. {Sovinec et al.}}, 14921 title = {{NIMROD Web page}}, 14922 howpublished = {http://nimrodteam.org} 14923} 14924 14925@Misc{ grace-web-page, 14926 author = {Manish {Parashar et al.}}, 14927 title = {{GrACE Web Page}}, 14928 howpublished = {\url{http://www.caip.rutgers.edu/~parashar/TASSL/Projects/GrACE}} 14929} 14930 14931@Misc{ accel1, 14932 title = {Advanced Computing for 21st Century Accelerator Science and Technology Web page}, 14933 howpublished = {\url{http://scidac.nersc.gov/accelerator/}}, 14934 author = {K. Ko and R. Ryne (PIs)} 14935} 14936 14937@Unpublished{ katzspiegelman03, 14938 author = {Richard F. Katz and Marc Spiegelman}, 14939 title = {A semi-{L}agrangian {C}rank-{N}icholson algorithm for the numerical solution of 14940 advection-diffusion problems}, 14941 note = {Columbia University, in preparation} 14942} 14943 14944@Misc{ acts:homepage, 14945 author = {}, 14946 title = {{Advanced CompuTational Software (ACTS) Web page}}, 14947 howpublished = {\url{http://acts.nersc.gov}}, 14948 key = {{Advanced CompuTational Software (ACTS) Web page}} 14949} 14950 14951@Article{ superlu99, 14952 author = {James W. Demmel and Stanley C. Eisenstat and John R. Gilbert and Xiaoye S. Li and 14953 Joseph W. H. Liu}, 14954 title = {A supernodal approach to sparse partial pivoting}, 14955 journal = {SIAM J. Matrix Analysis and Applications}, 14956 year = {1999}, 14957 volume = {20}, 14958 number = {3}, 14959 pages = {720-755} 14960} 14961 14962@Misc{ superlu:homepage, 14963 author = {J. Demmel and J. Gilbert and X. Li}, 14964 title = {{SuperLU Web page}}, 14965 howpublished = {http://crd.lbl.gov/\~xiaoye/SuperLU} 14966} 14967 14968@InProceedings{ ccf98, 14969 author = {E. Chow and A. Cleary and R. Falgout}, 14970 title = {Design of the hypre Preconditioner Library}, 14971 booktitle = {Proceedings of the SIAM Workshop on Object Oriented Methods for Inter-operable 14972 Scientific and Engineering Computing}, 14973 publisher = {SIAM}, 14974 year = {1999} 14975} 14976 14977@TechReport{ hypre-users-manual, 14978 author = {R. Falgout}, 14979 title = {{hypre} Users Manual}, 14980 number = {Revision 2.28}, 14981 institution = {Lawrence Livermore National Laboratory}, 14982 year = {2023}, 14983 url = {https://hypre.readthedocs.io/} 14984} 14985 14986@Misc{ hypre:homepage, 14987 author = {R. Falgout}, 14988 title = {{hypre Web page}}, 14989 howpublished = {\url{https://www.llnl.gov/casc/hypre}} 14990} 14991 14992@InProceedings{ trilinos:gpu, 14993 author = {C.G. Baker and M.A. Heroux. and H.C. Edwards and A.B. Williams}, 14994 title = {A Light-weight API for Portable Multicore Programming}, 14995 booktitle = {18th Euromicro International Conference on Parallel, Distributed and 14996 Network-Based Processing (PDP)}, 14997 pages = {601--606}, 14998 publisher = {IEEE}, 14999 year = {2010} 15000} 15001 15002@InProceedings{ heroux2004design, 15003 title = {The design of {T}rilinos}, 15004 author = {Heroux, Michael A and Sala, Marzio}, 15005 booktitle = {International Workshop on Applied Parallel Computing}, 15006 pages = {620--628}, 15007 year = {2004}, 15008 organization = {Springer} 15009} 15010 15011@Misc{ trilinos:homepage, 15012 author = {M. {Heroux et al.}}, 15013 title = {{Trilinos Web page}}, 15014 howpublished = {{\tt http://trilinos.sandia.gov/}} 15015} 15016 15017@Article{ trilinos:overview, 15018 author = {Michael A. Heroux and Roscoe A. Bartlett and Vicki E. Howle and Robert J. 15019 Hoekstra and Jonathan J. Hu and Tamara G. Kolda and Richard B. Lehoucq and Kevin 15020 R. Long and Roger P. Pawlowski and Eric T. Phipps and Andrew G. Salinger and Heidi 15021 K. Thornquist and Ray S. Tuminaro and James M. Willenbring and Alan Williams and 15022 Kendall S. Stanley}, 15023 title = {An overview of the {T}rilinos project}, 15024 journal = {ACM Transactions on Mathematical Software}, 15025 volume = {31}, 15026 number = {3}, 15027 year = {2005}, 15028 issn = {0098-3500}, 15029 pages = {397--423}, 15030 publisher = {ACM Press}, 15031 doi = {10.1145/1089014.1089021} 15032} 15033 15034@Misc{ rythmos:homepage, 15035 author = {T. Coffey and R. Bartlett}, 15036 title = {Rythmos: Transient Integration of Differential Equations}, 15037 howpublished = {\url{http://trilinos.sandia.gov/packages/rythmos}} 15038} 15039 15040@Misc{ triangle:homepage, 15041 author = {J. {Shewchuk}}, 15042 title = {{Triangle: A Two-Dimensional Quality Mesh Generator and Delaunay Triangulator}}, 15043 howpublished = {\url{http://www-2.cs.cmu.edu/~quake/triangle.html}}, 15044 year = {2005} 15045} 15046 15047@Misc{ tetgen:homepage, 15048 author = {Hang {Si}}, 15049 title = {{TetGen: A Quality Tetrahedral Mesh Generator and Three-Dimensional Delaunay 15050 Triangulator}}, 15051 howpublished = {\url{http://tetgen.berlios.de}}, 15052 year = {2005} 15053} 15054 15055@Misc{ opencascade:homepage, 15056 author = {{OpenCASCADE SAS}}, 15057 title = {{Open CASCADE Technology (OCCT)}}, 15058 howpublished = {\url{https://dev.opencascade.org/}}, 15059 year = {2024} 15060} 15061 15062@Misc{ eigen:homepage, 15063 author = {Benoit Jacob and Ga\"el Guennebaud}, 15064 title = {{Eigen} {W}eb page}, 15065 key = {Jacob}, 15066 url = {http://eigen.tuxfamily.org/}, 15067 howpublished = {\url{http://eigen.tuxfamily.org/}}, 15068 year = {2015} 15069} 15070 15071@Misc{ dune:homepage, 15072 author = {Peter Bastian and Markus Blatt and Andreas Dedner and Christian Engwer and Jorrit 15073 Fahlke and Christoph Gersbacher and Carsten Gr\"aser and Christoph Gr\"uninger 15074 Robert Kl\"ofkorn and Steffen M\"uthing and Martin Nolte and Mario Ohlberger and 15075 Oliver Sander}, 15076 title = {{DUNE} {W}eb page}, 15077 key = {Bastian}, 15078 url = {http://www.dune-project.org/}, 15079 howpublished = {\url{http://www.dune-project.org/}}, 15080 year = {2015} 15081} 15082 15083@Misc{ thrust, 15084 author = {N. Bell and J. Hoberock}, 15085 title = {The {T}hrust Library}, 15086 howpublished = {{\tt http://code.google.com/p/thrust/}}, 15087 year = {2010} 15088} 15089 15090@Misc{ cusp, 15091 author = {N. Bell and M. Garland}, 15092 title = {The {C}usp Library}, 15093 howpublished = {{\tt http://code.google.com/p/cusp-library/}}, 15094 year = {2010} 15095} 15096 15097@Misc{ cig:homepage, 15098 author = {M. {Gurnis et al.}}, 15099 title = {{Computational Infrastructure for Geodynamics}}, 15100 howpublished = {\url{http://www.geodynamics.org}} 15101} 15102 15103@Article{ maltsevselkov00, 15104 author = {R. Overbeek and N. Larsen and G. Pusch and M. D'Souza and E. Selkov Jr. and N. 15105 Kyrpides and M. Fonstein and N. Maltsev and E. Selkov}, 15106 title = {{WIT}: {I}ntegrated system for high-throughput genome sequence analysis and 15107 metabolic reconstruction}, 15108 journal = {Nucleic Acids Res.}, 15109 year = {2000}, 15110 month = jan, 15111 pages = {123-125}, 15112 volume = {28}, 15113 number = {1} 15114} 15115 15116@Article{ more:coloring, 15117 author = {Thomas F. Coleman and Jorge J. Mor\'{e}}, 15118 title = {Estimation of sparse {J}acobian matrices and graph coloring problems}, 15119 journal = {SIAM Journal on Numerical Analysis}, 15120 year = {1983}, 15121 month = feb, 15122 pages = {187--209}, 15123 volume = {20}, 15124 number = {1} 15125} 15126 15127@Article{ selkovmaltsev97, 15128 author = {E. Selkov and N. Maltsev and G.J. Olsen and R. Overbeek and W. B. Whitman}, 15129 title = {A reconstruction of the metabolism of Methanococcus jannaschii from sequence 15130 data}, 15131 journal = {Gene}, 15132 year = {1997}, 15133 pages = {GC11-GC26}, 15134 volume = {197}, 15135 number = {1-2} 15136} 15137 15138@Unpublished{ rocketcenter, 15139 title = {Center for Simulation of Advanced Rockets}, 15140 note = {http://www.csar.uiuc.edu}, 15141 institution = {University of Illinois at Urbana-Champaign} 15142} 15143 15144@Article{ kirby03, 15145 title = {A posteriori error estimates for the mixed hybrid finite element method}, 15146 author = {Robert C Kirby}, 15147 journal = {Computational Geosciences}, 15148 volume = {7}, 15149 pages = {197--214}, 15150 note = {\url{http://www.ices.utexas.edu/~clint/nsf/apostmfem.ps}}, 15151 year = {2003} 15152} 15153 15154@Article{ kirby2003b, 15155 title = {On the convergence of high resolution methods with multiple time scales for 15156 hyperbolic conservation laws}, 15157 author = {Robert C Kirby}, 15158 journal = {Mathematics of computation}, 15159 volume = {72}, 15160 number = {243}, 15161 pages = {1239--1250}, 15162 year = {2003} 15163} 15164 15165@Article{ dawsonkirby2001, 15166 title = {High resolution schemes for conservation laws with locally varying time steps}, 15167 author = {Clint Dawson and Robert C Kirby}, 15168 journal = {SIAM Journal on Scientific Computing}, 15169 volume = {22}, 15170 number = {6}, 15171 pages = {2256--2281}, 15172 year = {2001}, 15173 publisher = {SIAM} 15174} 15175 15176@Article{ dawsonkirby1999, 15177 title = {Solution of parabolic equations by backward Euler-mixed finite element methods on 15178 a dynamically changing mesh}, 15179 author = {Clint Dawson and Robert C Kirby}, 15180 journal = {SIAM Journal on Numerical Analysis}, 15181 volume = {37}, 15182 number = {2}, 15183 pages = {423--442}, 15184 year = {1999}, 15185 publisher = {SIAM} 15186} 15187 15188@Article{ barthlarson00, 15189 author = {T. J. Barth and M. G. Larson}, 15190 title = {{\em A posteriori} Error Estimation for Discontiuous {G}alerkin Approximations of 15191 Hyperbolic Systems}, 15192 journal = {LNCS}, 15193 year = {2000}, 15194 volume = {11}, 15195 publisher = {Spinger-Verlag} 15196} 15197 15198@Article{ xu1, 15199 author = {J. Xu}, 15200 title = {Iterative Methods by Space Decomposition and Subspace Correction}, 15201 journal = {SIAM Review}, 15202 volume = {34}, 15203 pages = {581--613}, 15204 year = {1992} 15205} 15206 15207@Article{ brandt77, 15208 author = {Achi Brandt}, 15209 title = {Multi-Level Adaptive Solutions to Boundary-Value Problems}, 15210 journal = {Mathematics of Computation}, 15211 month = apr, 15212 year = {1977}, 15213 pages = {333--390}, 15214 volume = {31}, 15215 number = {138}, 15216 doi = {10.2307/2006422} 15217} 15218 15219@Article{ brandt1979multigrid, 15220 title = {{Multigrid solutions to elliptic flow problems}}, 15221 author = {Brandt, A. and Dinar, N.}, 15222 journal = {Numerical Methods for Partial Differential Equations}, 15223 pages = {53--147}, 15224 year = {1979} 15225} 15226 15227@InCollection{ brandt1979singular, 15228 title = {Multi-Level Adaptive Techniques(MLAT) for singular-perturbation problems}, 15229 author = {Achi Brandt}, 15230 booktitle = {Numerical Analysis of Singular Perturbation Problems}, 15231 editor = {Hemker, Pieter W. and Miller, John J.H.}, 15232 pages = {53--142}, 15233 year = {1979}, 15234 publisher = {Academic Press} 15235} 15236 15237@Article{ amge1, 15238 author = {M. Brezina and A. J. Cleary and R. D. Falgout and V. E. Henson and J. E. Jones 15239 and T. A. Manteuffel and S. F. McCormick and J. W. Ruge}, 15240 title = {Algebraic Multigrid Based on Element Interpolation (AMGe)}, 15241 journal = {SIAM J. Scientific Computing}, 15242 volume = {22}, 15243 pages = {1570--1592}, 15244 year = {2000} 15245} 15246 15247@Book{ bramble1, 15248 author = {J. H. Bramble}, 15249 title = {Multigrid Methods}, 15250 publisher = {Longman Scientific and Technical}, 15251 address = {Essex, England}, 15252 year = {1993} 15253} 15254 15255@Book{ arpack98, 15256 author = {R. B. Lehoucq and D. C. Sorensen and C. Yang}, 15257 title = {ARPACK, Users' Guide}, 15258 publisher = {SIAM}, 15259 year = {1998} 15260} 15261 15262@Article{ bbder96, 15263 author = {R. Barrett and M. Berry and J. Dongarra and V. Eijkhout and C. Romine}, 15264 title = {Algorithmic bombardment for the iterative solution of linear systems: A 15265 polyIterative approach}, 15266 journal = {J. of Computational and Applied Mathematics}, 15267 year = {1996}, 15268 volume = {74}, 15269 pages = {91--110} 15270} 15271 15272@Article{ egks94, 15273 author = {A. Ern and V. Giovangigli and D. E. Keyes and M. D. Smooke}, 15274 title = {Towards polyalgorithmic linear system solvers for nonlinear elliptic problems,}, 15275 journal = {SIAM J. Scientific Computing}, 15276 year = {1994}, 15277 volume = {15}, 15278 number = {3}, 15279 pages = {681--703} 15280} 15281 15282@Article{ dftb02, 15283 author = {P. Zapol and M. Sternberg and L.A. Curtiss and Th. Frauenheim and D.M. Gruen}, 15284 title = {Tight-binding molecular-dynamics simulation of impurities in ultrananocrystalline 15285 diamond grain boundaries,}, 15286 journal = {Phys. Rev}, 15287 year = {2002}, 15288 volume = {B65}, 15289 pages = {045403} 15290} 15291 15292@InBook{ lsa, 15293 author = {R. Bramley and D. Gannon and T. Stuckey and J. Villacis and J. Balasubramanian 15294 and E. Akman and F. Berg and S. Diwan and M. Govindaraju}, 15295 title = {The linear system analyzer}, 15296 series = {enabling technologies for computational science}, 15297 year = {2002}, 15298 publisher = {Kluwer}, 15299 location = {Dordrecht} 15300} 15301 15302@Article{ kk97, 15303 author = {Carl T. Kelley and David E. Keyes}, 15304 title = {Convergence analysis of pseudo-transient continuation}, 15305 journal = {SIAM J. Numerical Analysis}, 15306 year = {1998}, 15307 volume = {35}, 15308 pages = {508--523} 15309} 15310 15311@Article{ swtm01, 15312 author = {R. Shepard and A. F. Wagner and J. L. Tilson and M. Minkoff}, 15313 journal = {Journal of Computational Physics}, 15314 year = {2001}, 15315 volume = {172}, 15316 number = {2}, 15317 pages = {472--514}, 15318 title = {The Subspace Projected Approximate Matrix {(SPAM)} Modification of the {D}avidson 15319 Method} 15320} 15321 15322@TechReport{ zhou03, 15323 author = {Y. Zhou}, 15324 title = {Eigenvalue Computation from the Optimization Perspective: On {Jacobi-Davidson, 15325 IIGD, RQI and Newton} Updates}, 15326 institution = {Argonne National Laboratory}, 15327 number = {ANL/MCS-P1074-0803}, 15328 note = {Submitted to Numerical Linear Algebra with Applications}, 15329 year = {2003} 15330} 15331 15332@Unpublished{ mtwm03, 15333 author = {G. G. Maisuradze and D. L. Thompson and A. F. Wagner and M. Minkoff}, 15334 title = {Interpolating moving least squares methods for fitting potential energy surfaces: 15335 Detailed analysis of one-dimensional applications}, 15336 note = {to appear in the Journal of Chemical Physics}, 15337 year = {2003} 15338} 15339 15340@Article{ singhjosephheslaglowinskipan00, 15341 author = {P. Singh and D. D. Joseph and T. Hesla and R. Glowinski and T.-W. Pan}, 15342 title = {A distributed {L}agrange multiplier/fictitious domain model for viscoelastic 15343 particulate flows}, 15344 journal = {J. Non-Newtonian Fluid Mech.}, 15345 volume = {91}, 15346 pages = {165--188}, 15347 year = {2000} 15348} 15349 15350@Book{ joseph02, 15351 author = {Daniel D. Joseph}, 15352 title = {Interrogations of Direct Numerical Simulations of Sloid-Liquid Flows}, 15353 publisher = {Springer-Verlag}, 15354 month = mar, 15355 year = {2002}, 15356 note = {\url{http://www.efluids.com/efluids/books/joseph.htm}} 15357} 15358 15359@Misc{ triangle-web-page, 15360 author = {Jonathan R. Shewchuk}, 15361 title = {{Triangle Web} page}, 15362 note = {\url{http://www-2.cs.cmu.edu/~quake/triangle.html}} 15363} 15364 15365@InCollection{ shewchuk96, 15366 author = {Jonathan R. Shewchuk}, 15367 title = {Triangle: {E}ngineering a {2D} Quality Mesh Generator and {D}elaunay 15368 Triangulator}, 15369 booktitle = {Applied Computational Geometry: Towards Geometric Engineering}, 15370 editor = {Ming C. Lin and Dinesh Manocha}, 15371 series = {Lecture Notes in Computer Science}, 15372 volume = {1148}, 15373 publisher = {Springer-Verlag}, 15374 pages = {203--222}, 15375 month = may, 15376 year = {1996}, 15377 note = {From the First ACM Workshop on Applied Computational Geometry} 15378} 15379 15380@Article{ leaf1, 15381 author = {Transient Dynamics of Pinning of Domain Walls}, 15382 title = {G. K. Leaf and S. Obukhov and S. Scheidl and V. M. Vinokur}, 15383 journal = {J. Magnetism and Magnetic Materials}, 15384 volume = {241}, 15385 pages = {118--123}, 15386 year = {2002} 15387} 15388 15389@Article{ leaf2, 15390 author = {D. O. Gunter and H. G. Kaper and G. K. Leaf}, 15391 title = {Implicit Integration of the Time-Dependent {Ginzburg-Landau} Equations of 15392 Superconductivity}, 15393 journal = {SIAM J. Sci. Comp.}, 15394 volume = {23}, 15395 pages = {1944--1959}, 15396 year = {2002} 15397} 15398 15399@Article{ leaf3, 15400 author = { J. S. Jiang and H. G. Kaper and G. K. Leaf}, 15401 title = {Hysteresis in Layered Spring Magnets}, 15402 journal = { Discreet and Continuous Dynamical Systems, Series B}, 15403 volume = {1}, 15404 pages = {219--232}, 15405 year = {2001} 15406} 15407 15408@Article{ leaf4, 15409 author = {J. S. Jiang and S. D. Bader and H. G. Kaper and G. K. Leaf}, 15410 title = {Rotational Hysteresis of Exchange-Spring Magnets}, 15411 journal = {J. Phys. D Appl. Phys.}, 15412 volume = {35}, 15413 pages = {2339--2343}, 15414 year = {2002} 15415} 15416 15417@Article{ leaf5, 15418 author = {M. Grimsditch and G. K. Leaf and H. G. Kaper and D. A. Karpeev and R. E. Camley}, 15419 title = {Normal Modes of Spin Excitation in Magnetic Nanoparticles}, 15420 journal = {Submitted to Phys. Rev. B.}, 15421 note = {Submitted}, 15422 year = {2003} 15423} 15424 15425@Article{ graysumpternoidbarnes01, 15426 author = {S. K. Gray and B. G. Sumpter and D. W. Noid and M. d. Barnes}, 15427 title = {Quantum Mechanical Model of Localized Electrons on the Surface of Polymer 15428 Nanospheres}, 15429 journal = {Chem. Phys. Lett.}, 15430 volume = {333}, 15431 pages = {308--313}, 15432 year = {2001} 15433} 15434 15435@InProceedings{ petsc-efficient, 15436 author = {Satish Balay and William~D. Gropp and Lois Curfman McInnes and Barry~F. Smith}, 15437 title = {Efficient Management of Parallelism in Object Oriented Numerical Software 15438 Libraries}, 15439 booktitle = {Modern Software Tools in Scientific Computing}, 15440 editor = {E. Arge and A.~M. Bruaset and H.~P. Langtangen}, 15441 publisher = {Birkh{\"{a}}user Press}, 15442 pages = {163--202}, 15443 year = {1997} 15444} 15445 15446@Article{ mumps01, 15447 author = {Patrick R. Amestoy and Ian S. Duff and Jean-Yves L'Excellent and Jacko Koster}, 15448 title = {A fully asynchronous multifrontal solver using distributed dynamic scheduling}, 15449 journal = {SIAM Journal on Matrix Analysis and Applications}, 15450 volume = {23}, 15451 number = {1}, 15452 pages = {15--41}, 15453 year = {2001} 15454} 15455 15456@Article{ mumps19, 15457 title = {{Performance and Scalability of the Block Low-Rank Multifrontal Factorization on 15458 Multicore Architectures}}, 15459 author = {P.R. Amestoy and A. Buttari and J.-Y. L'Excellent and T. Mary}, 15460 journal = {ACM Transactions on Mathematical Software}, 15461 volume = {45}, 15462 issue = {1}, 15463 pages = {2:1--2:26}, 15464 year = {2019} 15465} 15466 15467@Article{ zoltan06, 15468 author = {Karen D. Devine and Erik G. Boman and Robert T. Heaphy and \"Umit V. 15469 \c{C}ataly\"urek and Robert H. Bisseling}, 15470 title = {Parallel Hypergraph Partitioning for Irregular Problems}, 15471 journal = {SIAM Parallel Processing for Scientific Computing}, 15472 month = feb, 15473 year = {2006} 15474} 15475 15476@Article{ lidemmel03, 15477 author = {Xiaoye S. Li and James W. Demmel}, 15478 title = {{SuperLU\_DIST}: a scalable distributed-memory sparse direct solver for 15479 unsymmetric linear systems}, 15480 journal = {ACM Transactions on Mathematical Software}, 15481 year = {2003}, 15482 month = jun, 15483 volume = {29}, 15484 number = {2}, 15485 pages = {110--140} 15486} 15487 15488@TechReport{ superlu, 15489 author = {James W. Demmel and John R. Gilbert and Xiaoye S. Li}, 15490 title = {{SuperLU} Users' Guide}, 15491 number = {LBNL-44289}, 15492 institution = {Lawrence Berkeley National Laboratory}, 15493 year = {2003}, 15494 url = {http://crd.lbl.gov/\~xiaoye/SuperLU/} 15495} 15496 15497@TechReport{ trilinos-overview03, 15498 title = {{An Overview of {T}rilinos}}, 15499 author = {Michael Heroux and Roscoe Bartlett and Vicki Howle Robert Hoekstra and Jonathan 15500 Hu and Tamara Kolda and Richard Lehoucq and Kevin Long and Roger Pawlowski and 15501 Eric Phipps and Andrew Salinger and Heidi Thornquist and Ray Tuminaro and James 15502 Willenbring and Alan Williams}, 15503 institution = {Sandia National Laboratories}, 15504 number = {SAND2003-2927}, 15505 year = {2003} 15506} 15507 15508@TechReport{ trilinos-users-guide, 15509 title = {{Trilinos} Users Guide}, 15510 author = {Michael A. Heroux and James M. Willenbring}, 15511 institution = {Sandia National Laboratories}, 15512 number = {SAND2003-2952}, 15513 url = {http://trilinos.sandia.gov/}, 15514 year = {2003} 15515} 15516 15517@Article{ pilut01, 15518 author = {David Hysom and Alex Pothen}, 15519 title = {A scalable parallel algorithm for incomplete factor preconditioning}, 15520 journal = {SIAM Journal on Scientific Computing}, 15521 volume = {22}, 15522 pages = {2194--2215}, 15523 year = {2001} 15524} 15525 15526@TechReport{ boomeramg00, 15527 author = {V.~E. Henson and U.~M. Yang}, 15528 title = {{BoomerAMG}: A parallel algebraic multigrid solver and preconditioner}, 15529 institution = {Lawrence Livermore National Laboratory}, 15530 number = {UCRL-JC-133948}, 15531 year = {2000} 15532} 15533 15534@InCollection{ baker2012scaling, 15535 title = {Scaling algebraic multigrid solvers: {O}n the road to exascale}, 15536 author = {Baker, Allison H. and Falgout, Robert D. and Gamblin, Todd and Kolev, Tzanio V. 15537 and Schulz, Martin and Yang, Ulrike Meier}, 15538 booktitle = {Competence in High Performance Computing 2010}, 15539 pages = {215--226}, 15540 year = {2012}, 15541 publisher = {Springer} 15542} 15543 15544@Article{ knollkeyes:04, 15545 author = {D. A. Knoll and D. E. Keyes}, 15546 year = {2004}, 15547 title = {Jacobian-free {Newton-Krylov} Methods: A Survey of Approaches and Applications}, 15548 journal = {J. Comp. Phys.}, 15549 volume = {193}, 15550 pages = {357-397} 15551} 15552 15553@Article{ chacon02, 15554 author = {Luis Chacon and Dana A. Knoll and John M. Finn}, 15555 title = {An implicit nonlinear reduced resistive {MHD} solver}, 15556 journal = {J. Comput. Phys}, 15557 volume = {188}, 15558 year = {2002}, 15559 pages = {15--36} 15560} 15561 15562@Article{ mousseau03, 15563 author = {V. A. Mousseau and D. A. Knoll}, 15564 title = {New Physics-based Preconditioning of Implicit Methods for Non-Equilibrium 15565 Radiation Diffusion}, 15566 journal = {J. Comput. Physics}, 15567 year = {2003} 15568} 15569 15570@Article{ mousseau00, 15571 author = {V. A. Mousseau and D. A. Knoll and W. J. Rider}, 15572 title = {Physics-based Preconditioning and the {Newton-Krylov} Method for Non-Equilibrium 15573 Radiation Diffusion}, 15574 journal = {J. Comput. Physics}, 15575 year = {2000}, 15576 pages = {743--765}, 15577 volume = {160} 15578} 15579 15580@Unpublished{ facets:homepage, 15581 author = {John {Cary (PI)}}, 15582 title = {{Framework Application for Core-Edge Transport Simulations (FACETS)}}, 15583 note = {Proto-FSP project, see \url{http://www.facetsproject.org}} 15584} 15585 15586@Unpublished{ cpes:homepage, 15587 author = {{C.S.} {Chang (PI)}}, 15588 title = {{Center for Plasma Edge Simulation (CPES)}}, 15589 note = {Proto-FSP project, see \url{http://www.cims.nyu.edu/cpes}} 15590} 15591 15592@Misc{ epsi:homepage, 15593 author = {{C.S.} {Chang (PI)}}, 15594 title = {{Center for Edge Physics Simulation (EPSI)}}, 15595 note = {\url{http://epsi.pppl.gov}} 15596} 15597 15598@Unpublished{ groundwater-scidac2:web, 15599 author = {Peter {Lichtner (PI)}}, 15600 title = {Modeling Multiscale-Multiphase-Multicomponent Subsurface Reactive Flows Using 15601 Advanced Computing}, 15602 howpublished = {http://www.scidac.gov/groundwater/gwflow.html} 15603} 15604 15605@Misc{ pflotran:web, 15606 author = {Peter {Lichtner (PI)}}, 15607 title = {{Modeling Multiscale-Multiphase-Multicomponent Subsurface Reactive Flows Using 15608 Advanced Computing}}, 15609 note = {\url{http://ees.lanl.gov/pflotran/}} 15610} 15611 15612@Misc{ accel-scidac2-solicitation, 15613 author = {{DOE Office of Science}}, 15614 title = {{Program Announcement LAB 07-09, SciDAC: Accelerator Science and Simulation}}, 15615 year = {2006}, 15616 note = {\url{http://www.science.doe.gov/grants/LAB07_09.html}} 15617} 15618 15619@Article{ nieter04, 15620 author = {C. Nieter and J. R. Cary}, 15621 title = {{VORPAL}: A Versatile Plasma Simulation Code}, 15622 journal = {J. Comp. Phys.}, 15623 year = {2004}, 15624 volume = {196}, 15625 pages = {448} 15626} 15627 15628@Article{ synergia06, 15629 author = {J. Amundson and P. Spentzouris and J. Qiang and R. Ryne}, 15630 title = {Synergia: An accelerator modeling tool with {3-D} space charge}, 15631 journal = {J. Comp. Phys.}, 15632 year = {2006}, 15633 volume = {211}, 15634 pages = {229-248} 15635} 15636 15637@Unpublished{ stoltz07, 15638 author = {P. H. Stoltz}, 15639 title = {Maps of {RF} cavities generated from electromagnetic simulations}, 15640 year = {2007}, 15641 note = {to appear in Proceedings of the 2007 Particle Accelerator Conference (PAC07), 15642 Albuquerque, NM, 2007} 15643} 15644 15645@Misc{ iter:homepage, 15646 key = {{International Thermonuclear Experimental Reactor (ITER) homepage}}, 15647 year = {2007}, 15648 title = {{International Thermonuclear Experimental Reactor (ITER) homepage}}, 15649 howpublished = {\url{http://www.iter.org}} 15650} 15651 15652@Misc{ epp2010, 15653 author = {{Committee on Elementary Particle Physics in the 21st Century, National Research 15654 Council}}, 15655 title = {Revealing the Hidden Nature of Space and Time: Charting the Course for Elementary 15656 Particle Physics}, 15657 year = {2006}, 15658 howpublished = {The National Academies Press, ISBN: 0309101948} 15659} 15660 15661@Misc{ post-fsp-report, 15662 author = {D.~E.~Post and D.~B.~Batchelor and R.~B.~Bramley and J.~R.~Cary and R.~H.~Cohen 15663 and P.~Colella and S.~C.~Jardin}, 15664 title = {{Report of Fusion Simulation Project Steering Committee}}, 15665 month = aug, 15666 year = {2004}, 15667 note = {Available via \url{http://w3.pppl.gov/usjapanim/FSPReport.pdf}} 15668} 15669 15670@Misc{ fsp:workshop2011, 15671 key = {{Fusion Simulation Project (FSP) Planning Workshop}}, 15672 title = {{Fusion Simulation Project (FSP) Planning Workshop}}, 15673 month = feb, 15674 year = {2011}, 15675 note = {\url{https://ice.txcorp.com/trac/2011_FspDefinitionWorkshop}} 15676} 15677 15678@Book{ hazeltine-meiss-book, 15679 author = {R.~D.~Hazeltine and J.~D.~Meiss}, 15680 title = {Plasma Confinement}, 15681 year = {1991}, 15682 publisher = {Addison-Wesley, Redwood City, CA} 15683} 15684 15685@Article{ falgout05a, 15686 author = {R. D. Falgout and J. E. Jones and U. M. Yang}, 15687 title = {Conceptual Interfaces in hypre}, 15688 journal = {Future Generation Computer Systems}, 15689 note = {Special issue on PDE software}, 15690 volume = {22}, 15691 year = {2005}, 15692 pages = {239--251} 15693} 15694 15695@Article{ falgout05b, 15696 author = {R. D. Falgout and J. E. Jones and U. M. Yang}, 15697 title = {Pursuing Scalability for hypre's Conceptual Interfaces}, 15698 journal = {ACM Trans. Math. Softw.}, 15699 volume = {31}, 15700 year = {2005}, 15701 pages = {326--350} 15702} 15703 15704@Unpublished{ compass:homepage, 15705 author = {Panagiotis {Spentzouris (PI)}}, 15706 title = {Community Petascale Project for Accelerator Science and Simulation (ComPASS)}, 15707 note = {SciDAC2 project, see \url{https://compass.fnal.gov/}} 15708} 15709 15710@Unpublished{ cmsnf:homepage, 15711 author = {{Todd Allen, Director}}, 15712 title = {{Center for Materials Science of Nuclear Fuel}}, 15713 note = {Energy Frontier Research Center, see 15714 \url{https://inlportal.inl.gov/portal/server.pt/community/center_for_materials_science_of_nuclear_fuel}} 15715} 15716 15717@Unpublished{ dvi-materials:project, 15718 author = {{L.~C.} {McInnes (PI)}}, 15719 title = {Large-Scale Differential Variational Inequalities for Heterogeneous Materials}, 15720 note = {{SciDAC}-e project}, 15721 year = {2011} 15722} 15723 15724@Misc{ scidac:homepage, 15725 author = {{DOE Office of Science}}, 15726 title = {{Scientific Discovery through Advanced Computing}}, 15727 year = {2007}, 15728 howpublished = {\url{http://www.scidac.gov}} 15729} 15730 15731@Misc{ corba, 15732 author = {{Object Management Group}}, 15733 year = {2007}, 15734 title = {{Common Object Request Broker Architecture (CORBA)}}, 15735 howpublished = {\url{http://www.corba.org}} 15736} 15737 15738@Article{ uedge, 15739 author = {T.~D. Rognlien and D.~D. Ryutov and N. Mattor and G.~D. Porter}, 15740 title = {Two-Dimensional Electric Fields and Drifts near the Magnetic Separatrix in 15741 Divertor Tokamak}, 15742 journal = {J. Plasma Physics}, 15743 year = {1999}, 15744 volume = {6}, 15745 pages = {1851}, 15746 note = {also see user manual at http://www.mfescience.org, then UEDGE link} 15747} 15748 15749@Article{ bout, 15750 author = {X.~Q. Xu and R.~H. Cohen and T.~D. Rognlien and J.~R. Myra}, 15751 title = {Low-to-High Confinement Transition Simulations in Divertor Geometry}, 15752 journal = {J. Plasma Physics}, 15753 year = {2000}, 15754 volume = {7}, 15755 pages = {1951}, 15756 note = {} 15757} 15758 15759@Article{ bout++, 15760 author = {B. Dudson and M. Umansky and X.~Q. Xu and P. B. Snyder and H. R. Wilson}, 15761 title = {{BOUT++}: A Framework for Parallel Plasma Fluid Simulations}, 15762 journal = {Computer Physics Communications}, 15763 year = {2009}, 15764 volume = {180}, 15765 issue = {9}, 15766 pages = {1467 -- 1480}, 15767 note = {} 15768} 15769 15770@Article{ tempest, 15771 author = {Z. Xiong and X.Q. Xu and B.I. Cohen and R. Cohen and M.R. Dorr and J.A. Hittinger 15772 and G. Kerbel and W.M. Nevins and T. Rognlien}, 15773 title = {Simulation of Plasma Transport in a Toroidal Annulus with TEMPEST}, 15774 journal = {Bull. Am. Phys. Soc. }, 15775 year = {2005}, 15776 volume = {50}, 15777 number = {86}, 15778 pages = {CP1}, 15779 note = {} 15780} 15781 15782@Article{ ccahpc, 15783 author = {David E. Bernholdt and Benjamin A. Allan and Robert Armstrong and Felipe Bertrand 15784 and Kenneth Chiu and Tamara L. Dahlgren and Kostadin Damevski and Wael R. Elwasif 15785 and Thomas G. W. Epperly and Madhusudhan Govindaraju and Daniel S. Katz and James 15786 A. Kohl and Manoj Krishnan and Gary Kumfert and J. Walter Larson and Sophia 15787 Lefantzi and Michael J. Lewis and Allen D. Malony and Lois C. McInnes and Jarek 15788 Nieplocha and Boyana Norris and Steven G. Parker and Jaideep Ray and Sameer Shende 15789 and Theresa L. Windus and Shujia Zhou}, 15790 title = {A Component Architecture for High-Performance Scientific Computing}, 15791 journal = {Intl. J. High-Perf. Computing Appl.}, 15792 volume = {20}, 15793 pages = {163--202}, 15794 year = {2006}, 15795 note = {ACTS Collection special issue} 15796} 15797 15798@Misc{ cca-forum:homepage, 15799 author = {{Common Component Architecture Forum}}, 15800 note = {\url{http://www.cca-forum.org}}, 15801 year = {2010} 15802} 15803 15804@Misc{ petsc:driven-cavity-example, 15805 title = {{PETSc Driven Cavity Example Code}}, 15806 author = {B. F. {Smith et al.}}, 15807 howpublished = {\url{https://petsc.org/release/src/snes/tutorials/ex19.c.html}} 15808} 15809 15810@Misc{ petsc-dm:webpage, 15811 author = {B. F. {Smith et al.}}, 15812 title = {{PETSc DM Webpage}}, 15813 howpublished = {\url{https://petsc.org/release/manualpages/DM/}}, 15814 year = {2018} 15815} 15816 15817@Misc{ unic-ref, 15818 author = {Giuseppe Palmiotti}, 15819 title = {{UNIC} Neutronics Software}, 15820 note = {Nuclear Engineering Division, Argonne National Laboratory} 15821} 15822 15823% ----------------------------------------------------------------------- 15824% Model coupling refs 15825@Book{ greve-blatter, 15826 author = {Ralf Greve and Heinz Blatter}, 15827 title = {Dynamics of Ice Sheets and Glaciers}, 15828 series = {Advances in Geophysical and Environmental Mechanics and Mathematics}, 15829 publisher = {Springer}, 15830 year = {2009} 15831} 15832 15833@Misc{ doe-isicles, 15834 key = {ISICLES}, 15835 title = {Ice {S}heet {I}nitiative for {CL}-imate {E}xtreme{S}}, 15836 howpublished = {\url{http://www.csm.ornl.gov/ISICLES/index.html}} 15837} 15838 15839@Article{ safta2011tchem, 15840 title = {TChem-a software toolkit for the analysis of complex kinetic models}, 15841 author = {Safta, Cosmin and Najm, Habib N and Knio, Omar}, 15842 journal = {Sandia Report, SAND2011-3282}, 15843 year = {2011} 15844} 15845 15846@Misc{ chemkin-website, 15847 key = {chemkin}, 15848 title = {ANSYS Chemkin-Pro Website}, 15849 howpublished = {\url{http://www.ansys.com/products/fluids/ansys-chemkin-pro}}, 15850 year = {2017} 15851} 15852 15853@Misc{ mct-website, 15854 key = {MCT}, 15855 title = {{M}odel {C}oupling {T}oolkit ({MCT}) {W}eb {S}ite}, 15856 howpublished = {\url{http://www.mcs.anl.gov/mct}} 15857} 15858 15859@Article{ larson:05, 15860 author = {Jay Larson and Robert Jacob and Everest Ong}, 15861 title = {{The Model Coupling Toolkit}: A New {Fortran90} Toolkit for Building 15862 Multi-Physics Parallel Coupled Models}, 15863 journal = {Int. J. High Perf. Comp. App.}, 15864 year = {2005}, 15865 pages = {277--292} 15866} 15867 15868@Article{ dennis2012computational, 15869 title = {Computational performance of ultra-high-resolution capability in the Community 15870 Earth System Model}, 15871 author = {Dennis, John M and Vertenstein, Mariana and Worley, Patrick H and Mirin, Arthur A 15872 and Craig, Anthony P and Jacob, Robert and Mickelson, Sheri}, 15873 journal = {International Journal of High Performance Computing Applications}, 15874 volume = {26}, 15875 number = {1}, 15876 pages = {5--16}, 15877 year = {2012}, 15878 publisher = {SAGE Publications} 15879} 15880 15881@InProceedings{ bettge01, 15882 author = {T. Bettge and A. Craig and R. James and V. Wayland and G. Strand}, 15883 year = {2001}, 15884 title = {The {DOE} Parallel Climate Model {(PCM)}: The Computational Highway and 15885 Backroads}, 15886 booktitle = {Proc. International Conference on Computational Science (ICCS) 2001}, 15887 editors = {V. N. Alexandrow and J. J. Dongarra and C. J. K. Tan}, 15888 pages = {148 -- 156}, 15889 series = {Lecture Notes in Computer Science}, 15890 volume = {2073}, 15891 publisher = {Springer-Verlag} 15892} 15893 15894@InProceedings{ jacob01, 15895 author = {R. Jacob and C. Schafer and I. Foster and M. Tobis and J. Anderson}, 15896 year = {2001}, 15897 title = {Computational Design and Performance of the {Gast} Ocean Atmosphere Model}, 15898 booktitle = {Proc. International Conference on Computational Science (ICCS) 2001}, 15899 editors = {V. N. Alexandrow and J. J. Dongarra and C. J. K. Tan}, 15900 series = {Lecture Notes in Computer Science}, 15901 volume = {2073}, 15902 publisher = {Springer-Verlag} 15903} 15904 15905@Article{ chen2008new, 15906 title = {New generation of multi-scale {NWP} system {(GRAPES)}: General scientific 15907 design}, 15908 author = {Chen, DeHui and Xue, JiShan and Yang, XueSheng and Zhang, HongLiang and Shen, 15909 XueShun and Hu, JiangLin and Wang, Yu and Ji, LiRen and Chen, JiaBin}, 15910 journal = {Chinese Science Bulletin}, 15911 volume = {53}, 15912 number = {22}, 15913 pages = {3433--3445}, 15914 year = {2008}, 15915 publisher = {Springer} 15916} 15917 15918@InProceedings{ baum01, 15919 author = {J. Baum and H. Luo and E. Mestreau and D. Sharov and R. Loehner and D. Pelessone 15920 and C. Charman}, 15921 year = {2001}, 15922 title = {Recent Developments of a Coupled {CFD/CSD} Methodology}, 15923 booktitle = {Proc. International Conference on Computational Science (ICCS) 2001}, 15924 editors = {V. N. Alexandrow and J. J. Dongarra and C. J. K. Tan}, 15925 series = {Lecture Notes in Computer Science}, 15926 volume = {2073}, 15927 publisher = {Springer-Verlag} 15928} 15929 15930@InProceedings{ lefantzi03, 15931 author = {S. Lefantzi and J. Ray}, 15932 year = {2003}, 15933 title = {A Component-based Scientific Toolkit for Reacting Flows}, 15934 booktitle = {Proc. Second MIT Conference on Computational Fluid and Solid Mechanics}, 15935 volume = {2}, 15936 publisher = {Elsevier} 15937} 15938 15939@Article{ boville98, 15940 author = {B. A. Boville and P. R. Gent}, 15941 title = {The {NCAR} Climate System Model, Version One}, 15942 journal = {Journal of Climate}, 15943 volume = {11}, 15944 year = {1998}, 15945 pages = {1115--1130} 15946} 15947 15948@Misc{ paraschivoiu99, 15949 author = {M. Paraschivoiu and X.-C. Cai and M. Sarkis and D. P. Young and D. Keyes}, 15950 title = {Multi-domain multi-model formulation for compressible flows: Conservative 15951 interface coupling and parallel implicit solvers for {3D} unstructured meshes}, 15952 note = {AIAA Paper 99-0784}, 15953 year = {1999} 15954} 15955 15956@Article{ peszynska, 15957 author = {M. Peszynska and M. F. Wheeler and I. Yotov}, 15958 title = {Mortar upscaling for multiphysics flow in porous media}, 15959 journal = {Computational Geosciences} 15960} 15961 15962@TechReport{ wheeler00, 15963 author = {M. F. Wheeler and J. Wheeler and M. Peszynska}, 15964 title = {A distributed computing portal for coupling multi-physics and multiple domains in 15965 porous media}, 15966 institution = {University of Texas at Austin}, 15967 number = {TICAM 00-03}, 15968 year = {2000} 15969} 15970 15971@TechReport{ peszynska00, 15972 author = {M. Peszynska and Q. Lu and M. F. Wheeler}, 15973 title = {Multiphysics Coupling of Codes}, 15974 institution = {University of Texas at Austin}, 15975 number = {TICAM 00-02}, 15976 year = {2000} 15977} 15978 15979@Article{ joshaghanijoodatnakshatrala2019, 15980 title = {A stabilized mixed discontinuous Galerkin formulation for double 15981 porosity/permeability model}, 15982 author = {MS Joshaghani and SHS Joodat and KB Nakshatrala}, 15983 journal = {Computer Methods in Applied Mechanics and Engineering}, 15984 volume = {352}, 15985 pages = {508--560}, 15986 year = {2019} 15987} 15988 15989@InProceedings{ cai99, 15990 author = {X.-C. Cai and M. Paraschivoiu and M. Sarkis}, 15991 title = {An explicit multi-model compressible flow formulation based on the full potential 15992 equation and the {Euler} equations on {3D} unstructured meshes}, 15993 booktitle = {Proceedings of the 11th International Conference on Domain Decomposition 15994 Methods}, 15995 editor = {C-H. Lai and P. Bjorstad and M. Cross and O. Widlund}, 15996 year = {1999} 15997} 15998 15999@Article{ he05, 16000 author = {Yun He and Chris H. Q. Ding}, 16001 title = {Coupling Multi-Component Models with {MPH} on Distributed Memory Computer 16002 Architectures}, 16003 year = {2005}, 16004 volume = {19}, 16005 pages = {329--240}, 16006 number = {3}, 16007 journal = {Int. Journal of High Performance Computing Applications} 16008} 16009 16010@InProceedings{ uiuc-rocket-center02, 16011 author = {W. A. Dick and M. T. Heath}, 16012 title = {Whole System Simulation of Solid Propellant Rockets}, 16013 booktitle = {Proceedings of the AIAA Joint Propulsion Conference, AIAA2002-4345}, 16014 month = jul, 16015 year = {2002} 16016} 16017 16018@InProceedings{ toth04, 16019 author = {G. Toth and O. Volberg and A. J. Ridley and T. I Gombosi and D. DeZeeuw and K. W. 16020 Hansen and D. R. Chesney and Q. F. Stout and K. G. Powell and K. Kane and R. 16021 Oehmke}, 16022 title = {A Physics-Based Software Framework for Sun-Earth Connection Modeling}, 16023 editor = {A. T. Y. Lui and Y. Kamide and G. Consolini}, 16024 booktitle = {Multiscale Coupling of Sun-Earth Processes, Proceedings of the Conference on the 16025 Sun-Earth Connection}, 16026 year = {2004}, 16027 publisher = {Elsevier}, 16028 pages = {383--397} 16029} 16030 16031@Misc{ csdrm:web, 16032 author = {M. Aivazis and B. Goddard and D. Meiron and M. Ortiz and J. Pool and J. 16033 Shepherd}, 16034 title = {{Center for Simulation of Dynamic Response of Materials}}, 16035 note = {California Institute of Technology, see \url{http://csdrm.caltech.edu}} 16036} 16037 16038@Misc{ csar:web, 16039 author = {M. {Heath (Director)}}, 16040 title = {{Center for Simulation of Advanced Rockets}}, 16041 note = {University of Illinois at Urbana-Champaign, see \url{http://www.csar.uiuc.edu}} 16042} 16043 16044@Misc{ csafe:web, 16045 author = {D. {Pershing (Director)}}, 16046 title = {{Center for Simulation of Accidental Fires and Explosions}}, 16047 note = {University of Utah, see \url{http://www.csafe.utah.edu}} 16048} 16049 16050@Misc{ cits:web, 16051 author = {P. {Moin (Director)}}, 16052 title = {{Center for Integrated Turbulence Simulations}}, 16053 note = {Stanford University, see \url{http://www.stanford.edu/group/cits}} 16054} 16055 16056@Misc{ flash:web, 16057 author = {D. {Lamb (Director)}}, 16058 title = {{Center for Integrated Turbulence Simulations}}, 16059 note = {University of Chicago, see \url{http://flash.uchicago.edu}} 16060} 16061 16062@TechReport{ utah-csafe03, 16063 author = {J. Guilkey and T. Harman and A. Xia and B. Kashiwa and P. McMurtry}, 16064 title = {An Eulerian-Lagrangian Approach for Large Deformation Fluid Structure Interaction 16065 Problems, Part 1: Algorithm Development}, 16066 institution = {University of Utah, Center for the Simulation of Accidental Fires and 16067 Explosions}, 16068 year = {2003} 16069} 16070 16071@InBook{ shepherd07, 16072 author = {M. Shepherd and E. Seol and B. FrantzDale}, 16073 title = {Toward a Multi-Model Hierarchy to Support Multiscale Simulations}, 16074 year = {2007}, 16075 booktitle = {CRC Handbook of Dynamic System Modeling}, 16076 publisher = {Wiley}, 16077 pages = {1--41}, 16078 note = {also available as SCOREC Report 2007-2, Rensselaer Polytechnic Institute} 16079} 16080 16081@InProceedings{ cactus02, 16082 author = {Tom Goodale and Gabrielle Allen and Gerd Lanfermann and Joan Masso and Thomas 16083 Radke and Edward Seidel and John Shalf}, 16084 title = {The {Cactus} Framework and Toolkit: Design and Applications}, 16085 booktitle = {VECPAR'2002, 5th International Conference, Lecture Notes in Computer Science}, 16086 year = {2002}, 16087 url = {http://www.cactuscode.org/Papers/VecPar_2002.pdf} 16088} 16089 16090@Misc{ cactus:homepage, 16091 author = {G. {Allen et al.}}, 16092 title = {{Cactus Web page}}, 16093 howpublished = {\url{http://cactuscode.org}} 16094} 16095 16096@Misc{ open-grid-forum:web, 16097 key = {{Open Grid Forum}}, 16098 title = {{Open Grid Forum}}, 16099 note = {See \url{http://www.ogf.org}} 16100} 16101 16102@Misc{ nox:web, 16103 author = {Tamara Kolda and Roger {Pawlowski et al.}}, 16104 title = {Nonlinear Object-Oriented Solutions {(NOX)}}, 16105 note = {See \url{http://software.sandia.gov/nox}} 16106} 16107 16108@Misc{ chombo:web, 16109 author = {P. {Colella (PI)}}, 16110 title = {{Chombo}}, 16111 note = {See \url{http://seesar.lbl.gov/anag/chombo}} 16112} 16113 16114@Article{ lanzkron96, 16115 author = {P. J. Lanzkron and D. J. Rose and J. T. Wilkes}, 16116 title = {An Analysis of Approximate Nonlinear Elimination}, 16117 journal = {SIAM J. Sci. Comput.}, 16118 volume = {17}, 16119 year = {1996}, 16120 pages = {538--559} 16121} 16122 16123@Article{ jiang95, 16124 author = {J. Jiang and P. Forsyth}, 16125 title = {Robust Linear and Nonlinear Strategies for Solution of the Transonic {Euler} 16126 Equations}, 16127 journal = {Computers and Fluids}, 16128 volume = {24}, 16129 pages = {753--770}, 16130 year = {1995} 16131} 16132 16133@Article{ young90, 16134 author = {D. Young and R. Melbin and M. Bieterman and F. Johnson and S. Samant}, 16135 title = {Global Convergence of Inexact {Newton} Methods for Transonic Flow}, 16136 journal = {Int. J. Numer. Methods Fluids}, 16137 volume = {11}, 16138 pages = {1075--1095}, 16139 year = {1990} 16140} 16141 16142@Article{ fishwick04, 16143 author = {Paul A. Fishwick}, 16144 title = {Toward an Integrated Multimodeling Interface: A Human-Computer Interface Approach 16145 to Interrelating Model Structures}, 16146 journal = {SCS Trans. on Simulation}, 16147 note = {Special Issue in Grand Challenges in Computer Simulation}, 16148 year = {2004} 16149} 16150 16151@Article{ fishwick03, 16152 author = {Paul Fishwick and Jinho Lee and Minho Park and Jyunju Shim}, 16153 title = {{RUBE}: A Customized {2D} and {3D} Modeling Framework for Simulation}, 16154 booktitle = {Proceedings of the 2003 Winter Simulation Conference}, 16155 editor = {S. Chick and P. J. Sanchez and D. Ferrin and D. J. Morrice}, 16156 year = {2003} 16157} 16158 16159@InProceedings{ kirner00, 16160 author = {T. G. Kirner and V. F. Martins}, 16161 title = {Development of an Information Visualization Tool Using Virtual Reality}, 16162 booktitle = {Proceedings of the 2000 ACM Symposium on Applied Computing}, 16163 year = {2000}, 16164 pages = {604--606} 16165} 16166 16167@InProceedings{ orso03, 16168 author = {A. Orso and J. Jones and M. J. Harrold}, 16169 title = {Visualization of Program-Execution Data for Deployed Software}, 16170 booktitle = {Proceedings of the 2003 ACM Symposium on Software Visualization}, 16171 year = {2003}, 16172 pages = {67--76} 16173} 16174 16175@Book{ tiller01, 16176 author = {M. Tiller}, 16177 title = {Introduction to Physical System Modeling with Modelica}, 16178 series = {Kluwer International Series inEngineering and Computer Science}, 16179 volume = {615}, 16180 publisher = {Kluwer}, 16181 year = {2001} 16182} 16183 16184@Article{ buck94, 16185 author = {J. Buck and S. Ha and E. Lee and D. Messerschmitt}, 16186 title = {Ptolemy: A Framework for Simulating and Prototyping Heterogeneous Systems}, 16187 journal = {Int. Journal of Computer Simulation}, 16188 volume = {4}, 16189 pages = {155--182}, 16190 year = {1994} 16191} 16192 16193@Article{ mu95, 16194 author = {M. Mu and J.R. Rice}, 16195 title = {Modeling with collaborating {PDE} solvers - Theory and practice}, 16196 journal = {Comp. Syst. Engr.}, 16197 volume = {6}, 16198 year = {1995}, 16199 pages = {87--95} 16200} 16201 16202@TechReport{ drashansky96, 16203 title = {Multidisciplinary Problem Solving using Agents in a Cluster Environment}, 16204 author = {R. Drashansky and A. Joshi and J. R. Rice}, 16205 institution = {Emory Universtity, Department of Mathematics and Computer Science}, 16206 year = {1996} 16207} 16208 16209@Article{ michopoulos05, 16210 title = {Survey on Modeling and Simulation of Multiphysics Systems}, 16211 author = {John G. Michopoulos and Charbel Farhat and Jacob Fish}, 16212 journal = {Journal of Computing and Information Science in Engineering}, 16213 volume = {5}, 16214 issue = {3}, 16215 pages = {198--213}, 16216 year = {2005} 16217} 16218 16219@Article{ dubey09, 16220 title = {Extensibe Component-Based Architecture for {FLASH}, a Massively Parallel 16221 Multiphysics Simulation Code}, 16222 author = {A. Dubey and K. Antypass and M. Ganapathy and L. Reid and D. Sheeler and A. 16223 Siegel and K. Weide}, 16224 journal = {Parallel Computing}, 16225 volume = {35}, 16226 issue = {10 -- 11}, 16227 pages = {512 -- 522}, 16228 year = {2009} 16229} 16230 16231@Book{ bottloring95, 16232 author = {Raoul Bott and Loring W. Tu}, 16233 title = {Differential Forms in Algebraic Topology}, 16234 publisher = {Springer}, 16235 year = {1995} 16236} 16237 16238@Book{ kobayashinomizu96, 16239 author = {Shoshichi Kobayashi and Katsumi Nomizu}, 16240 title = {Foundations of Differential Geometry}, 16241 publisher = {Wiley-Interscience}, 16242 year = {1996} 16243} 16244 16245@Article{ hornungkohn02, 16246 author = {Richard D. Hornung and Scott R. Kohn}, 16247 title = {Managing Application Complexity in the SAMRAI Object-Oriented Framework}, 16248 journal = {Concurrency and Computation: Practice and Experience}, 16249 volume = {14}, 16250 pages = {347--368}, 16251 year = {2002} 16252} 16253 16254@InProceedings{ concepts06, 16255 author = {Douglas Gregor and Jaakko J{\"a}rvi and Jeremy Siek and Bjarne Stroustrup and 16256 Gabriel Dos Reis and Andrew Lumsdaine}, 16257 title = {Concepts: Linguistic Support for Generic Programming in C++}, 16258 booktitle = {Proceedings of OOPSLA 2006}, 16259 year = {2006}, 16260 pages = {???--???} 16261} 16262 16263@Book{ hatcher02, 16264 author = {Hatcher, Allen}, 16265 title = {Algebraic Topology}, 16266 publisher = {Cambridge University Press}, 16267 year = {2002} 16268} 16269 16270@Book{ gammahelmjohnsonvlissides95, 16271 abstract = {{Design Patterns is a modern classic in the literature of object-oriented 16272 development, offering timeless and elegant solutions to common problems in 16273 software design. It describes patterns for managing object creation, composing 16274 objects into larger structures, and coordinating control flow between objects. The 16275 book provides numerous examples where using composition rather than inheritance 16276 can improve the reusability and flexibility of code. Note, though, that it's not a 16277 tutorial but a catalog that you can use to find an object-oriented design pattern 16278 that's appropriate for the needs of your particular application--a selection for 16279 virtuoso programmers who appreciate (or require) consistent, well-engineered 16280 object-oriented designs.} {Now on CD, this internationally acclaimed bestseller is 16281 more valuable than ever! 16282 16283 Use the contents of the CD to create your own design documents and reusable 16284 components. The CD contains: 23 patterns you can cut and paste into your own 16285 design documents; sample code demonstrating pattern implementation; complete 16286 Design Patterns content in standard HTML format, with numerous hyperlinked 16287 cross-references; accessed through a standard web browser; Java-based dynamic 16288 search mechanism, enhancing online search capabilities; graphical user environment, 16289 allowing ease of navigation. 16290 16291 First published in 1995, this landmark work on object-oriented software design 16292 presents a catalog of simple and succinct solutions to common design problems. 16293 Created by four experienced designers, the 23 patterns contained herein have 16294 become an essential resource for anyone developing reusable object-oriented 16295 software. In response to reader demand, the complete text and pattern catalog are 16296 now available on CD-ROM. This electronic version of Design Patterns enables 16297 programmers to install the book directly onto a computer or network for use as an 16298 online reference for creating reusable object-oriented software. 16299 16300 The authors first describe what patterns are and how they can help you in the 16301 design process. They then systematically name, explain, evaluate, and catalog 16302 recurring designs in object-oriented systems. All patterns are compiled from 16303 real-world examples and include code that demonstrates how they may be implemented 16304 in object-oriented programming languages such as C++ and Smalltalk. Readers who 16305 already own the book will want the CD to take advantage of its dynamic search 16306 mechanism and ready-to-install patterns.}}, 16307 author = {Gamma, Erich and Helm, Richard and Johnson, Ralph and Vlissides, John}, 16308 citeulike-article-id={115158}, 16309 howpublished = {Hardcover}, 16310 isbn = {0201633612}, 16311 keywords = {1995 algorithms architecture book books computer computing design design-pattern 16312 design-patterns design_patterns designpatterns development diplom entwurfsmuster 16313 four gang gof java mathgamespatterns no-tag object object-orientation 16314 object-oriented of oo-patterns oop oriented pattern patterns programming se 16315 software software-development software-engineering software_design 16316 softwareengineering standard}, 16317 month = jan, 16318 publisher = {{Addison-Wesley Professional}}, 16319 title = {Design Patterns}, 16320 url = {http://www.amazon.ca/exec/obidos/redirect?tag=citeulike04-20{\&}path=ASIN/0201633612}, 16321 year = {1995} 16322} 16323 16324@InProceedings{ chaco95, 16325 author = {Bruce Hendrickson and Robert Leland}, 16326 title = {A multilevel algorithm for partitioning graphs}, 16327 booktitle = {Supercomputing '95: Proceedings of the 1995 ACM/IEEE Conference on Supercomputing 16328 (CDROM)}, 16329 year = {1995}, 16330 isbn = {0-89791-816-9}, 16331 pages = {28}, 16332 location = {San Diego, California, United States}, 16333 doi = {10.1145/224170.224228}, 16334 publisher = {ACM Press}, 16335 address = {New York} 16336} 16337 16338@Book{ aleksandrov98, 16339 author = {Aleksandrov, Pavel S.}, 16340 title = {Combinatorial Topology}, 16341 publisher = {Dover}, 16342 volume = {3}, 16343 year = {1998} 16344} 16345 16346@Book{ steenrod99, 16347 abstract = {{ Fibre bundles, now an integral part of differential geometry, are also of great 16348 importance in modern physics--such as in gauge theory. This book, a succinct 16349 introduction to the subject by renown mathematician Norman Steenrod, was the first 16350 to present the subject systematically. 16351 16352 It begins with a general introduction to bundles, including such topics as 16353 differentiable manifolds and covering spaces. The author then provides brief 16354 surveys of advanced topics, such as homotopy theory and cohomology theory, before 16355 using them to study further properties of fibre bundles. The result is a classic 16356 and timeless work of great utility that will appeal to serious mathematicians and 16357 theoretical physicists alike. }}, 16358 author = {Steenrod, Norman}, 16359 citeulike-article-id={712999}, 16360 howpublished = {Paperback}, 16361 isbn = {0691005486}, 16362 keywords = {fibre_bundles topology}, 16363 month = apr, 16364 publisher = {{Princeton University Press}}, 16365 title = {The Topology of Fibre Bundles. (PMS-14)}, 16366 url = {http://www.amazon.ca/exec/obidos/redirect?tag=citeulike04-20{\&}path=ASIN/0691005486}, 16367 year = {1999} 16368} 16369 16370@Book{ bredon97, 16371 author = {Bredon, Glen E.}, 16372 title = {Sheaf Theory}, 16373 publisher = {Springer}, 16374 pages = {524}, 16375 series = {Graduate Texts in Mathematics}, 16376 year = {1997} 16377} 16378 16379@TechReport{ tautgesmeyers04, 16380 title = {{MOAB}: A Mesh-Oriented Database}, 16381 author = {Timothy J. Tautges and Ray Meyers and Karl Merkley and Clint Stimpson and Corey 16382 Ernst}, 16383 institution = {Sandia National Laboratories}, 16384 number = {SAND2004-1592}, 16385 month = apr, 16386 year = {2004} 16387} 16388 16389@Article{ tautges04, 16390 author = {Timothy J. Tautges}, 16391 title = {{MOAB}-{SD}: Integrated Structured and Unstructured Mesh Representation}, 16392 journal = {Engineering With Computers}, 16393 volume = {20}, 16394 pages = {286--293}, 16395 year = {2004} 16396} 16397 16398@InProceedings{ meyers02, 16399 author = {Ray Meyers et. al}, 16400 title = {{SNL} Implementation of the {TSTT} Mesh Interface}, 16401 booktitle = {8th International conference on numerical grid generation in computational field 16402 simulations}, 16403 month = jun, 16404 year = {2002} 16405} 16406 16407@InProceedings{ seolshepard05, 16408 author = {E. S. Seol and Mark S. Shephard}, 16409 title = {A Flexible Distributed Mesh Data Structure to Support Parallel Adaptive 16410 Analysis}, 16411 booktitle = {Proceedings of the 8th US National Congress on Computational Mechanics}, 16412 year = {2005} 16413} 16414 16415@Article{ lishephardbeall2005, 16416 title = {3D anisotropic mesh adaptation by mesh modification}, 16417 author = {Xiangrong Li and Mark S Shephard and Mark W Beall}, 16418 journal = {Computer methods in applied mechanics and engineering}, 16419 volume = {194}, 16420 number = {48-49}, 16421 pages = {4915--4950}, 16422 year = {2005}, 16423} 16424 16425@Article{ lushephardtendulkarbeall2014, 16426 title = {Parallel mesh adaptation for high-order finite element methods with curved element geometry}, 16427 author = {Qiukai Lu and Mark S Shephard and Saurabh Tendulkar and Mark W Beall}, 16428 journal = {Engineering with Computers}, 16429 volume = {30}, 16430 pages = {271--286}, 16431 year = {2014}, 16432} 16433 16434@Article{ beallwalshshephard04, 16435 author = {Mark W. Beall and Joe Walsh and Mark S. Shephard}, 16436 title = {A comparison of techniques for geometry access related to mesh generation}, 16437 journal = {Engineering With Computers}, 16438 volume = {20}, 16439 number = {3}, 16440 pages = {210--221}, 16441 year = {2004} 16442} 16443 16444@Article{ careyandersoncarneskirk04, 16445 author = {Graham F. Carey and Michael L. Anderson and Brian R. Carnes and Benjamin S. 16446 Kirk}, 16447 title = {Some aspects of adaptive grid technology related to boundary and interior 16448 layers}, 16449 journal = {Journal of Computational Applied Mathematics}, 16450 volume = {166}, 16451 number = {1}, 16452 pages = {55--86}, 16453 year = {2004} 16454} 16455 16456@PhDThesis{ gralthesis, 16457 author = {Guntram Berti}, 16458 title = {Generic Software Components for Scientific Computing}, 16459 school = {TU Cottbus}, 16460 year = {2000}, 16461 note = {\url{http://www.math.tu-cottbus.de/~berti/diss}} 16462} 16463 16464@Article{ whitehead1949, 16465 title = {Combinatorial homotopy. I}, 16466 author = {John HC Whitehead}, 16467 journal = {Bulletin of the American Mathematical Society}, 16468 volume = {55}, 16469 number = {3. P1}, 16470 pages = {213--245}, 16471 year = {1949}, 16472 publisher = {American Mathematical Society} 16473} 16474 16475@Article{ beylkincoifmanrokhlin91, 16476 author = {Gregory Beylkin and Ronald Coifman and Vladimir Rokhlin}, 16477 title = {Fast Wavelet Transforms and Numerical Algorithms {I}}, 16478 journal = {Communications on Pure and Applied Mathematics}, 16479 volume = {44}, 16480 pages = {141--183}, 16481 year = {1991} 16482} 16483 16484@Book{ wesseling92, 16485 author = {Pieter Wesseling}, 16486 title = {An Introduction to Multigrid Methods}, 16487 publisher = {John Wiley and Sons}, 16488 year = {1992} 16489} 16490 16491@Book{ grakakos04, 16492 author = {Loukas Grakakos}, 16493 title = {Classical and Modern Fourier Analysis}, 16494 publisher = {Pearson Education}, 16495 address = {New Jersey}, 16496 year = {2004} 16497} 16498 16499@Misc{ hlib-web-page, 16500 key = {HLib}, 16501 title = {{HLib} {Web} page}, 16502 note = {{\texttt{http://www.hlib.org/}}}, 16503 annote = {Hierarchical matrices for fast integral transform} 16504} 16505 16506@Article{ hackbusch99, 16507 author = {Wolfgang Hackbusch}, 16508 title = {A sparse matrix arithmetic based on {$\mathcal H$}-matrices. Part {I}: 16509 Introduction to {$\mathcal H$}-matrices}, 16510 journal = {Computing}, 16511 volume = {62}, 16512 pages = {89--108}, 16513 year = {1999} 16514} 16515 16516@TechReport{ kay1999green, 16517 title = {A {G}reen's function preconditioner for the steady-state {N}avier-{S}tokes 16518 equations}, 16519 author = {Kay, D. and Loghin, D.}, 16520 year = {1999}, 16521 institution = {Oxford University Computing Laboratory}, 16522 number = {99/06} 16523} 16524 16525@Article{ bebendorf2003existence, 16526 title = {Existence of {$\mathcal H$}-matrix approximants to the inverse {FE}-matrix of 16527 elliptic operators with {$L^\infty$}-coefficients}, 16528 author = {Bebendorf, M. and Hackbusch, W.}, 16529 journal = {Numerische Mathematik}, 16530 volume = {95}, 16531 number = {1}, 16532 pages = {1--28}, 16533 year = {2003}, 16534 publisher = {Springer} 16535} 16536 16537@Article{ hackbusch2005direct, 16538 title = {Direct {S}chur complement method by domain decomposition based on {$\mathcal 16539 H$}-matrix approximation}, 16540 author = {Hackbusch, W. and Khoromskij, B.N. and Kriemann, R.}, 16541 journal = {Computing and Visualization in Science}, 16542 volume = {8}, 16543 number = {3}, 16544 pages = {179--188}, 16545 year = {2005}, 16546 publisher = {Springer} 16547} 16548 16549@TechReport{ duphof2003, 16550 author = {T. Dupont and J. Hoffman and C. Johnson and R. C. Kirby and M. G. Larson and A. 16551 Logg and L. R. Scott}, 16552 title = {The {FE}ni{CS} project}, 16553 institution = {Chalmers Finite Element Center Preprint Series}, 16554 number = {2003--21}, 16555 year = {2003} 16556} 16557 16558@Article{ flame01, 16559 author = {John A. Gunnels and Fred G. Gustavson and Greg M. Henry and Robert A. van de 16560 Geijn}, 16561 title = {{FLAME}: Formal Linear Algebra Methods Environment}, 16562 journal = {Transactions on Mathematical Software}, 16563 volume = {27}, 16564 number = {4}, 16565 year = {2001}, 16566 pages = {422--455} 16567} 16568 16569@Article{ puschel05, 16570 author = {Markus P{\"u}schel and Jos{\'e} M. F. Moura and Jeremy Johnson and David Padua 16571 and Manuela Veloso and Bryan W. Singer and Jianxin Xiong and Franz Franchetti and 16572 Aca Ga\v{c}i\'{c} and Yevgen Voronenko and Kang Chen and Robert W. Johnson and 16573 Nick Rizzolo}, 16574 title = {{SPIRAL}: Code Generation for {DSP} Transforms}, 16575 journal = {Proceedings of the IEEE}, 16576 volume = {93}, 16577 number = {2}, 16578 year = {2005}, 16579 note = {special issue on "Program Generation, Optimization, and Adaptation"} 16580} 16581 16582@Article{ kirbylogg06, 16583 author = {Robert C. Kirby and Anders Logg}, 16584 title = {A compiler for variational forms}, 16585 journal = {ACM Transactions on Mathematical Software}, 16586 volume = {32}, 16587 number = {3}, 16588 year = {2006}, 16589 issn = {0098-3500}, 16590 pages = {417--444}, 16591 doi = {10.1145/1163641.1163644}, 16592 publisher = {ACM Press}, 16593 address = {New York, NY} 16594} 16595 16596@Article{ kirbylogg07, 16597 author = {Robert C. Kirby and Anders Logg}, 16598 title = {Efficient compilation of a class of variational forms}, 16599 journal = {ACM Transactions on Mathematical Software}, 16600 volume = {33}, 16601 number = {3}, 16602 year = {2007}, 16603 issn = {0098-3500}, 16604 pages = {17}, 16605 doi = {10.1145/1268769.1268771}, 16606 publisher = {ACM Press}, 16607 address = {New York, NY} 16608} 16609 16610@Article{ bankdupont81, 16611 author = {Randolph Bank and Todd Dupont}, 16612 title = {An optimal order process for solving finite element equations}, 16613 journal = {Mathematics of Computation}, 16614 volume = {36}, 16615 pages = {35--51}, 16616 year = {1981} 16617} 16618 16619@TechReport{ adams00, 16620 author = {Mark F. Adams}, 16621 title = {Evaluation of three unstructured multigrid methods on 3D finite element problems 16622 in solid mechanics}, 16623 institution = {UC Berkeley}, 16624 number = {CSD-00-1103}, 16625 year = {2000}, 16626 url = {citeseer.ist.psu.edu/article/adams00evaluation.html} 16627} 16628 16629@Article{ bergengradlhuelsemannruede06, 16630 author = {Benjamin Bergen and Tobias Gradl and Frank H\"ulsemann and Ulrich R\"ude}, 16631 title = {A Massively Parallel Multigrid Method for Finite Elements}, 16632 journal = {Computing in Science \& Engineering}, 16633 volume = {8}, 16634 number = {6}, 16635 pages = {56--62}, 16636 year = {2006} 16637} 16638 16639@MastersThesis{ brunethesis08, 16640 author = {Peter R. Brune}, 16641 title = {Enabling Unstructured Multigrid Under the Sieve Framework}, 16642 school = {University of Chicago}, 16643 address = {Chicago, IL}, 16644 year = {2008}, 16645 month = feb 16646} 16647 16648@Article{ arnoldwinther02, 16649 author = {Douglas N. Arnold and Ragnar Winther}, 16650 title = {Mixed finite elements for elasticity}, 16651 journal = {Numerische Mathematik}, 16652 volume = {92}, 16653 number = {3}, 16654 month = sep, 16655 year = {2002}, 16656 pages = {401--419}, 16657 doi = {10.1007/s002110100348} 16658} 16659 16660@Article{ arnoldfalkwinther06, 16661 author = {Douglas N. Arnold and Richard S. Falk and Ragnar Winther}, 16662 title = {Finite element exterior calculus, homological techniques, and applications}, 16663 journal = {Acta Numerica}, 16664 year = {2006}, 16665 volume = {15}, 16666 pages = {1--155}, 16667 publisher = {Cambridge University Press}, 16668 doi = {10.1017/S0962492906210018} 16669} 16670 16671@Article{ kirby04, 16672 author = {Robert C. Kirby}, 16673 title = {Algorithm 839: {FIAT}, a new paradigm for computing finite element basis 16674 functions}, 16675 journal = {ACM Transactions on Mathematical Software}, 16676 volume = {30}, 16677 number = {4}, 16678 year = {2004}, 16679 issn = {0098-3500}, 16680 pages = {502--516}, 16681 doi = {10.1145/1039813.1039820}, 16682 publisher = {ACM Press}, 16683 address = {New York, NY} 16684} 16685 16686@Article{ kirby06, 16687 author = {Robert C. Kirby}, 16688 title = {Optimizing {FIAT} with level 3 {BLAS}}, 16689 journal = {ACM Transactions on Mathematical Software}, 16690 volume = {32}, 16691 number = {2}, 16692 year = {2006}, 16693 issn = {0098-3500}, 16694 pages = {223--235}, 16695 doi = {10.1145/1141885.1141889}, 16696 publisher = {ACM Press}, 16697 address = {New York, NY} 16698} 16699 16700@Misc{ bluecrystal08, 16701 author = {{B}lue {C}rystal Cluster}, 16702 title = {Advanced {C}omputing {R}esearch {C}entre{,} {University of Bristol}}, 16703 year = {2008}, 16704 note = {\url{http://www.acrc.bris.ac.uk/acrc/hpc.htm}} 16705} 16706 16707@Article{ beylkin95, 16708 author = {Gregory Beylkin}, 16709 title = {On the Fast Fourier Transform of Functions With Singularities}, 16710 journal = {Applied and Computational Harmonic Analysis}, 16711 volume = {2}, 16712 pages = {363--381}, 16713 year = {1995} 16714} 16715 16716@InProceedings{ riehl08, 16717 author = {Jonathan Riehl}, 16718 title = {Implementing the MyFEM Embedded Domain-specific Language}, 16719 booktitle = {Proceedings of the Second International Workshop on Domain-specific Program 16720 Development (DSPD'08)}, 16721 address = {Nashville, TN}, 16722 year = {2008} 16723} 16724 16725@Article{ appel85, 16726 author = {Andrew W. Appel}, 16727 date-added = {2008-02-27 12:23:39 +0000}, 16728 date-modified = {2008-02-27 12:24:02 +0000}, 16729 doi = {10.1137/0906008}, 16730 journal = {SIAM Journal on Scientific and Statistical Computing}, 16731 keywords = {treecodes}, 16732 number = {1}, 16733 pages = {85-103}, 16734 publisher = {SIAM}, 16735 title = {An Efficient Program for Many-Body Simulation}, 16736 volume = {6}, 16737 year = {1985} 16738} 16739 16740@Article{ ewald21, 16741 author = {{Ewald}, P.~P.}, 16742 title = {{Die Berechnung optischer und elektrostatischer Gitterpotentiale}}, 16743 journal = {Annalen der Physik}, 16744 year = {1921}, 16745 volume = {369}, 16746 pages = {253-287}, 16747 doi = {10.1002/andp.19213690304}, 16748 adsurl = {http://adsabs.harvard.edu/abs/1921AnP...369..253E}, 16749 adsnote = {Provided by the SAO/NASA Astrophysics Data System} 16750} 16751 16752@Article{ greengardrokhlin87, 16753 author = {L. Greengard and V. Rokhlin}, 16754 date-added = {2008-02-15 18:43:55 +0000}, 16755 date-modified = {2008-02-26 20:09:11 +0000}, 16756 doi = {10.1016/0021-9991(87)90140-9}, 16757 journal = {J. Comput.\ Phys.}, 16758 keywords = {FMM}, 16759 number = {2}, 16760 pages = {325--348}, 16761 title = {A Fast Algorithm for Particle Simulations}, 16762 url = {citeseer.ist.psu.edu/greengard87fast.html}, 16763 volume = {73}, 16764 year = {1987}, 16765 bdsk-url-1 = {citeseer.ist.psu.edu/greengard87fast.html} 16766} 16767 16768@Article{ greengardrokhlin97, 16769 author = {L. Greengard and V. Rokhlin}, 16770 title = {A New Version of the Fast Multipole Method for the Laplace Equation in Three 16771 Dimensions}, 16772 journal = {Acta Numerica}, 16773 volume = {6}, 16774 year = {1997}, 16775 pages = {229--269} 16776} 16777 16778@Article{ luchenghuangmccammon06, 16779 author = {Benzhuo Lu and Xiaolin Cheng and Jingfang Huang and J. Andrew McCammon}, 16780 title = {Order {N} algorithm for computation of electrostatic interactions in biomolecular 16781 systems}, 16782 journal = {PNAS}, 16783 doi = {10.1073/pnas.0605166103}, 16784 volume = {102}, 16785 number = {51}, 16786 year = {2006}, 16787 pages = {19314--19319} 16788} 16789 16790@Article{ schussnadlereisenberg01, 16791 author = {Zev Schuss and Boaz Nadler and Robert S. Eisenberg}, 16792 title = {Derivation of {P}oisson and {N}ernst-{P}lanck equations in a bath and channel 16793 from a molecular model}, 16794 journal = {Physical Review E}, 16795 volume = {64}, 16796 number = {3}, 16797 year = {2001} 16798} 16799 16800@Book{ hairerlubichwanner02, 16801 author = {E. Hairer and Ch. Lubich and G. Wanner}, 16802 title = {Geometric Numerical Integration}, 16803 publisher = {Springer-Verlag}, 16804 address = {Berlin Heidelberg}, 16805 year = {2002} 16806} 16807 16808@Article{ holstbakerwang00, 16809 author = {M. Holst and N. Baker and F. Wang}, 16810 title = {The adaptive multilevel finite element solution of the {P}oisson-{B}oltzmann 16811 equation on massively parallel computers}, 16812 journal = {Journal of Computational Chemistry}, 16813 volume = {21}, 16814 year = {2000} 16815} 16816 16817@Book{ hockneyeastwood81, 16818 author = {R. Hockney and J. Eastwood}, 16819 title = {Computer simulation using particles}, 16820 publisher = {McGraw-Hill}, 16821 address = {New York}, 16822 year = {1981} 16823} 16824 16825@Article{ lutydavistironigunsteren94, 16826 author = {Brock A. Luty and Malcolm E. Davis and Ilario G. Tironi and Wilfred F. Van 16827 Gunsteren}, 16828 title = {A Comparison of {P}article-{P}article, {P}article-{M}esh and {E}wald Methods for 16829 Calculating Electrostatic Interactions in Periodic Molecular Systems}, 16830 journal = {Molecular Simulation}, 16831 volume = {14}, 16832 number = {1}, 16833 year = {1994}, 16834 pages = {11--20} 16835} 16836 16837@Book{ briggshensonmccormick00, 16838 author = {Briggs,, William L. and Henson,, Van Emden and McCormick,, Steve F.}, 16839 title = {A Multigrid Tutorial (2nd ed.)}, 16840 year = {2000}, 16841 isbn = {0-89871-462-1}, 16842 publisher = {Society for Industrial and Applied Mathematics}, 16843 address = {Philadelphia, PA} 16844} 16845 16846@Article{ chartier2003spectral, 16847 title = {Spectral AMGe ($\rho$ AMGe)}, 16848 author = {Chartier, Tim and Falgout, RD and Henson, VE and Jones, J and Manteuffel, T and 16849 McCormick, S and Ruge, J and Vassilevski, PS}, 16850 journal = {SIAM Journal on Scientific Computing}, 16851 volume = {25}, 16852 number = {1}, 16853 pages = {1--26}, 16854 year = {2003}, 16855 publisher = {SIAM} 16856} 16857 16858@Article{ galvis2010domain, 16859 title = {Domain decomposition preconditioners for multiscale flows in high-contrast 16860 media}, 16861 author = {Galvis, Juan and Efendiev, Yalchin}, 16862 journal = {Multiscale Modeling \& Simulation}, 16863 volume = {8}, 16864 number = {4}, 16865 pages = {1461--1483}, 16866 year = {2010}, 16867 publisher = {SIAM} 16868} 16869 16870@Book{ brennerscott02, 16871 author = {Susanne~C. Brenner and L.~Ridgway Scott}, 16872 title = {The mathematical theory of finite element methods}, 16873 year = {2002}, 16874 isbn = {0-38795-451-1}, 16875 publisher = {Springer}, 16876 pages = {361} 16877} 16878 16879@Book{ trefethenbau97, 16880 author = {Lloyd N. Trefethen and David {Bau, III}}, 16881 title = {Numerical Linear Algebra}, 16882 publisher = {Society for Industrial and Applied Mathematics}, 16883 address = {Philadelphia, PA}, 16884 pages = {xii + 361}, 16885 year = {1997}, 16886 isbn = {0-89871-361-7}, 16887 isbn-13 = {978-0-89871-361-9}, 16888 lccn = {QA184 .T74 1997}, 16889 mrclass = {65-01 (65-02 65Fxx)}, 16890 mrnumber = {MR1444820 (98k:65002)}, 16891 mrreviewer = {Moody T. Chu}, 16892 bibdate = {Wed Jan 07 15:23:19 1998}, 16893 bibsource = {ftp://ftp.math.utah.edu/pub/bibnet/authors/t/trefethen-lloyd-n.bib} 16894} 16895 16896@Article{ liptonreagan2014, 16897 title = {Quantum Algorithms via Linear Algebra: A Primer}, 16898 author = {Richard J Lipton and Kenneth W Regan}, 16899 pages = {206}, 16900 isbn = {978-0-26202-839-4}, 16901 year = {2014} 16902} 16903 16904@InProceedings{ rhea08, 16905 author = {Carsten Burstedde and Omar Ghattas and Michael Gurnis and Georg Stadler and Eh 16906 Tan and T.~Tu and Lucas~C. Wilcox and Shijie Zhong}, 16907 title = {Scalable adaptive mantle convection simulation on petascale supercomputers}, 16908 booktitle = {Proceedings of IEEE/ACM SC '08}, 16909 year = {2008} 16910} 16911 16912@Misc{ bursteddewilcox09, 16913 author = {Carsten Burstedde and Lucas~C. Wilcox}, 16914 title = {The p4est library: A parallel scalable forest of adaptive octrees}, 16915 note = {in preparation} 16916} 16917 16918@Article{ skeeltezcanhardy02, 16919 author = {R. D. Skeel and I. Tezcan and D. J. Hardy}, 16920 title = {Multiple Grid Methods for Classical Molecular Dynamics}, 16921 journal = {J. Comp. Chem.}, 16922 volume = {23}, 16923 pages = {673--684}, 16924 year = {2002} 16925} 16926 16927@Article{ verschelde99, 16928 author = {Jan Verschelde}, 16929 title = {Algorithm 795: PHCpack: a general-purpose solver for polynomial systems by 16930 homotopy continuation}, 16931 journal = {ACM Trans. Math. Softw.}, 16932 volume = {25}, 16933 number = {2}, 16934 issn = {0098-3500}, 16935 pages = {251--276}, 16936 doi = {10.1145/317275.317286}, 16937 publisher = {ACM}, 16938 address = {New York, NY}, 16939 year = {1999} 16940} 16941 16942@InProceedings{ sommeseverscheldewampler08, 16943 author = {Andrew J. Sommese and Jan Verschelde and Charles W. Wampler}, 16944 title = {Solving Polynomial Systems Equation by Equation}, 16945 booktitle = {IMA Volume 146: Algorithms in Algebraic Geometry}, 16946 editor = {Alicia Dickenstein and Frank-Olaf Schreyer and Andrew J. Sommese}, 16947 pages = {133--152}, 16948 publisher = {Springer-Verlag}, 16949 year = {2008} 16950} 16951 16952@Article{ phanthientanner77, 16953 author = {N. Phan-Thien and R.~I. Tanner}, 16954 title = {A new constitutive equation derived from network theory}, 16955 journal = {J. Non-Newt. Fluid Mech.}, 16956 volume = {2}, 16957 pages = {353}, 16958 year = {1977} 16959} 16960 16961@Manual{ sage, 16962 key = {SAGE}, 16963 author = {W.\thinspace{}A. Stein and others}, 16964 organization = {The Sage~Development Team}, 16965 title = {{S}age {M}athematics {S}oftware ({V}ersion 3.3)}, 16966 note = {{\tt http://www.sagemath.org}}, 16967 year = {2009} 16968} 16969 16970@Misc{ bateshauensteinsommesewampler06, 16971 author = {Daniel J. Bates and Jonathan D. Hauenstein and Andrew J. Sommese and Charles W. 16972 Wampler}, 16973 title = {{B}ertini: {S}oftware for {N}umerical {A}lgebraic {G}eometry}, 16974 howpublished = {Available at http://www.nd.edu/$\sim$sommese/bertini} 16975} 16976 16977@Article{ archer09, 16978 author = {A. J. Archer}, 16979 collaboration = {}, 16980 title = {Dynamical density functional theory for molecular and colloidal fluids: A 16981 microscopic approach to fluid mechanics}, 16982 publisher = {AIP}, 16983 year = {2009}, 16984 journal = {The Journal of Chemical Physics}, 16985 volume = {130}, 16986 number = {1}, 16987 eid = {014509}, 16988 numpages = {8}, 16989 pages = {014509}, 16990 keywords = {colloids; continuum mechanics; density functional theory; free energy; glass 16991 transition; statistical distributions; stochastic processes}, 16992 doi = {10.1063/1.3054633} 16993} 16994 16995@Article{ giesekus1966, 16996 author = {Hanswalter Giesekus}, 16997 title = {Die Elastizit\"at von Fl\"ussigkeiten}, 16998 journal = {Rheologica Acta}, 16999 publisher = {Springer Berlin / Heidelberg}, 17000 volume = {5}, 17001 number = {1}, 17002 month = mar, 17003 year = {1966}, 17004 doi = {10.1007/BF01973575}, 17005 pages = {29-35} 17006} 17007 17008@Article{ baaijens98, 17009 author = {F.P. Baaijens}, 17010 title = {Mixed finite element methods for viscoelastic flow analysis: a review}, 17011 journal = {Journal of Non-Newtonian Fluid Mechanics}, 17012 volume = {79}, 17013 year = {1998}, 17014 pages = {361--385} 17015} 17016 17017@Book{ joseph90, 17018 author = {D.~D. Joseph}, 17019 title = {Fluid Dynamics of Viscoelastic Liquids}, 17020 publisher = {Springer}, 17021 address = {New York, NY}, 17022 year = {1990} 17023} 17024 17025@Article{ oldroyd50, 17026 author = {J.~G. Oldroyd}, 17027 title = {On the Formulation of Rheological Equations of State}, 17028 journal = {Proceedings of the Royal Society of London. Series A, Mathematical and Physical 17029 Sciences}, 17030 volume = {200}, 17031 year = {1950}, 17032 pages = {523--541} 17033} 17034 17035@InProceedings{ bynasungroppthakur04, 17036 author = {S. Byna and X.-H. Sun and W. Gropp and R. Thakur}, 17037 title = {Predicting Memory-Access Cost Based on Data-Access Patterns}, 17038 booktitle = {Proceedings of IEEE International Conference on Cluster Computing, San Diego}, 17039 year = {2004} 17040} 17041 17042@Book{ pozrikidis07, 17043 author = {C. Pozrikidis}, 17044 title = {Fluid Dynamics: Theory, Computation, and Numerical Simulation}, 17045 publisher = {Kluwer (Springer)}, 17046 pages = {675}, 17047 year = {2001}, 17048 isbn = {0792373510} 17049} 17050 17051@Misc{ kritzkeyesfsp07, 17052 author = {A. Kritz and D. Keyes}, 17053 title = {{Fusion Simulation Project Workshop Report}}, 17054 month = jul, 17055 year = {2007}, 17056 note = {Available via 17057 \url{http://www.sc.doe.gov/ofes/More_HTML/FESAC/FESAC07/FSP_report_070702d.pdf}} 17058} 17059 17060@Misc{ dahlburg02, 17061 author = {J. {Dahlburg (Chair)}}, 17062 title = {{Final Report of the FESAC ISOFS SubCommittee}}, 17063 year = {2002}, 17064 note = {Available via 17065 \url{http://www.ofes.fusion.doe.gov/More_HTML/FESAC/FESAC11-02/Dahlburg.pdf}} 17066} 17067 17068@Misc{ brown08, 17069 author = {D. {Brown (Chair)}}, 17070 title = {{Applied Mathematics at the U.S. Department of Energy: Past, Present, and a View 17071 to the Future}}, 17072 year = {2008}, 17073 howpublished = {Office of Science, U.S. Department of Energy}, 17074 url = {http://science.energy.gov/~/media/ascr/pdf/program-documents/docs/Brown_report_may_08.pdf} 17075} 17076 17077@Misc{ crosscutting10, 17078 author = {D. Brown and P. {Messina (Chairs)}}, 17079 title = {{Scientific Grand Challenges: Crosscutting Technologies for Computing at the 17080 Exascale}}, 17081 year = {2010}, 17082 howpublished = {Office of Science, U.S. Department of Energy}, 17083 url = {http://extremecomputing.labworks.org/SumReps/Crosscutting-SumRep-PNNL_20168.pdf} 17084} 17085 17086@Misc{ extreme-scale-solvers-workshop12, 17087 author = {J. Ang and K. Evans and A. Geist and M. Heroux and P. Hovland and O. Marques and 17088 L.C. McInnes and E. Ng and S. Wild}, 17089 title = {Report on the Workshop on Extreme-Scale Solvers: Transitions to Future 17090 Architectures}, 17091 howpublished = {Office of Advanced Scientific Computing Research, U.S. Department of Energy}, 17092 note = {{Washington, DC}, March 8-9, 2012}, 17093 url = {http://science.energy.gov/~/media/ascr/pdf/program-documents/docs/reportExtremeScaleSolvers2012.pdf}, 17094 year = {2012} 17095} 17096 17097@Misc{ monizrosner09, 17098 author = {{E. Moniz and R. Rosner}}, 17099 title = {{Workshop on Science Based Nuclear Energy Systems Enabled by Advanced Modeling 17100 and Simulation at the Extreme Scale}}, 17101 month = may, 17102 year = {2009}, 17103 note = {See 17104 \url{http://extremecomputing.labworks.org/crosscut/references/nuclearenergy10exascael.pdf}} 17105} 17106 17107@Misc{ blanford08, 17108 author = {{R. Blandord (Chair)}}, 17109 title = {{Workshop on Challenges for Understanding the Quantum Universe and the Role of 17110 Computing at the Extreme Scale}}, 17111 month = dec, 17112 year = {2008}, 17113 note = {See 17114 \url{http://extremecomputing.labworks.org/crosscut/references/HEPreport10exascale.pdf}} 17115} 17116 17117@Misc{ exascale07, 17118 author = {H. Simon and T. Zacharia and R. Stevens}, 17119 title = {{Modeling and Simulation at the Exascale for Energy and the Environment}}, 17120 year = {2007}, 17121 note = {See \url{http://www.sc.doe.gov/ascr/ProgramDocuments/Docs/TownHall.pdf}} 17122} 17123 17124@Misc{ ascrbreakthroughs08, 17125 author = {{Panel on Recent Significant Advancements in Computational Science}}, 17126 title = {Breakthroughs}, 17127 year = {2008}, 17128 note = {See 17129 \url{http://www.er.doe.gov/ASCR/ProgramDocuments/Docs/Breakthroughs_2008.pdf}} 17130} 17131 17132@Misc{ petsc-rd100-2009, 17133 author = {{R\&D Magazine}}, 17134 title = {{PETSc} {R}\&{D} 100 Award}, 17135 year = {2009}, 17136 note = {See 17137 \url{http://www.rdmag.com/Awards/RD-100-Awards/2009/07/PETSc-Release-3-0-Expands-Capabilities}} 17138} 17139 17140@Article{ compass-scidac08, 17141 author = {P. Spentzouris and J. Cary and L. C. McInnes and W. Mori and C. Ng and E. Ng and 17142 R. Ryne}, 17143 title = {Community Petascale Project for Accelerator Science and Simulation: Advancing 17144 Computational Science for Future Accelerators and Accelerator Technologies}, 17145 journal = {J. Phys.: Conf. Ser.}, 17146 volume = {125}, 17147 year = {2008}, 17148 pages = {012001}, 17149 url = {http://iopscience.iop.org/1742-6596/125/1/012001} 17150} 17151 17152@Article{ compass-amundson-scidac08, 17153 title = {Multiscale, Multiphysics Beam Dynamics Framework Design and Applications}, 17154 author = {J. Amundson and D. Dechow and L. McInnes and B. Norris and P. Spentzouris and P. 17155 Stoltz}, 17156 journal = {J. Phys.: Conf. Ser.}, 17157 volume = {125}, 17158 year = {2008} 17159} 17160 17161@InProceedings{ muszala09, 17162 title = {Two-tiered Component Design and Performance Analysis of {Synergia2} Accelerator 17163 Simulations}, 17164 author = {S. Muszala and J. Amundson and L. C. McInnes and B. Norris}, 17165 booktitle = {Proceedings of the 2009 Workshop on Component-Based High Performance Computing 17166 {(CBHPC 2009)}}, 17167 year = {2009} 17168} 17169 17170@Article{ gaston09, 17171 title = {{MOOSE}: A Parallel Computational Framework for Coupled Systems of Nonlinear 17172 Equations}, 17173 author = {Derek Gaston and Chris Newman and Glen Hansen and Damien Lebrun-Grandie}, 17174 journal = {Nuclear Engineering and Design}, 17175 volume = {239}, 17176 number = {10}, 17177 year = {2009}, 17178 pages = {1768 -- 1778} 17179} 17180 17181@Article{ gaston09b, 17182 title = {Parallel Multiphysics Algorithms and Software for Computational Nuclear 17183 Engineering}, 17184 author = {D. Gaston and G. Hansen and S. Kadioglu and D. Knoll and C. Newman and H. Park 17185 and C. Permann and W. Taitano}, 17186 journal = {J. Phys.: Conf. Ser.}, 17187 volume = {180}, 17188 year = {2009}, 17189 pages = {012012} 17190} 17191 17192@Article{ newman09, 17193 title = {Three Dimensional Coupled Simulation of Thermomechanics, Heat, and Oxygen 17194 Diffusion in {UO$_2$} Nuclear Fuel Rods}, 17195 author = {Chris Newman and Glen Hansen and Derek Gaston}, 17196 journal = {Journal of Nuclear Materials}, 17197 volume = {392}, 17198 issue = {1}, 17199 year = {2009}, 17200 pages = {6 -- 15} 17201} 17202 17203@Misc{ www:fenics, 17204 author = {{FE}ni{CS}}, 17205 title = {{FE}ni{CS} Project}, 17206 howpublished = {\url{http://www.fenics.org/}}, 17207 year = {2018} 17208} 17209 17210@InProceedings{ zwart08, 17211 title = {A Multiphysics and Multiscale Software Environment for Modeling Astrophysical 17212 Systems}, 17213 author = {S. Zwart and S. McMillan and B. Nuallain and D. Heggie and J. Lombarsi and P. Hut 17214 and S. Banerjee and H. Belkus and T. Fragos and J. Fregeau and M. Fuji and E. 17215 Gaburov and E. Glebbeek and D. Groen and S. Harfst and R. Izzard and J. Juric and 17216 S. Justham and P. Teuben and J. van Bever and O. Yaron and M. Zemp}, 17217 booktitle = {Proceedings of ICCS 2008}, 17218 year = {2008} 17219} 17220 17221@Article{ klocknerwarburtonbridgehesthaven09, 17222 author = {Kl\"{o}ckner, A. and Warburton, T. and Bridge, J. and Hesthaven, J. S.}, 17223 title = {Nodal discontinuous {G}alerkin methods on graphics processors}, 17224 journal = {J. Comput. Phys.}, 17225 volume = {228}, 17226 number = {21}, 17227 year = {2009}, 17228 issn = {0021-9991}, 17229 pages = {7863--7882}, 17230 doi = {10.1016/j.jcp.2009.06.041}, 17231 publisher = {Academic Press Professional}, 17232 address = {San Diego, CA} 17233} 17234 17235@PhDThesis{ rankin99, 17236 author = {Rankin, W. T.}, 17237 keywords = {FMM, parallel FMM}, 17238 school = {Department of Electrical and Computer Engineering, Duke University}, 17239 title = {Efficient parallel implementations of multipole-based {$N$}-body algorithms}, 17240 year = {1999} 17241} 17242 17243@InProceedings{ warrensalmon93, 17244 abstract = {We report on an efficient adaptive N-body method which we have recently designed 17245 and implemented. The algorithm computes the forces on an arbitrary distribution of 17246 bodies in a time which scales as N log N with the particle number. The accuracy of 17247 the force calculations is analytically bounded, and can be adjusted via a user 17248 defined parameter between a few percent relative accuracy, down to machine 17249 arithmetic accuracy. Instead of using pointers to indicate the topology of the 17250 tree, we identify...}, 17251 address = {New York}, 17252 author = {Warren, Michael S. and Salmon, John K.}, 17253 booktitle = {Proceedings of the 1993 ACM/IEEE Conference on Supercomputing}, 17254 citeulike-article-id={580952}, 17255 keywords = {oct-tree}, 17256 pages = {12--21}, 17257 publisher = {ACM}, 17258 title = {A parallel hashed Oct-Tree {N}-body algorithm}, 17259 year = {1993}, 17260 doi = {10.1145/169627.169640}, 17261 url = {http://citeseerx.ist.psu.edu/viewdoc/summary?doi=10.1.1.50.100} 17262} 17263 17264@Unpublished{ cruzwccm10, 17265 author = {Felipe A. Cruz}, 17266 title = {Heterogeneous extension of the PetFMM a Fast Multipole Library}, 17267 note = {Presentation at WCCM 2010, Sydney Australia}, 17268 year = {2010} 17269} 17270 17271@Article{ mcguffee06, 17272 author = {S.~R. {McGuffee} and A.~H. Elcock}, 17273 title = {Atomistically detailed simulations of concentrated protein solutions: the effects 17274 of salt, {pH}, point mutations, and protein concentration in simulations of 17275 1000-molecule systems}, 17276 journal = {Journal of the American Chemical Society}, 17277 volume = {128}, 17278 pages = {12098--12110}, 17279 year = {2006} 17280} 17281 17282@Article{ nilsencaihoylandlangtangen10, 17283 author = {{Nilsen}, J.~K. and {Cai}, X. and {Hoyland}, B. and {Petter Langtangen}, H.}, 17284 title = {{Simplifying Parallelization of Scientific Codes by a Function-Centric Approach 17285 in Python}}, 17286 journal = {ArXiv e-prints}, 17287 archiveprefix = {arXiv}, 17288 eprint = {1002.0705}, 17289 primaryclass = {cs.DC}, 17290 keywords = {Computer Science - Distributed, Parallel, and Cluster Computing, Computer Science 17291 - Programming Languages}, 17292 year = {2010}, 17293 month = feb, 17294 adsurl = {http://adsabs.harvard.edu/abs/2010arXiv1002.0705N}, 17295 adsnote = {Provided by the SAO/NASA Astrophysics Data System} 17296} 17297 17298@Misc{ mcinnes:siam09:minisymposium, 17299 title = {Implicit Nonlinear Solvers in Multimodel Simulations}, 17300 author = {L. C. McInnes and C. {Woodward (co-organizers)}}, 17301 note = {invited minisymposium session at the SIAM Annual Meeting, July 9-10, 2009, 17302 Denver, CO, speakers were: C. Woodward (LLNL), E. Myra (Univ. of Michigan), J. 17303 White (Stanford Univ.), A. Barker (Univ. of Colorado, Boulder), L. Wilcox (Univ. 17304 of Texas at Austin), R. Mills (ORNL), B. F. Smith (ANL), J. Shadid (SNL), D. Knoll 17305 (INL), G. Hansen (INL), J. Cary (Tech-X Corp.), T. Wildey (Univ. of Texas at 17306 Austin).} 17307} 17308 17309@Misc{ mcinnes:fsp-summary:feb2011, 17310 author = {Lois Curfman McInnes and Luis Chacon and John Shadid}, 17311 title = {Solvers and Time Integration Breakout Summary}, 17312 note = {FSP Planning Workshop, General Atomics, Feb 8-11, 2011, see 17313 \url{https://ice.txcorp.com/trac/2011_FspDefinitionWorkshop}} 17314} 17315 17316@Misc{ dvi-materials:siamcse11, 17317 title = {Progress in Large-Scale Differential Variational Inequalities for Heterogeneous 17318 Materials}, 17319 author = {M. Anitescu and A. El-Azab and J. Lee and L. C. McInnes and T. Munson and B. F. 17320 Smith and L. Wang}, 17321 note = {minisymposium presentation at the 2011 SIAM Conference on Computational Science 17322 and Engineering, March 3, 2011} 17323} 17324 17325@Misc{ jamroz:cemm10, 17326 title = {{JFNK} within the semi-implicit scheme in {NIMROD}}, 17327 author = {B. Jamroz and S. Kruger and T. Austin}, 17328 note = {presentation, CEMM Meeting, Chicago, IL, Nov 7, 2010} 17329} 17330 17331@Misc{ kruger:feb4-2011, 17332 title = {personal communication}, 17333 author = {S. Kruger}, 17334 note = {February, 2011} 17335} 17336 17337@Article{ elman1996, 17338 author = {H.C. Elman}, 17339 title = {Preconditioning for the steady-state {Navier-Stokes} equations for low 17340 viscosity}, 17341 journal = {SIAM J. Sci. Comput.}, 17342 volume = {20}, 17343 year = {1996}, 17344 pages = {1299--1316} 17345} 17346 17347@Article{ kayloghinwathen2002, 17348 author = {D. Kay and D. Loghin and A. Wathen}, 17349 title = {A preconditioning for the steady-state {Navier-Stokes} equations}, 17350 journal = {SIAM J. Sci. Comput.}, 17351 volume = {24}, 17352 year = {2002}, 17353 pages = {237--256} 17354} 17355 17356@Article{ elmanhowleshadidshuttleworthtuminaro2006, 17357 author = {H.C. Elman and V.E. Howle and J. Shadid and R. Shuttleworth and R. Tuminaro}, 17358 title = {Block preconditioners based on approximate commutators}, 17359 journal = {SIAM J. Sci. Comput.}, 17360 volume = {27}, 17361 number = {5}, 17362 year = {2006}, 17363 pages = {1651--1668} 17364} 17365 17366@Article{ braesssarazin1997, 17367 author = {Dietrich Braess and Regina Sarazin}, 17368 title = {An efficient smoother for the {Stokes} problem}, 17369 journal = {Applied Numerical Mathematics}, 17370 volume = {23}, 17371 number = {1}, 17372 year = {1997}, 17373 pages = {3--19}, 17374 doi = {10.1016/S0168-9274(96)00059-1} 17375} 17376 17377@Article{ wright2001large, 17378 title = {Large-Scale Computation of Pseudospectra Using {ARPACK} and \texttt{eigs}}, 17379 author = {Wright, T.G. and Trefethen, L.N.}, 17380 journal = {SIAM Journal on Scientific Computing}, 17381 volume = {23}, 17382 pages = {591}, 17383 year = {2001} 17384} 17385 17386@Misc{ wright2002eigtool, 17387 title = {Eig{T}ool}, 17388 author = {Wright, T.G. and Trefethen, LN}, 17389 howpublished = {Software available at \url{http://www.comlab.ox.ac.uk/pseudospectra/eigtool}}, 17390 year = {2002} 17391} 17392 17393@Misc{ visit-web-site, 17394 key = {{VisIt}}, 17395 title = {{VisIt web site}}, 17396 howpublished = {\url{http://wci.llnl.gov/codes/visit/}}, 17397 url = {http://wci.llnl.gov/codes/visit/}, 17398 year = {2011} 17399} 17400 17401@Book{ trefethen1996, 17402 title = {Finite difference and spectral methods for ordinary and partial differential 17403 equations}, 17404 author = {Lloyd Nicholas Trefethen}, 17405 year = {1996}, 17406 publisher = {Cornell University-Department of Computer Science and Center for Applied 17407 Mathematics} 17408} 17409 17410@Book{ trefethen2005spectra, 17411 title = {Spectra and pseudospectra: the behavior of nonnormal matrices and operators}, 17412 author = {Trefethen, L.N. and Embree, M.}, 17413 year = {2005}, 17414 publisher = {Princeton University Press} 17415} 17416 17417@Article{ gomez2010isogeometric, 17418 title = {Isogeometric analysis of the isothermal {N}avier-{S}tokes-{K}orteweg equations}, 17419 author = {Gomez, H. and Hughes, T.J.R. and Nogueira, X. and Calo, V.M.}, 17420 journal = {Computer Methods in Applied Mechanics and Engineering}, 17421 volume = {199}, 17422 number = {25-28}, 17423 pages = {1828--1840}, 17424 issn = {0045-7825}, 17425 year = {2010}, 17426 publisher = {Elsevier} 17427} 17428 17429@Article{ gomez2008isogeometric, 17430 title = {Isogeometric analysis of the {C}ahn-{H}illiard phase-field model}, 17431 author = {G{\'o}mez, H. and Calo, V.M. and Bazilevs, Y. and Hughes, T.J.R.}, 17432 journal = {Computer Methods in Applied Mechanics and Engineering}, 17433 volume = {197}, 17434 number = {49-50}, 17435 pages = {4333--4352}, 17436 year = {2008}, 17437 publisher = {Elsevier} 17438} 17439 17440@Misc{ fastmath:project, 17441 author = {Lori {Diachin (PI)}}, 17442 title = {{SciDAC Frameworks, Algorithms, and Scalable Technologies for Mathematics 17443 (FASTMath) Institute}}, 17444 howpublished = {\url{https://fastmath-scidac.llnl.gov}} 17445} 17446 17447@Misc{ exascale-software:proposal, 17448 author = {Peter {Beckman (PI)}}, 17449 title = {{Exascale Software Center}}, 17450 note = {proposal to DOE} 17451} 17452 17453@Misc{ imex:project, 17454 author = {Barry {Smith (PI)}}, 17455 title = {{Scalable Implicit-Explicit (IMEX) Algorithms and Software for Time-Dependent 17456 Multimodel PDEs}}, 17457 note = {DOE ASCR applied math project} 17458} 17459 17460@Misc{ intel-mic:website, 17461 author = {Intel}, 17462 title = {{Many Integrated Core Architecture}}, 17463 note = {\url{http://www.intel.com/technology/architecture-silicon/mic}} 17464} 17465 17466@Article{ dudson:2009, 17467 author = {B.D. Dudson and M.V. Umansky and X.Q. Xu and P.B. Snyder and H.R. Wilson}, 17468 title = {{{BOUT++:}} a framework for parallel plasma fluid simulations}, 17469 journal = {Computer Physics Communications}, 17470 volume = {180}, 17471 pages = {1467}, 17472 year = {2009} 17473} 17474 17475@Article{ umansky:2009, 17476 author = {M.V. Umansky and X.Q. Xu and B. Dudson and L.L. LoDestro and J.R. Myra}, 17477 title = {{Status and verification of edge plasma turbulence code BOUT}}, 17478 journal = {Computer Physics Communications}, 17479 year = {2009}, 17480 volume = {180}, 17481 pages = {887-903} 17482} 17483 17484@Article{ xu:1998, 17485 author = {X.Q. Xu and R.H. Cohen}, 17486 title = {{Scrape-Off Layer Turbulence Theory and Simulations}}, 17487 journal = {Computer Physics Communications}, 17488 year = {1998}, 17489 volume = {36}, 17490 number = {1-2}, 17491 pages = {158} 17492} 17493 17494@Article{ tron:1999, 17495 title = {Newton's Method for Large Bound-constrained Optimization Problems}, 17496 author = {Chih-Jen Lin and Jorge Mor\'{e}}, 17497 journal = {SIAM Journal on Optimization}, 17498 volume = {9}, 17499 number = {4}, 17500 pages = {1100-1127}, 17501 year = {1999} 17502} 17503 17504@Article{ stubenamg, 17505 author = {K. St\"{u}ben}, 17506 title = {A review of algebraic multigrid}, 17507 journal = {J. Comput. Appl. Math.}, 17508 volume = {128}, 17509 number = {1-2}, 17510 year = {2001}, 17511 issn = {0377-0427}, 17512 pages = {281--309}, 17513 doi = {10.1016/S0377-0427(00)00516-1}, 17514 publisher = {Elsevier Science Publishers B. V.}, 17515 address = {Amsterdam, The Netherlands, The Netherlands} 17516} 17517 17518@Article{ feuchtermg, 17519 author = {D. Feuchter and I. Heppner and S. Sauter and G. Wittum}, 17520 title = {Bridging the gap between geometric and algebraic multigrid methods}, 17521 journal = {Computing and visualization in science}, 17522 publisher = {Springer}, 17523 volume = {6}, 17524 number = {1}, 17525 year = {2003}, 17526 pages = {1--13} 17527} 17528 17529@Article{ chowmgsmoothness, 17530 abstract = {For non-M-matrices, this paper proposes an unstructured multigrid method that 17531 only attempts to interpolate in the directions of geometrical smoothness. These 17532 directions are determined by analyzing samples of algebraically smooth error, e. 17533 Neighboring grid points i and j are called smoothly coupled if e i and e j are 17534 consistently nearby in value. In addition, these dierences may be used to dene 17535 interpolation weights. These new ideas may be incorporated into the algebraic 17536 multigrid method. Test results show that the new method can have much lower grid 17537 and operator complexities compared to AMG, leading to lower solve timings. 1 }, 17538 author = {Chow, Edmond}, 17539 citeulike-article-id={7675372}, 17540 citeulike-linkout-0={http://citeseerx.ist.psu.edu/viewdoc/summary?doi=10.1.1.22.4305}, 17541 journal = {American Journal of Mathematics}, 17542 keywords = {fem, multigrid}, 17543 pages = {197--215}, 17544 posted-at = {2010-08-17 23:29:51}, 17545 priority = {2}, 17546 title = {An Unstructured Multigrid Method Based on Geometric Smoothness}, 17547 url = {http://citeseerx.ist.psu.edu/viewdoc/summary?doi=10.1.1.22.4305}, 17548 volume = {65}, 17549 year = {2001} 17550} 17551 17552@Article{ jonesamge, 17553 abstract = {{This paper contains the main ideas for an AMGe (algebraic multigrid for finite 17554 elements) method based on element agglomeration. In the method, coarse grid 17555 elements are formed by agglomerating fine grid elements. Compatible interpolation 17556 operators are constructed which yield coarse grid basis functions with a minimal 17557 energy property. Heuristics based on interpolation quality measures are used to 17558 guide the agglomeration procedure. The performance of the resulting method is 17559 demonstrated in two-level numerical experiments.}}, 17560 author = {Jones, Jim E. and Vassilevski, Panayot S.}, 17561 citeulike-article-id={8598569}, 17562 citeulike-linkout-0={http://scitation.aip.org/getabs/servlet/GetabsServlet?prog=normal&id=SJOCE3000023000001000109000001&idtype=cvips&gifs=yes}, 17563 citeulike-linkout-1={http://link.aip.org/link/?SCE/23/109}, 17564 journal = {SIAM Journal on Scientific Computing}, 17565 keywords = {amg, fem, multigrid}, 17566 number = {1}, 17567 pages = {109--133}, 17568 posted-at = {2011-01-13 18:05:55}, 17569 priority = {2}, 17570 publisher = {SIAM}, 17571 title = {{AMGE Based on Element Agglomeration}}, 17572 url = {http://scitation.aip.org/getabs/servlet/GetabsServlet?prog=normal&id=SJOCE3000023000001000109000001&idtype=cvips&gifs=yes}, 17573 volume = {23}, 17574 year = {2001} 17575} 17576 17577@Article{ saad1993, 17578 author = {Saad, Youcef}, 17579 doi = {10.1137/0914028}, 17580 issn = {10648275}, 17581 journal = {SIAM Journal on Scientific Computing}, 17582 keywords = {65f10,ams,especially since the popularization,gate gradient,general purpose 17583 iterative methods,gmres,krylov subspace methods,mos,non-hermitian systems,of 17584 precondition-,preconditioned conju-,subject classi cations,variable 17585 preconditioners}, 17586 number = {2}, 17587 pages = {461--469}, 17588 title = {{A flexible inner-outer preconditioned GMRES algorithm}}, 17589 volume = {14}, 17590 year = {1993} 17591} 17592 17593@Misc{ path:homepage, 17594 author = {S. Dirkse and M. Ferris and T. Munson}, 17595 title = {{{PATH} {W}eb page}}, 17596 howpublished = {\url{http://pages.cs.wisc.edu/~ferris/path.html}} 17597} 17598 17599@Article{ ketcheson2008, 17600 author = {David I Ketcheson}, 17601 title = {Highly Efficient Strong Stability Preserving {Runge-Kutta} Methods with 17602 Low-Storage Implementations}, 17603 volume = {30}, 17604 journal = {SIAM Journal on Scientific Computing}, 17605 year = {2008}, 17606 pages = {2113--2136} 17607} 17608 17609@Article{ elman2009boundary, 17610 title = {{Boundary conditions in approximate commutator preconditioners for the 17611 Navier-Stokes equations}}, 17612 author = {Elman, H.C. and Tuminaro, R.}, 17613 journal = {Electronic Transactions on Numerical Analysis}, 17614 volume = {35}, 17615 pages = {257--280}, 17616 year = {2009} 17617} 17618 17619@Article{ elman2008tcp, 17620 title = {{A taxonomy and comparison of parallel block multi-level preconditioners for the 17621 incompressible Navier-Stokes equations}}, 17622 author = {Elman, H.C. and Howle, V.E. and Shadid, J. and Shuttleworth, R. and Tuminaro, 17623 R.}, 17624 journal = {Journal of Computational Physics}, 17625 volume = {227}, 17626 number = {1}, 17627 pages = {1790--1808}, 17628 year = {2008}, 17629 publisher = {Academic Press}, 17630 url = {http://chess.cs.umd.edu/~elman/papers/tax.pdf} 17631} 17632 17633@Article{ arioli2013, 17634 title = {Generalized {G}olub--{K}ahan bidiagonalization and stopping criteria}, 17635 author = {Arioli, Mario}, 17636 journal = {SIAM Journal on Matrix Analysis and Applications}, 17637 volume = {34}, 17638 number = {2}, 17639 pages = {571--592}, 17640 year = {2013}, 17641 publisher = {SIAM} 17642} 17643 17644@Book{ wesseling2009, 17645 title = {Principles of computational fluid dynamics}, 17646 author = {Wesseling, Pieter}, 17647 volume = {29}, 17648 year = {2009}, 17649 publisher = {Springer Science \& Business Media} 17650} 17651 17652@Article{ silvester2001efficient, 17653 title = {{Efficient preconditioning of the linearized Navier-Stokes equations for 17654 incompressible flow}}, 17655 author = {Silvester, D. and Elman, H. and Kay, D. and Wathen, A.}, 17656 journal = {Journal of Computational and Applied Mathematics}, 17657 volume = {128}, 17658 number = {1-2}, 17659 pages = {261--279}, 17660 issn = {0377-0427}, 17661 year = {2001}, 17662 publisher = {Elsevier} 17663} 17664 17665@Article{ elman1999bfbt, 17666 title = {{Preconditioning for the steady-state Navier-Stokes equations with low 17667 viscosity}}, 17668 author = {Elman, H.C.}, 17669 journal = {SIAM Journal on Scientific Computing}, 17670 volume = {20}, 17671 number = {4}, 17672 pages = {1299--1316}, 17673 issn = {1064-8275}, 17674 year = {1999}, 17675 publisher = {Citeseer} 17676} 17677 17678@Article{ elman2006bpb, 17679 title = {{Block preconditioners based on approximate commutators}}, 17680 author = {Elman, H. and Howle, V.E. and Shadid, J. and Shuttleworth, R. and Tuminaro, R.}, 17681 journal = {SIAM Journal on Scientific Computing}, 17682 volume = {27}, 17683 number = {5}, 17684 pages = {1651--1668}, 17685 year = {2006}, 17686 publisher = {Philadelphia, PA: SIAM, c1993-} 17687} 17688 17689@Article{ olshanskii2006analysis, 17690 title = {{Analysis of a Stokes interface problem}}, 17691 author = {Olshanskii, M.A. and Reusken, A.}, 17692 journal = {Numerische Mathematik}, 17693 volume = {103}, 17694 number = {1}, 17695 pages = {129--149}, 17696 issn = {0029-599X}, 17697 year = {2006}, 17698 publisher = {Springer} 17699} 17700 17701@Article{ patankar1972cph, 17702 title = {{A calculation procedure for heat, mass and momentum transfer in 17703 three-dimensional parabolic flows}}, 17704 author = {Patankar, S.V. and Spalding, D.B.}, 17705 journal = {Int. J. Heat Mass Transfer}, 17706 volume = {15}, 17707 pages = {1787--1806}, 17708 year = {1972} 17709} 17710 17711@Article{ rannacher1992simple, 17712 title = {{Simple nonconforming quadrilateral Stokes element}}, 17713 author = {Rannacher, R. and Turek, S.}, 17714 journal = {Numerical Methods for Partial Differential Equations}, 17715 volume = {8}, 17716 number = {2}, 17717 pages = {97--111}, 17718 issn = {1098-2426}, 17719 year = {1992}, 17720 publisher = {Wiley Online Library} 17721} 17722 17723@Article{ rannacher2000finite, 17724 title = {Finite Element Methods for the Incompressible {N}avier-{S}tokes Equations}, 17725 author = {Rannacher, R.}, 17726 journal = {Fundamental Directions in Mathematical Fluid Mechanics}, 17727 pages = {191}, 17728 isbn = {3764364149}, 17729 year = {2000}, 17730 publisher = {Birkhauser} 17731} 17732 17733@Article{ vanka1986block, 17734 title = {{Block-implicit multigrid solution of Navier-Stokes equations in primitive 17735 variables}}, 17736 author = {Vanka, S.P.}, 17737 journal = {Journal of Computational Physics}, 17738 volume = {65}, 17739 number = {1}, 17740 pages = {138--158}, 17741 issn = {0021-9991}, 17742 year = {1986}, 17743 publisher = {Elsevier} 17744} 17745 17746@Article{ eisenstat1983variational, 17747 title = {Variational iterative methods for nonsymmetric systems of linear equations}, 17748 author = {Eisenstat, S.C. and Elman, H.C. and Schultz, M.H.}, 17749 journal = {SIAM Journal on Numerical Analysis}, 17750 volume = {20}, 17751 number = {2}, 17752 pages = {345--357}, 17753 year = {1983}, 17754 publisher = {JSTOR} 17755} 17756 17757@InProceedings{ burstedde2008scalable, 17758 title = {Scalable adaptive mantle convection simulation on petascale supercomputers}, 17759 author = {Burstedde, C. and Ghattas, O. and Gurnis, M. and Stadler, G. and Tan, E. and Tu, 17760 T. and Wilcox, L.C. and Zhong, S.}, 17761 booktitle = {Proceedings of the 2008 ACM/IEEE conference on Supercomputing}, 17762 pages = {62}, 17763 year = {2008}, 17764 organization = {IEEE Press} 17765} 17766 17767@Article{ burstedde2009parallel, 17768 title = {Parallel scalable adjoint-based adaptive solution of variable-viscosity {Stokes} 17769 flow problems}, 17770 author = {Burstedde, C. and Ghattas, O. and Stadler, G. and Tu, T. and Wilcox, L.C.}, 17771 journal = {Computer Methods in Applied Mechanics and Engineering}, 17772 volume = {198}, 17773 number = {21-26}, 17774 pages = {1691--1700}, 17775 year = {2009}, 17776 publisher = {Elsevier} 17777} 17778 17779@Article{ stadler2010dynamics, 17780 title = {The dynamics of plate tectonics and mantle flow: From local to global scales}, 17781 author = {Stadler, G. and Gurnis, M. and Burstedde, C. and Wilcox, L.C. and Alisic, L. and 17782 Ghattas, O.}, 17783 journal = {Science}, 17784 volume = {329}, 17785 number = {5995}, 17786 pages = {1033}, 17787 year = {2010}, 17788 publisher = {American Association for the Advancement of Science} 17789} 17790 17791@Article{ tackley2008modelling, 17792 title = {Modelling compressible mantle convection with large viscosity contrasts in a 17793 three-dimensional spherical shell using the yin-yang grid}, 17794 author = {Tackley, P.J.}, 17795 journal = {Physics of the Earth and Planetary Interiors}, 17796 volume = {171}, 17797 number = {1-4}, 17798 pages = {7--18}, 17799 year = {2008}, 17800 publisher = {Elsevier} 17801} 17802 17803@Article{ moresizhonggurnis96, 17804 author = {Louis N. Moresi and Shijie Zhong and Michael Gurnis}, 17805 title = {The accuracy of finite element solutions of {S}tokes' flow with strongly varying 17806 viscosity}, 17807 journal = {Physics of the Earth and Planetary Interiors}, 17808 volume = {97}, 17809 pages = {83-–94}, 17810 year = {1996} 17811} 17812 17813@Article{ moresisolomatov95, 17814 author = {Louis N. Moresi and V. S. Solomatov}, 17815 title = {Numerical investigation of {2D} convection with extremely large viscosity 17816 variations}, 17817 journal = {Physics of Fluids}, 17818 volume = {7}, 17819 number = {9}, 17820 pages = {2154-–2162}, 17821 year = {1995} 17822} 17823 17824@Article{ chenmolnar83, 17825 author = {W.-P. Chen and P. Molnar}, 17826 title = {Focal depths of intra-continental and intraplate earthquakes and their 17827 implications for the thermal and mechanical properties of the lithosphere}, 17828 journal = {Journal of Geophysical Research}, 17829 volume = {88}, 17830 pages = {4183–-4214}, 17831 year = {1983} 17832} 17833 17834@Article{ jackson02, 17835 author = {J. Jackson}, 17836 title = {Strength of the continental lithosphere: time to abandon the jelly sandwich?}, 17837 journal = {GSA Today}, 17838 volume = {12}, 17839 pages = {4–-10}, 17840 year = {2002} 17841} 17842 17843@Article{ burovwatts06, 17844 author = {E.B. Burov and A.B. Watts}, 17845 title = {The long-term strength of continental lithosphere: jelly sandwich or creme 17846 brulee?}, 17847 journal = {GSA Today}, 17848 volume = {16}, 17849 pages = {4–-10}, 17850 year = {2006} 17851} 17852 17853@InProceedings{ yang:brent:2002, 17854 title = {The Improved {BiCGStab} Method for Large and Sparse Unsymmetric Linear Systems on 17855 Parallel Distributed Memory Architectures}, 17856 author = {Laurence T. Yang and Richard Brent}, 17857 booktitle = {Proceedings of the Fifth International Conference on Algorithms and Architectures 17858 for Parallel Processing}, 17859 year = {2002}, 17860 publisher = {IEEE} 17861} 17862 17863@Article{ demmel2008communication, 17864 title = {Communication-optimal parallel and sequential {QR} and {LU} factorizations}, 17865 author = {Demmel, J. and Grigori, L. and Hoemmen, M. and Langou, J.}, 17866 journal = {Arxiv preprint arXiv:0808.2664}, 17867 year = {2008} 17868} 17869 17870@Article{ demmel09, 17871 author = {J. Demmel and M. Hoemmen and M. Mohiyuddin and K Yelick}, 17872 title = {Communication-optimal Iterative Methods}, 17873 journal = {Journal of Physics: Conf. Series}, 17874 volume = {180}, 17875 year = {2009} 17876} 17877 17878@TechReport{ parms04, 17879 author = {Yousef Saad and Masha Sosonkina}, 17880 title = {{pARMS}: A package for the parallel iterative solution of general large sparse 17881 linear systems user's guide}, 17882 number = {UMSI2004-8}, 17883 institution = {Minnesota Supercomputer Institute, University of Minnesota}, 17884 year = {2004} 17885} 17886 17887@Article{ picard1890, 17888 author = {Emile Picard}, 17889 title = {M\'emoire sur la th\'eorie des \'equations aux d\'eriv\'ees partielles et la 17890 m\'ethode des approximations successives}, 17891 journal = {Journal De Math\'ematiques Pures et Appliqu\'ees}, 17892 volume = {4}, 17893 number = {6}, 17894 pages = {145--210}, 17895 year = {1890}, 17896 url = {http://math-doc.ujf-grenoble.fr/JMPA/PDF/JMPA_1890_4_6_A3_0.pdf} 17897} 17898 17899@Book{ rall1969, 17900 author = {Louis B. Rall}, 17901 title = {Computational solution of nonlinear operator equations}, 17902 publisher = {Krieger Pub Co.}, 17903 pages = {225}, 17904 year = {1969} 17905} 17906 17907@Article{ fletcherreeves1964, 17908 author = {R. Fletcher and C. M. Reeves}, 17909 title = {Function Minimization by Conjugate Gradients}, 17910 journal = {Computer Journal}, 17911 volume = {7}, 17912 pages = {149–-154}, 17913 year = {1964} 17914} 17915 17916@InBook{ mcinnesallanetal06, 17917 author = {Lois Curfman McInnes and Benjamin Allan and Robert Armstrong and Steven Benson 17918 and David Bernholdt and Tamara Dahlgren and Lori Diachin and Manojkumar Krishnan 17919 and James Kohl and Jay Larson and Sophia Lefantzi and Jarek Nieplocha and Boyana 17920 Norris and Steven Parker and Jaideep Ray and Shujia Zhou}, 17921 editor = {A.~M.~Bruaset and A.~Tveito}, 17922 title = {Numerical Solution of Partial Differential Equations on Parallel Computers}, 17923 chapter = {Parallel {PDE}-Based Simulations Using the {Common Component Architecture}}, 17924 publisher = {Springer}, 17925 year = {2006}, 17926 number = {51}, 17927 series = {Lecture Notes in Computational Science and Engineering}, 17928 pages = {327--381}, 17929 doi = {10.1016/S0167-8191(02)00191-6} 17930} 17931 17932@Article{ cyrshadidtuminaro12, 17933 title = {Stabilization and scalable block preconditioning for the {Navier–Stokes} 17934 equations}, 17935 journal = {Journal of Computational Physics}, 17936 volume = {231}, 17937 number = {2}, 17938 pages = {345 - 363}, 17939 year = {2012}, 17940 issn = {0021-9991}, 17941 doi = {10.1016/j.jcp.2011.09.001}, 17942 author = {Eric C. Cyr and John N. Shadid and Raymond S. Tuminaro} 17943} 17944 17945@Article{ keyesmcinneswoodwardetal13, 17946 title = {Multiphysics Simulations: Challenges and Opportunities}, 17947 author = {David E. Keyes and Lois Curfman McInnes and Carol Woodward and William Gropp and 17948 Eric Myra and Michael Pernice and John Bell and Jed Brown and Alain Clo and 17949 Jeffrey Connors and Emil Constantinescu and Don Estep and Kate Evans and Charbel 17950 Farhat and Ammar Hakim and Glenn Hammond and Glen Hansen and Judith Hill and Tobin 17951 Isaac and Xiangmin Jiao and Kirk Jordan and Dinesh Kaushik and Efthimios Kaxiras 17952 and Alice Koniges and Kihwan Lee and Aaron Lott and Qiming Lu and John Magerlein 17953 and Reed Maxwell and Michael McCourt and Miriam Mehl and Roger Pawlowski and 17954 Amanda Peters Randles and Daniel Reynolds and B\'{e}atrice Rivi\`{e}re and Ulrich 17955 R\"{u}de and Tim Scheibe and John Shadid and Brendan Sheehan and Mark Shephard and 17956 Andrew Siegel and Barry Smith and Xianzhu Tang and Cian Wilson and Barbara Wohlmuth}, 17957 journal = {International Journal of High Performance Computing Applications}, 17958 month = feb, 17959 year = {2013}, 17960 volume = {27}, 17961 number = {1}, 17962 pages = {4--83}, 17963 doi = {10.1177/1094342012468181}, 17964 note = {Special issue}, 17965 abstract = {We consider multiphysics applications from algorithmic and architectural 17966 perspectives, where ``algorithmic'' includes both mathematical analysis and 17967 computational complexity and ``architectural'' includes both software and hardware 17968 environments. Many diverse multiphysics applications can be reduced, en route to 17969 their computational simulation, to a common algebraic coupling paradigm. 17970 Mathematical analysis of multiphysics coupling in this form is not always 17971 practical for realistic applications, but model problems representative of 17972 applications discussed herein can provide insight. A variety of software 17973 frameworks for multiphysics applications have been constructed and refined within 17974 disciplinary communities and executed on leading-edge computer systems. We examine 17975 several of these, expose some commonalities among them, and attempt to extrapolate 17976 best practices to future systems. From our study, we summarize challenges and 17977 forecast opportunities.} 17978} 17979 17980@Misc{ rosner10, 17981 author = {Robert {Rosner (Chair)}}, 17982 title = {{The Opportunities and Challenges of Exascale Computing}}, 17983 year = {2010}, 17984 howpublished = {Office of Science, U.S. Department of Energy}, 17985 url = {http://science.energy.gov/~/media/ascr/ascac/pdf/reports/Exascale_subcommittee_report.pdf} 17986} 17987 17988@Misc{ kogge2008exascale, 17989 title = {ExaScale Computing Study: {T}echnology Challenges in achieving exascale systems}, 17990 author = {Peter Kogge and Keren Bergman and Shekhar Borkar and Dan Campbell and Willian 17991 Carlson and William Dally and Monty Denneau and Paul Franzon and William Harrod 17992 and Kerry Hill and Jon Hiller and Sherman Karp and Stephen Keckler and Dean Klein 17993 and Robert Lucas and Mark Richards and Al Scarpelly and Steven Scott and Allan 17994 Snavely and Themas Sterling and R. Stanley Williams and Katherine Yelick}, 17995 howpublished = {DARPA}, 17996 year = {2008}, 17997 url = {http://www.cse.nd.edu/Reports/2008/TR-2008-13.pdf} 17998} 17999 18000@Misc{ doegrandchallengeworkshops, 18001 key = {Office of Science, U.S. Department of Energy}, 18002 title = {{Scientific Grand Challenges Workshop Series}}, 18003 howpublished = {Office of Science, U.S. Department of Energy, see 18004 \url{http://extremecomputing.labworks.org/workshops.stm}} 18005} 18006 18007@Misc{ lawrence2011, 18008 key = {Lawrence}, 18009 title = {{Ernest Orlando Lawrence Award Winners}}, 18010 howpublished = {U.S. Department of Energy, {\footnotesize 18011 \url{http://energy.gov/articles/secretary-chu-announces-2011-ernest-orlando-lawrence-award-winners}}}, 18012 year = {2011} 18013} 18014 18015@Article{ murphy2000npi, 18016 title = {{A note on preconditioning for indefinite linear systems}}, 18017 author = {Murphy, M.F. and Golub, G.H. and Wathen, A.J.}, 18018 journal = {SIAM Journal on Scientific Computing}, 18019 volume = {21}, 18020 number = {6}, 18021 pages = {1969--1972}, 18022 year = {2000}, 18023 publisher = {Philadelphia, PA: SIAM, c1993-} 18024} 18025 18026@Article{ elman2011bouyancy, 18027 title = {Fast iterative solvers for buoyancy driven flow problems}, 18028 journal = {Journal of Computational Physics}, 18029 volume = {230}, 18030 number = {10}, 18031 pages = {3900 - 3914}, 18032 year = {2011}, 18033 note = {}, 18034 issn = {0021-9991}, 18035 doi = {10.1016/j.jcp.2011.02.014}, 18036 author = {Howard Elman and Milan Mihajlovic and David Silvester}, 18037 keywords = {Navier-Stokes, Boussinesq, Finite element approximation, Time stepping, 18038 Adaptivity, Preconditioning, Algebraic multigrid} 18039} 18040 18041@Article{ dongarrabeckman11, 18042 author = {J. Dongarra and P. Beckman and et al.}, 18043 title = {The {I}nternational {E}xascale {S}oftware {P}roject {R}oadmap}, 18044 journal = {Int. J. High Perf. Comput. Applics.}, 18045 volume = {25}, 18046 year = {2011}, 18047 pages = {3--60} 18048} 18049 18050@Article{ mandel1999energy, 18051 title = {Energy optimization of algebraic multigrid bases}, 18052 author = {Mandel, J. and Brezina, M. and Van{\v{e}}k, P.}, 18053 journal = {Computing}, 18054 volume = {62}, 18055 number = {3}, 18056 pages = {205--228}, 18057 year = {1999}, 18058 publisher = {Springer} 18059} 18060 18061@Article{ vanek1996algebraic, 18062 title = {Algebraic multigrid by smoothed aggregation for second and fourth order elliptic 18063 problems}, 18064 author = {Van{\v{e}}k, P. and Mandel, J. and Brezina, M.}, 18065 journal = {Computing}, 18066 volume = {56}, 18067 number = {3}, 18068 pages = {179--196}, 18069 year = {1996}, 18070 publisher = {Springer} 18071} 18072 18073@Article{ vanek2001convergence, 18074 title = {Convergence of algebraic multigrid based on smoothed aggregation}, 18075 author = {Van{\v{e}}ek, P. and Brezina, M. and Mandel, J.}, 18076 journal = {Numerische Mathematik}, 18077 volume = {88}, 18078 number = {3}, 18079 pages = {559--579}, 18080 year = {2001}, 18081 publisher = {Springer} 18082} 18083 18084@Article{ brannick2007algebraic, 18085 title = {Algebraic multigrid methods based on compatible relaxation and energy 18086 minimization}, 18087 author = {Brannick, J. and Zikatanov, L.}, 18088 journal = {Domain decomposition methods in science and engineering XVI}, 18089 pages = {15--26}, 18090 year = {2007}, 18091 publisher = {Springer} 18092} 18093 18094@Article{ brannickfalgout2010, 18095 title = {{Compatible Relaxation and Coarsening in Algebraic Multigrid}}, 18096 author = {James J. Brannick and Robert D. Falgout}, 18097 journal = {SIAM Journal on Scientific Computing}, 18098 volume = {32}, 18099 number = {3}, 18100 pages = {1393--1416}, 18101 url = {http://epubs.siam.org/doi/10.1137/090772216}, 18102 doi = {10.1137/090772216}, 18103 issn = {1064-8275}, 18104 year = {2010} 18105} 18106 18107@Article{ xu2004energy, 18108 title = {On an energy minimizing basis for algebraic multigrid methods}, 18109 author = {Xu, J. and Zikatanov, L.}, 18110 journal = {Computing and Visualization in Science}, 18111 volume = {7}, 18112 number = {3}, 18113 pages = {121--127}, 18114 year = {2004}, 18115 publisher = {Springer} 18116} 18117 18118@Article{ dblp:journals/toms/bakerhlt09, 18119 author = {C. G. Baker and Ulrich Hetmaniuk and Richard B. Lehoucq and Heidi Thornquist}, 18120 title = {Anasazi software for the numerical solution of large-scale eigenvalue problems}, 18121 journal = {ACM Trans. Math. Softw.}, 18122 volume = {36}, 18123 number = {3}, 18124 year = {2009}, 18125 doi = {10.1145/1527286.1527287}, 18126 bibsource = {DBLP, http://dblp.uni-trier.de} 18127} 18128 18129@Article{ dblp:journals/siamsc/yanggbllhn05, 18130 author = {Chao Yang and Weiguo Gao and Zhaojun Bai and Xiaoye S. Li and Lie-Quan Lee and 18131 Parry Husbands and Esmond G. Ng}, 18132 title = {An Algebraic Substructuring Method for Large-Scale Eigenvalue Calculation}, 18133 journal = {SIAM J. Scientific Computing}, 18134 volume = {27}, 18135 number = {3}, 18136 year = {2005}, 18137 pages = {873-892}, 18138 doi = {10.1137/040613767}, 18139 bibsource = {DBLP, http://dblp.uni-trier.de} 18140} 18141 18142@TechReport{ ml-guide, 18143 author = {M.W. Gee and C.M. Siefert and J.J. Hu and R.S. Tuminaro and M.G. Sala}, 18144 title = {{ML} 5.0 Smoothed Aggregation User's Guide}, 18145 institution = {Sandia National Laboratories}, 18146 year = {2006}, 18147 number = {SAND2006-2649} 18148} 18149 18150@Article{ brannick06, 18151 title = {An energy-based AMG coarsening strategy}, 18152 volume = {13}, 18153 doi = {10.1002/nla.480}, 18154 number = {2-3}, 18155 journal = {Numerical Linear Algebra with Applications}, 18156 author = {Brannick, J and Brezina, M and MacLachlan, S and Manteuffel, T and McCormick, S 18157 and Ruge, J}, 18158 year = {2006}, 18159 pages = {133--148} 18160} 18161 18162@Article{ olson10, 18163 author = {Olson, Luke N. and Schroder, Jacob and Tuminaro, Raymond S.}, 18164 title = {A new perspective on strength measures in algebraic multigrid}, 18165 journal = {Numerical Linear Algebra with Applications}, 18166 volume = {17}, 18167 number = {4}, 18168 pages = {713--733}, 18169 year = {2010}, 18170 publisher = {John Wiley \& Sons, Ltd.}, 18171 issn = {1099-1506}, 18172 doi = {10.1002/nla.669} 18173} 18174 18175@Article{ olson11, 18176 author = {Olson, Luke N. and Schroder, Jacob B. and Tuminaro, Raymond S.}, 18177 title = {A General Interpolation Strategy for Algebraic Multigrid Using Energy 18178 Minimization}, 18179 journal = {SIAM J. Sci. Comput.}, 18180 issue_date = {April 2011}, 18181 volume = {33}, 18182 issue = {2}, 18183 month = apr, 18184 year = {2011}, 18185 issn = {1064-8275}, 18186 pages = {966--991}, 18187 numpages = {26}, 18188 doi = {10.1137/100803031}, 18189 acmid = {2078825}, 18190 publisher = {Society for Industrial and Applied Mathematics}, 18191 address = {Philadelphia, PA}, 18192 keywords = {algebraic multigrid, interpolation, non-Hermitian, nonsymmetric, smoothed 18193 aggregation} 18194} 18195 18196@Article{ dorit2011, 18197 author = {Dorit Ron and Ilya Safro and Achi Brandt}, 18198 title = {Relaxation-Based Coarsening and Multiscale Graph Organization}, 18199 journal = {Multiscale Modeling {\&} Simulation}, 18200 volume = {9}, 18201 number = {1}, 18202 year = {2011}, 18203 pages = {407-423}, 18204 doi = {10.1137/100791142} 18205} 18206 18207@Article{ chen2011algebraic, 18208 title = {Algebraic distance on graphs}, 18209 author = {Chen, Jie and Safro, Ilya}, 18210 journal = {SIAM Journal on Scientific Computing}, 18211 volume = {33}, 18212 number = {6}, 18213 pages = {3468--3490}, 18214 year = {2011}, 18215 publisher = {SIAM} 18216} 18217 18218@InProceedings{ adams04, 18219 author = {Adams, M.~F. and Bayraktar, H.~H. and Keaveny, T.~M. and Papadopoulos, P.}, 18220 booktitle = {ACM/IEEE Proceedings of SC2004: High Performance Networking and Computing}, 18221 title = {Ultrascalable implicit finite element analyses in solid mechanics with over a 18222 half a billion degrees of freedom}, 18223 note = {Gordon Bell Award}, 18224 year = {2004} 18225} 18226 18227@Article{ adams03a, 18228 author = {Adams, M.~F.}, 18229 journal = {Numerical Linear Algebra with Applications}, 18230 number = {2-3}, 18231 pages = {141-153}, 18232 title = {Algebraic multigrid methods for constrained linear systems with applications to 18233 contact problems in solid mechanics}, 18234 volume = {11}, 18235 year = {2004} 18236} 18237 18238@Article{ adams-10a, 18239 author = {M. ~F. Adams and Ravi Samtaney and Achi Brandt}, 18240 doi = {10.1016/j.jcp.2010.04.024}, 18241 issn = {0021-9991}, 18242 journal = {Journal of Computational Physics}, 18243 keywords = {Implicit magnetohydrodynamics}, 18244 number = {18}, 18245 pages = {6208 - 6219}, 18246 title = {Toward textbook multigrid efficiency for fully implicit resistive 18247 magnetohydrodynamics}, 18248 volume = {229}, 18249 year = {2010} 18250} 18251 18252@InProceedings{ adams98, 18253 address = {Copper Mountain, CO}, 18254 author = {Adams, M.~F.}, 18255 booktitle = {Proceedings 5th Copper Mountain Conference on Iterative Methods}, 18256 title = {A Parallel Maximal Independent Set Algorithm}, 18257 year = {1998} 18258} 18259 18260@InProceedings{ madaypatera89, 18261 author = {Y. Maday and A. T. Patera}, 18262 title = {Spectral element methods for the {Navier-Stokes} equations}, 18263 editor = {A. K. Noor and J. T. Oden}, 18264 booktitle = {State-of-the-Art Surveys in Computational Mechanics}, 18265 pages = {71-–143}, 18266 publisher = {ASME}, 18267 address = {New York, NY}, 18268 year = {1989} 18269} 18270 18271@Article{ mishra2012mlmcfvm, 18272 title = {Multi-level {M}onte {C}arlo finite volume methods for nonlinear systems of 18273 conservation laws in multi-dimensions}, 18274 journal = {Journal of Computational Physics}, 18275 volume = {231}, 18276 number = {8}, 18277 pages = {3365--3388}, 18278 year = {2012}, 18279 issn = {0021-9991}, 18280 doi = {10.1016/j.jcp.2012.01.011}, 18281 author = {S. Mishra and Ch. Schwab and J. {\v S}ukys}, 18282 keywords = {Conservation laws, Euler, MHD, Uncertainty quantification, Multi-level Monte 18283 Carlo, Parallelization} 18284} 18285 18286@Article{ barth2011mlmcfe, 18287 author = {Barth, Andrea and Schwab, Christoph and Zollinger, Nathaniel}, 18288 affiliation = {ETH Zentrum, Seminar für Angewandte Mathematik, Rämistrasse 101, 8092 Zurich, 18289 Switzerland}, 18290 title = {Multi-Level {M}onte {C}arlo Finite Element method for elliptic {PDE}s with 18291 stochastic coefficients}, 18292 journal = {Numerische Mathematik}, 18293 publisher = {Springer Berlin / Heidelberg}, 18294 issn = {0029-599X}, 18295 keyword = {Mathematics and Statistics}, 18296 pages = {123-161}, 18297 volume = {119}, 18298 issue = {1}, 18299 doi = {10.1007/s00211-011-0377-0}, 18300 year = {2011} 18301} 18302 18303@Article{ nguyen2011hybridizable, 18304 title = {Hybridizable discontinuous {G}alerkin methods}, 18305 author = {Nguyen, N.C. and Peraire, J. and Cockburn, B.}, 18306 journal = {Spectral and High Order Methods for Partial Differential Equations}, 18307 pages = {63--84}, 18308 year = {2011}, 18309 publisher = {Springer} 18310} 18311 18312@Misc{ snyder-scidac3:proposal, 18313 author = {Philip {Snyder (PI)}}, 18314 title = {{Plasma Edge Advanced Computation (PEAC) Center}}, 18315 note = {proposal to DOE SciDAC3}, 18316 month = oct, 18317 year = {2011} 18318} 18319 18320@Misc{ wirth-scidac3:proposal, 18321 author = {Brian {Wirth (PI)}}, 18322 title = {{Plasma Surface Interactions: Bridging from the Surface to the Micron Frontier 18323 through Leadership Class Computing}}, 18324 note = {proposal to DOE SciDAC3}, 18325 month = oct, 18326 year = {2011} 18327} 18328 18329@Misc{ cary-scidac3:proposal, 18330 author = {John {Cary (PI)}}, 18331 title = {{Integrated Multiscale Modeling for Plasma Analysis and Control of Tokamak 18332 Stability (IMMPACTS)}}, 18333 note = {proposal to DOE SciDAC3}, 18334 month = oct, 18335 year = {2011} 18336} 18337 18338@Misc{ vashista-scidac3:proposal, 18339 author = {Priya {Vashista (PI)}}, 18340 title = {{Design of Damage-Tolerance Material Interfaces for Extreme 18341 Stress-Temperature-Corrosion Environments: Algorithms and Methods for 18342 Multi-Petaflops Simulations}}, 18343 note = {proposal to DOE SciDAC3}, 18344 month = mar, 18345 year = {2012} 18346} 18347 18348@Article{ elemental2012, 18349 author = {Jack Poulson and Bryan Marker and Jeff R. Hammond and Nichols A. Romero and 18350 Robert {v}an~{d}e~{G}eijn}, 18351 title = {Elemental: A New Framework for Distributed Memory Dense Matrix Computations}, 18352 journal = {{ACM} Transactions on Mathematical Software}, 18353 volume = {39}, 18354 number = {2}, 18355 year = {2013} 18356} 18357 18358@Misc{ elemental-web-page, 18359 author = {Jack Poulson}, 18360 title = {Elemental: Distributed memory dense linear algebra}, 18361 howpublished = {\url{http://libelemental.org}}, 18362 url = {http://libelemental.org/}, 18363 year = {2015} 18364} 18365 18366@Book{ scalesreport, 18367 title = {A Science-based Case for Large-scale Simulation}, 18368 editor = {D. E. Keyes}, 18369 publisher = {U.S. Department of Energy}, 18370 year = {2004}, 18371 url = {http://www.pnl.gov/scales} 18372} 18373 18374@InProceedings{ cilk95, 18375 address = {Santa Barbara, California}, 18376 author = {Robert D. Blumofe and Christopher F. Joerg and Bradley C. Kuszmaul and Charles E. 18377 Leiserson and Keith H. Randall and Yuli Zhou}, 18378 booktitle = {Proceedings of the Fifth ACM SIGPLAN Symposium on Principles and Practice of 18379 Parallel Programming (PPoPP)}, 18380 day = {19--21}, 18381 month = jul, 18382 pages = {207--216}, 18383 title = {{Cilk}: An Efficient Multithreaded Runtime System}, 18384 year = {1995} 18385} 18386 18387@Misc{ valgrind-web-page, 18388 author = {Julian Seward}, 18389 title = {Valgrind}, 18390 url = {http://valgrind.org/}, 18391 howpublished = {\url{http://valgrind.org/}}, 18392 year = {2012} 18393} 18394 18395@Article{ blas79, 18396 author = {C.~L. Lawson and R.~J. Hanson and D. Kincaid and F.~T. Krogh}, 18397 title = {Basic linear algebra subprograms for Fortran usage}, 18398 journal = {ACM Transactions on Mathematical Software}, 18399 volume = {5}, 18400 pages = {308--323}, 18401 year = {1979} 18402} 18403 18404@TechReport{ lapack90, 18405 author = {E. Anderson and Z. Bai and C. Bischof and J. Demmel and J. Dongarra and J. 18406 Du~Croz and A. Greenbaum and S. Hammarling and A. McKenney and D. Sorensen}, 18407 title = {{LAPACK}: A portable linear algebra library for high-performance computers}, 18408 institution = {Computer Science Dept., University of Tennessee}, 18409 number = {CS-90-105}, 18410 month = may, 18411 year = {1990} 18412} 18413 18414@TechReport{ nvidiafermi, 18415 author = {NVIDIA}, 18416 title = {{NVIDIA}'s Next Generation {CUDA} Compute Architecture: {F}ermi}, 18417 institution = {NVIDIA}, 18418 year = {2009} 18419} 18420 18421@Misc{ intelmic, 18422 author = {Many Core Group, Cambridge University}, 18423 title = {Intel Many Integrated Core Architecture}, 18424 howpublished = {\url{http://www.many-core.group.cam.ac.uk/ukgpucc2/talks/Elgar.pdf}}, 18425 month = dec, 18426 year = {2010} 18427} 18428 18429@Article{ abusufahkucklawrie81, 18430 author = {W. Abu-Sufah and D.~J. Kuck and D.~H. Lawrie}, 18431 title = {On the Performance Enhancement of Paging Systems Through Program Analysis and 18432 Transformations}, 18433 journal = {IEEE Trans. Comput.}, 18434 volume = {30}, 18435 number = {5}, 18436 pages = {341--356}, 18437 year = {1981} 18438} 18439 18440@InProceedings{ guobikshandifraguelagarzaranpadua08, 18441 author = {Guo, Jia and Bikshandi, Ganesh and Fraguela, Basilio B. and Garzaran, Maria J. 18442 and Padua, David}, 18443 title = {Programming with tiles}, 18444 booktitle = {Proceedings of the 13th ACM SIGPLAN Symposium on Principles and practice of 18445 parallel programming}, 18446 series = {PPoPP '08}, 18447 year = {2008}, 18448 isbn = {978-1-59593-795-7}, 18449 location = {Salt Lake City, UT}, 18450 pages = {111--122}, 18451 numpages = {12}, 18452 doi = {10.1145/1345206.1345225}, 18453 acmid = {1345225}, 18454 publisher = {ACM}, 18455 address = {New York, NY} 18456} 18457 18458@Article{ strout04, 18459 journal = {International Journal of High Performance Computing Applications}, 18460 year = {2004}, 18461 title = {Sparse Tiling for Stationary Iterative Methods}, 18462 month = feb, 18463 publisher = {Sage Publications}, 18464 pages = {95-114}, 18465 volume = {18}, 18466 number = {1}, 18467 author = {Michelle Mills Strout and Larry Carter and Jeanne Ferrante and Barbara Kreaseck} 18468} 18469 18470@Misc{ openclstandard, 18471 author = {Khronos Group}, 18472 title = {{OpenCL} 1.2 Specification}, 18473 howpublished = {\url{http://www.khronos.org/registry/cl/specs/opencl-1.2.pdf}}, 18474 url = {http://www.khronos.org/registry/cl/specs/opencl-1.2.pdf}, 18475 year = {2011} 18476} 18477 18478@Misc{ stlguide, 18479 author = {SGI}, 18480 title = {Standard Template Library Programmer's Guide}, 18481 howpublished = {\url{http://www.sgi.com/tech/stl/}}, 18482 url = {http://www.sgi.com/tech/stl/}, 18483 year = {2011} 18484} 18485 18486@Book{ stepanov09, 18487 author = {Alexander Stepanov and Paul McJones}, 18488 title = {Elements of Programming}, 18489 publisher = {Addison-Wesley}, 18490 isbn = {978-0-321-63537-2}, 18491 year = {2009} 18492} 18493 18494@Article{ bangerthhartmannkanschat2007, 18495 author = {W. Bangerth and R. Hartmann and G. Kanschat}, 18496 title = {{deal.II} -- a General Purpose Object Oriented Finite Element Library}, 18497 journal = {ACM Trans. Math. Softw.}, 18498 year = {2007}, 18499 volume = {33}, 18500 number = {4}, 18501 pages = {24/1--24/27} 18502} 18503 18504@Misc{ dealii-web-page, 18505 author = {W. Bangerth and R. Hartmann and G. Kanschat}, 18506 title = {{deal.II}}, 18507 howpublished = {\url{http://www.dealii.org/}}, 18508 url = {http://www.dealii.org/}, 18509 year = {2012} 18510} 18511 18512@InBook{ siek2012, 18513 title = {The C++0x ``Concepts'' Effort}, 18514 author = {Jeremy G. Siek}, 18515 editor = {Jeremy Gibbons}, 18516 booktitle = {Generic and Indexed Programming: International Spring School, SSGIP 2010, Oxford, 18517 UK, March 22-26, 2010, Revised Lectures}, 18518 pages = {175--216}, 18519 isbn = {978-3-642-32202-0}, 18520 doi = {10.1007/978-3-642-32202-0_4}, 18521 url = {http://arxiv.org/abs/1201.0027}, 18522 note = {\url{http://arxiv.org/abs/1201.0027}}, 18523 publisher = {Springer Berlin Heidelberg}, 18524 year = {2012} 18525} 18526 18527@Misc{ sharpclaw, 18528 note = {\url{http://numerics.kaust.edu.sa/sharpclaw}}, 18529 author = {Ketcheson, D. I. and Parsani, M.}, 18530 keywords = {clawpack,finite volumes,godunov type methods,high order methods,hyperbolic 18531 PDEs,sharpclaw,software}, 18532 mendeley-tags = {clawpack,finite volumes,godunov type methods,high order methods,hyperbolic 18533 PDEs,sharpclaw,software}, 18534 title = {{SharpClaw software}}, 18535 year = {2011} 18536} 18537 18538@Book{ leveque2002, 18539 title = {Finite volume methods for hyperbolic problems}, 18540 author = {Randall J LeVeque}, 18541 volume = {31}, 18542 year = {2002} 18543} 18544 18545@Misc{ clawpack45, 18546 note = {\url{http://www.clawpack.org}}, 18547 author = {LeVeque, R. J. and Berger, M. J.}, 18548 keywords = {clawpack,finite volumes,hyperbolic PDEs,software}, 18549 mendeley-tags = {clawpack,finite volumes,hyperbolic PDEs,software}, 18550 title = {{Clawpack Software version 4.5}}, 18551 url = {www.clawpack.org}, 18552 year = {2011} 18553} 18554 18555@Article{ nilsen2010, 18556 archiveprefix = {arXiv}, 18557 arxivid = {arXiv:1002.0705v1}, 18558 author = {Nilsen, J.K. and Cai, X. and H{\o}yland, Bj{\o} rn and Langtangen, H. P.}, 18559 eprint = {arXiv:1002.0705v1}, 18560 file = {:Users/ketch/Documents/Mendeley Desktop/Nilsen et al/2010 - Simplifying the 18561 parallelization of scientific codes by a function-centric approach in 18562 Python.pdf:pdf}, 18563 journal = {Computational Science \& Discovery}, 18564 keywords = {parallel,programming,python,software}, 18565 mendeley-tags = {parallel,programming,python,software}, 18566 pages = {015003}, 18567 publisher = {IOP Publishing}, 18568 title = {{Simplifying the parallelization of scientific codes by a function-centric 18569 approach in Python}}, 18570 url = {http://iopscience.iop.org/1749-4699/3/1/015003}, 18571 volume = {3}, 18572 year = {2010} 18573} 18574 18575@Book{ langtangen09, 18576 author = {Hans Petter Langtangen}, 18577 title = {Python Scripting for Computational Science}, 18578 publisher = {Springer}, 18579 series = {Texts in Computational Science and Engineering}, 18580 pages = {784}, 18581 isbn = {3540739157}, 18582 year = {2009} 18583} 18584 18585@Book{ numpyguide, 18586 author = {Travis E. Oliphant}, 18587 title = {Guide to {N}umpy}, 18588 publisher = {Trelgol}, 18589 year = {2008} 18590} 18591 18592@Misc{ pycuda, 18593 author = {Andreas Kl\"ockner}, 18594 title = {{PyCUDA}}, 18595 howpublished = {\url{http://mathema.tician.de/software/pycuda}}, 18596 year = {2011} 18597} 18598 18599@Misc{ pyopencl, 18600 author = {Andreas Kl\"ockner}, 18601 title = {{PyOpenCL}}, 18602 howpublished = {\url{http://mathema.tician.de/software/pyopencl}}, 18603 year = {2011} 18604} 18605 18606@Article{ klockner2012, 18607 author = {Andreas Kl\"{o}ckner and Nicolas Pinto and Yunsup Lee and Bryan Catanzaro and 18608 Paul Ivanov and Ahmed Fasih}, 18609 title = {{PyCUDA} and {PyOpenCL}: A scripting-based approach to {GPU} run-time code 18610 generation}, 18611 journal = {Parallel Computing}, 18612 volume = {38}, 18613 number = {3}, 18614 pages = {157--174}, 18615 year = {2012}, 18616 issn = {0167-8191}, 18617 doi = {10.1016/j.parco.2011.09.001} 18618} 18619 18620%%%%%% Matt Stuff %%%%%% 18621@Article{ morrabozdagknepleyrassvesselinov, 18622 title = {A Tectonic Shift in Analytics and Computing Is Coming}, 18623 author = {Gabriele Morra and Ebru Bozdag and Matthew G. Knepley and Ludovic R\"ass and 18624 Velimir Vesselinov}, 18625 journal = {Eos}, 18626 volume = {102}, 18627 doi = {10.1029/2021EO159258}, 18628 month = {Jun}, 18629 year = {2021} 18630} 18631 18632@Misc{ knepley:icerm-workshop:2012, 18633 author = {David Keyes and Matthew Knepley and Katherine Yelick}, 18634 title = {Synchronization-reducing and Communication-reducing Algorithms and Programming 18635 Models for Large-scale Simulations}, 18636 note = {Workshop sponsored by the Institute for Computational and Experimental Research 18637 in Mathematics (ICERM), Jan. 9-13, 2012, Providence, RI, 18638 \url{http://icerm.brown.edu/tw12-1-exascale}}, 18639 year = {2012} 18640} 18641 18642@TechReport{ kirbyknepleyscott04, 18643 author = {Robert C. Kirby and Matthew G. Knepley and L. Ridgway Scott}, 18644 title = {Optimal Evaluation of Finite Element Matrices}, 18645 type = {Technical Report}, 18646 number = {TR-2004-04}, 18647 institution = {University of Chicago}, 18648 url = {http://www.cs.uchicago.edu/research/publications/techreports/TR-2004-04}, 18649 note = {\url{http://www.cs.uchicago.edu/research/publications/techreports/TR-2004-04}}, 18650 pages = {14}, 18651 month = may, 18652 year = {2004} 18653} 18654 18655@TechReport{ kirbyknepleyscott10, 18656 author = {Robert C. Kirby and Matthew G. Knepley and L. Ridgway Scott}, 18657 title = {Languages and Compilers for Variational Forms}, 18658 type = {Technical Report}, 18659 number = {TR-2010-09}, 18660 institution = {University of Chicago}, 18661 url = {http://www.cs.uchicago.edu/research/publications/techreports/TR-2010-09}, 18662 note = {\url{http://www.cs.uchicago.edu/research/publications/techreports/TR-2010-09}}, 18663 month = oct, 18664 year = {2010} 18665} 18666 18667@TechReport{ kirbyknepleyscott10b, 18668 author = {Robert C. Kirby and Matthew G. Knepley and L. Ridgway Scott}, 18669 title = {Evaluation of the Action of Finite Element Operators}, 18670 type = {Technical Report}, 18671 number = {TR-2010-08}, 18672 institution = {University of Chicago}, 18673 url = {http://www.cs.uchicago.edu/research/publications/techreports/TR-2010-08}, 18674 note = {\url{http://www.cs.uchicago.edu/research/publications/techreports/TR-2010-08}}, 18675 month = oct, 18676 year = {2010} 18677} 18678 18679@TechReport{ bruneknepleyscott11, 18680 author = {Peter R. Brune and Matthew G. Knepley and L. Ridgway Scott}, 18681 title = {Exponential grids in high-dimensional space}, 18682 type = {Technical Report}, 18683 number = {TR-2011-07}, 18684 institution = {University of Chicago}, 18685 url = {http://www.cs.uchicago.edu/research/publications/techreports/TR-2011-07}, 18686 note = {\url{http://www.cs.uchicago.edu/research/publications/techreports/TR-2011-07}}, 18687 month = dec, 18688 year = {2011} 18689} 18690 18691@TechReport{ zheng11, 18692 author = {Liang Zheng and Taras Gerya and Matthew G. Knepley and David A. Yuen and Huai 18693 Zhang and Yaolin Shi}, 18694 title = {Implementation of a multigrid solver on {GPU} for {Stokes} equations with 18695 strongly variable viscosity based on {Matlab} and {CUDA}}, 18696 type = {Research Report}, 18697 number = {UMSI 2011/33}, 18698 institution = {University of Minnesota Supercomputing Institute}, 18699 url = {http://static.msi.umn.edu/rreports/2011/33.pdf}, 18700 note = {\url{http://static.msi.umn.edu/rreports/2011/33.pdf}}, 18701 month = mar, 18702 year = {2011} 18703} 18704 18705@InProceedings{ zheng2010, 18706 author = {Liang Zheng and Taras Gerya and David A. Yuen and Matthew G. Knepley and Huai 18707 Zhang and Yaolin Shi}, 18708 title = {{GPU} Implementation of {Stokes} Equation with Strongly Variable Coefficients}, 18709 booktitle = {Eos Transactions of the AGU}, 18710 organization = {American Geophysical Union}, 18711 note = {Fall Meeting Supplemental, Abstract IN41A-1350}, 18712 year = {2010} 18713} 18714 18715@InCollection{ terrelkirbyknepleyscott12, 18716 author = {Andy R. Terrel and Robert C. Kirby and Matthew G. Knepley and L. Ridgway Scott 18717 and Garth N. Wells}, 18718 title = {Finite elements for incompressible fluids}, 18719 editors = {A. Logg and K.A. Mardal and G. N. Wells}, 18720 booktitle = {Automated solutions of differential equations by the finite element method}, 18721 series = {Lecture Notes in Computational Science and Engineering}, 18722 volume = {84}, 18723 pages = {163--169}, 18724 publisher = {Springer-Verlag}, 18725 year = {2012} 18726} 18727 18728@InCollection{ mardalhaga12, 18729 author = {Kent-Andre Mardal and Joachim Berdal Haga}, 18730 title = {Block preconditioning of systems of PDEs}, 18731 editors = {A. Logg and K.A. Mardal and G. N. Wells}, 18732 booktitle = {Automated solutions of differential equations by the finite element method}, 18733 series = {Lecture Notes in Computational Science and Engineering}, 18734 volume = {84}, 18735 pages = {643--655}, 18736 publisher = {Springer-Verlag}, 18737 year = {2012} 18738} 18739 18740@InCollection{ kirbyknepleyloggscottterrel12, 18741 author = {Robert C. Kirby and Matthew G. Knepley and Anders Logg and L. Ridgway Scott and 18742 Andy R. Terrel}, 18743 title = {Discrete optimization of finite element matrix evaluation}, 18744 editors = {A. Logg and K.A. Mardal and G. N. Wells}, 18745 booktitle = {Automated solutions of differential equations by the finite element method}, 18746 series = {Lecture Notes in Computational Science and Engineering}, 18747 volume = {84}, 18748 pages = {385--397}, 18749 publisher = {Springer-Verlag}, 18750 year = {2012} 18751} 18752 18753@InCollection{ kirby12, 18754 author = {Robert C. Kirby}, 18755 title = {{FIAT}: Numerical Construction of Finite Element Basis Functions}, 18756 editors = {A. Logg and K.A. Mardal and G. N. Wells}, 18757 booktitle = {Automated solutions of differential equations by the finite element method}, 18758 series = {Lecture Notes in Computational Science and Engineering}, 18759 volume = {84}, 18760 publisher = {Springer-Verlag}, 18761 year = {2012} 18762} 18763 18764@Article{ brownconveryhotesknepleypetropolous1993, 18765 author = {Robert W. Brown and Mary Convery and Scott Hotes and Matthew G. Knepley and 18766 Labros Petropolous}, 18767 title = {Closed strings with low harmonics and kinks}, 18768 journal = {Physical Review D}, 18769 volume = {48}, 18770 number = {6}, 18771 year = {1993} 18772} 18773 18774@Article{ minimax1996, 18775 title = {MiniMax: What has been learned thus far}, 18776 author = {Mary E. Convery and W.~L. Davis and Ken W. Del Signore and Tom L. Jenkins and 18777 Erik Kangas and Matthew G. Knepley and Ken L. Kowalski and Cyrus C. Taylor and 18778 C.~H. Wang and S.~H. Oh and W.~D. Walker and P.~L. Colestock and B. Hanna and M. 18779 Martens and J. Streets and R.~C. Ball and H.~R. Gustafson and L.~W. Jones and 18780 M.~J. Longo and J.~D. Bjorken and N. Morgan and C.~A. Pruneau}, 18781 journal = {Nuovo Cimento}, 18782 volume = {19}, 18783 number = {1}, 18784 pages = {1045--1049}, 18785 year = {1996} 18786} 18787 18788@Article{ minimax1997, 18789 author = {Minimax Collaboration}, 18790 title = {Analysis of Charged Particle/Photon Correlations in Hadronic Multiparticle 18791 Production}, 18792 journal = {Physical Review D}, 18793 volume = {55}, 18794 number = {9}, 18795 year = {1997} 18796} 18797 18798@Article{ minimax2000, 18799 author = {Minimax Collaboration}, 18800 title = {Search for disoriented chiral condensate at the {Fermilab} {Tevatron}}, 18801 journal = {Physical Review D}, 18802 volume = {61}, 18803 number = {3}, 18804 year = {2000} 18805} 18806 18807@Article{ kirbyknepleyloggscott05, 18808 author = {Robert C. Kirby and Matthew G. Knepley and Anders Logg and L. Ridgway Scott}, 18809 title = {Optimizing the evaluation of finite element matrices}, 18810 journal = {SIAM Journal on Scientific Computing}, 18811 volume = {27}, 18812 number = {3}, 18813 pages = {741--758}, 18814 year = {2005} 18815} 18816 18817@Article{ bardhanknepleyanitescu2008, 18818 author = {Jaydeep P. Bardhan and Matthew G. Knepley and Mihai Anitescu}, 18819 title = {Bounding the Electrostatic Free Energies Associated with Linear Continuum Models 18820 of Molecular Solvation}, 18821 journal = {Journal of Chemical Physics}, 18822 volume = {130}, 18823 number = {10}, 18824 pages = {104108}, 18825 note = {Selected for the March 15, 2009 issue of Virtual Journal of Biological Physics 18826 Research}, 18827 doi = {10.1063/1.3081148}, 18828 year = {2008} 18829} 18830 18831%Poster at Biophysical Society Fall Meeting 18832@Article{ bardhanknepley2017, 18833 author = {Jaydeep P. Bardhan and Matthew G. Knepley}, 18834 title = {Accurate Atom-by-Atom Predictions of Solvation Electrostatics Using a 18835 Hydration-Shell {Poisson}-{Boltzmann} Model}, 18836 journal = {Biophysical Journal}, 18837 volume = {110}, 18838 number = {3}, 18839 note = {Fall Meeting Supplemental, Abstract DI14A-08}, 18840 doi = {10.1016/j.bpj.2015.11.1766}, 18841 year = {2017} 18842} 18843 18844@Article{ tabrizirahimigoossensknepleybardhan2018, 18845 title = {Solvation Thermodynamics of Neutral and Charged Solutes Using the Solvation-Layer 18846 Interface Condition (SLIC) Continuum Dielectric Model}, 18847 author = {Amirhossein Molavi Tabrizi and Ali Mehdizadeh Rahimi and Spencer Goossens and 18848 Matthew G. Knepley and Jaydeep P. Bardhan}, 18849 journal = {International Journal of Quantum Chemistry}, 18850 note = {Accepted}, 18851 year = {2018} 18852} 18853 18854@Article{ knepley2010, 18855 author = {Stodden, V. and Knepley, M. G. and Wiggins, C. and LeVeque, R. J. and Donoho, D. 18856 and Fomel, S. and Friedlander, M. P. and Gerstein, M. and Mitchell, I. and 18857 Ouellette, L. L. and Bramble, N. W. and Brown, P. O. and Carey, V. and DeNardis, 18858 L. and Gentleman, R. and {Gezelter, J}, D. and Goodman, A. and Moore, J. E. and 18859 Pasquale, F. A. and Rolnick, J. and Seringhaus, M. and Subramanian, R.}, 18860 title = {{Reproducible Research: addressing the need for data and code sharing in 18861 computational science}}, 18862 journal = {Computing in Science and Engineering}, 18863 volume = {12}, 18864 number = {5}, 18865 pages = {8--13}, 18866 url = {http://www.bepress.com/cgi/viewcontent.cgi?article=1034\&amp;context=sagmb}, 18867 year = {2010} 18868} 18869 18870@Article{ ketchesonahmadiaknepley2011, 18871 title = {Conference Review: High Performance Computing and Hybrid Programming Concepts for 18872 Hyperbolic PDE Codes}, 18873 author = {David I. Ketcheson and Aron Ahmadia and Matthew G. Knepley}, 18874 journal = {SIAM News}, 18875 volume = {44}, 18876 number = {7}, 18877 month = sep, 18878 note = {\url{http://www.siam.org/pdf/news/1912.pdf}}, 18879 year = {2011} 18880} 18881 18882@Article{ yokotabardhanknepleybarbahamada2011, 18883 author = {Rio Yokota and Jaydeep P. Bardhan and Matthew G. Knepley and L.A. Barba and 18884 Tsuyoshi Hamada}, 18885 title = {Biomolecular electrostatics using a fast multipole {BEM} on up to 512 {GPU}s and 18886 a billion unknowns}, 18887 journal = {Computer Physics Communications}, 18888 volume = {182}, 18889 number = {6}, 18890 pages = {1272--1283}, 18891 year = {2011}, 18892 issn = {0010-4655}, 18893 doi = {10.1016/j.cpc.2011.02.013}, 18894 url = {http://arxiv.org/abs/1007.4591} 18895} 18896 18897@Article{ bardhanknepley2011, 18898 author = {Jaydeep P. Bardhan and Matthew G. Knepley}, 18899 title = {Mathematical Analysis of the {BIBEE} Approximation for Molecular Solvation: Exact 18900 Results for Spherical Inclusions}, 18901 journal = {Journal of Chemical Physics}, 18902 volume = {135}, 18903 number = {12}, 18904 pages = {124107--124117}, 18905 url = {http://arxiv.org/abs/1109.0651}, 18906 note = {\url{http://arxiv.org/abs/1109.0651}}, 18907 year = {2011} 18908} 18909 18910@Article{ bruneknepleyscott2013, 18911 author = {Peter R. Brune and Matthew G. Knepley and L. Ridgway Scott}, 18912 title = {Unstructured Geometric Multigrid in Two and Three Dimensions on Complex and 18913 Graded Meshes}, 18914 journal = {SIAM Journal on Scientific Computing}, 18915 url = {http://arxiv.org/abs/1104.0261}, 18916 note = {\url{http://arxiv.org/abs/1104.0261}}, 18917 volume = {35}, 18918 number = {1}, 18919 pages = {A173--A191}, 18920 year = {2013} 18921} 18922 18923@Article{ bardhanknepley2012a, 18924 author = {Jaydeep P. Bardhan and Matthew G. Knepley}, 18925 title = {Computational science and re-discovery: open-source implementations of 18926 ellipsoidal harmonics for problems in potential theory}, 18927 journal = {Computational Science \& Discovery}, 18928 volume = {5}, 18929 pages = {014006}, 18930 note = {\url{http://arxiv.org/abs/1204.0267}}, 18931 doi = {10.1088/1749-4699/5/1/014006}, 18932 year = {2012} 18933} 18934 18935@Article{ kreienkampetal2013, 18936 author = {Amy Kreienkamp and Lucy Y. Liu and Mona S. Minkara and Matthew G. Knepley and 18937 Jaydeep P. Bardhan and Mala L. Radhakrishnan}, 18938 title = {Analysis of fast boundary-integral approximations for modeling electrostatic 18939 contributions of molecular binding}, 18940 journal = {Molecular Based Mathematical Biology}, 18941 volume = {1}, 18942 pages = {124--150}, 18943 doi = {10.2478/mlbmb-2013-0007}, 18944 issn = {2299-3266}, 18945 month = jun, 18946 note = {\url{http://www.degruyter.com/view/j/mlbmb.2012.1.issue/mlbmb-2013-0007/mlbmb-2013-0007.xml}}, 18947 year = {2013} 18948} 18949 18950@Article{ bardhanknepleybrune2015, 18951 author = {Jaydeep P. Bardhan and Matthew G. Knepley and Peter R. Brune}, 18952 title = {Analytical Nonlocal Electrostatics Using Eigenfunction Expansions of 18953 Boundary-Integral Operators}, 18954 journal = {Molecular Based Mathematical Biology}, 18955 volume = {3}, 18956 number = {1}, 18957 pages = {1--22}, 18958 doi = {10.1515/mlbmb-2015-0001}, 18959 year = {2015} 18960} 18961 18962@Article{ bardhanknepley14, 18963 author = {Jaydeep P. Bardhan and Matthew G. Knepley}, 18964 title = {Modeling Charge-Sign Asymmetric Solvation Free Energies With Nonlinear Boundary 18965 Conditions}, 18966 journal = {Journal of Chemical Physics}, 18967 volume = {141}, 18968 number = {13}, 18969 pages = {131103}, 18970 doi = {10.1063/1.4897324}, 18971 year = {2014} 18972} 18973 18974@InProceedings{ bardhantejaniwieckowskiramaswamyknepley2015, 18975 title = {A Nonlinear Boundary Condition for Continuum Models of Biomolecular 18976 Electrostatics}, 18977 author = {Jaydeep P. Bardhan and D. A. Tejani and N. S. Wieckowski and A. Ramaswamy and 18978 Matthew G. Knepley}, 18979 booktitle = {Proceedings of PIERS}, 18980 pages = {1215--1221}, 18981 month = jul, 18982 url = {http://piers.org/piersproceedings/piers2015PragueProc.php?start=250}, 18983 year = {2015} 18984} 18985 18986@Article{ tabriziknepleybardhan2016, 18987 title = {Generalising the mean spherical approximation as a multiscale, nonlinear boundary 18988 condition at the solute-solvent interface}, 18989 author = {Amirhossein Molavi Tabrizi and Matthew G. Knepley and Jaydeep P. Bardhan}, 18990 journal = {Molecular Physics}, 18991 volume = {114}, 18992 number = {16-17}, 18993 pages = {2558--2567}, 18994 doi = {10.1080/00268976.2016.1198503}, 18995 year = {2016} 18996} 18997 18998% http://tex.stackexchange.com/questions/155532/biblatex-and-pubmed-pubmed-central-ids 18999@Article{ tabrizigoossensrahimiknepleybardhan2017, 19000 title = {Predicting Solvation Free Energies and Thermodynamics in Polar Solvents and 19001 Mixtures Using a Solvation-Layer Interface Condition}, 19002 author = {Amirhossein Molavi Tabrizi and Spencer Goossens and Ali Mehdizadeh Rahimi and 19003 Matthew G. Knepley and Jaydeep P. Bardhan}, 19004 journal = {Journal of Chemical Physics}, 19005 volume = {146}, 19006 number = {9}, 19007 pages = {094103}, 19008 url = {http://scitation.aip.org/content/aip/journal/jcp/146/9/10.1063/1.4977037}, 19009 eprint = {https://arxiv.org/abs/1611.02150}, 19010 doi = {10.1063/1.4977037}, 19011 note = {PMCID: PMC5336475}, 19012 year = {2017} 19013} 19014 19015@Article{ tabrizigoossenscooperknepleybardhan2017, 19016 title = {Extending the Solvation-Layer Interface Condition {(SLIC)} Continum Electrostatic 19017 Model to Linearized {Poisson}-{Boltzmann} Solvent}, 19018 author = {Amirhossein Molavi Tabrizi and Spencer Goossens and Christopher D. Cooper and 19019 Matthew G. Knepley and Jaydeep P. Bardhan}, 19020 number = {6}, 19021 pages = {2897--2914}, 19022 journal = {Journal of Chemical Theory and Computation}, 19023 year = {2017} 19024} 19025 19026@InProceedings{ mcclanahan2011, 19027 author = {McClanahan, C and Czechowski, Kent and Battaglino, Casey and Iyer, K and Yeung, P 19028 K and Vuduc, Richard}, 19029 booktitle = {Proc. ACM/IEEE Conf. Supercomputing (SC)}, 19030 title = {{Prospects for scalable 3D FFTs on heterogeneous exascale systems}}, 19031 url = {http://mcclanahoochie.com/blog/wp-content/uploads/2011/01/fft-sc11.pdf}, 19032 year = {2011} 19033} 19034 19035@Article{ ghyselsashbymeerbergenvanroose2013, 19036 author = {Ghysels, P. and Ashby, T.J. and Meerbergen, K. and Vanroose, W.}, 19037 title = {Hiding global communication latency in the {GMRES} algorithm on massively 19038 parallel machines}, 19039 journal = {SIAM Journal on Scientific Computing}, 19040 volume = {35}, 19041 number = {1}, 19042 pages = {C48--C71}, 19043 year = {2013} 19044} 19045 19046@Article{ ghyselsvanroose2014, 19047 author = {P. Ghysels and W. Vanroose}, 19048 title = {Hiding Global Synchronization Latency in the Preconditioned Conjugate Gradient 19049 Algorithm}, 19050 journal = {Parallel Computing}, 19051 volume = {40}, 19052 number = {7}, 19053 pages = {224--238}, 19054 note = {7th Workshop on Parallel Matrix Algorithms and Applications}, 19055 doi = {10.1016/j.parco.2013.06.001}, 19056 year = {2014} 19057} 19058 19059@InProceedings{ strzodkagoddeke06, 19060 author = {R. Strzodka and D. G\"oddeke}, 19061 title = {Pipelined Mixed Precision Algorithms on {FPGA}s for Fast and Accurate PDE Solvers 19062 from Low Precision Components}, 19063 booktitle = {Proceedings of the 14th Annual IEEE Symposium on Field-Programmable Custom 19064 Computing Machines}, 19065 note = {FCCM ’06}, 19066 pages = {259--270}, 19067 year = {2006}, 19068 organization = {IEEE Computer Society} 19069} 19070 19071@InCollection{ jacquesnicolasvollaire12, 19072 author = {T. Jacques and L. Nicolas and C. Vollaire}, 19073 title = {Electromagnetic Scattering with the Boundary Integral Method on {MIMD} Systems}, 19074 editors = {P. Sloot, M. Bubak, A. Hoekstra, and B. Hertzberger}, 19075 booktitle = {High-Performance Computing and Networking}, 19076 series = {Lecture Notes in Computer Science}, 19077 volume = {1593}, 19078 pages = {1025--1031}, 19079 publisher = {Springer}, 19080 year = {1999} 19081} 19082 19083@InProceedings{ hoeflerlumsdainerehm07, 19084 author = {T. Hoefler and A. Lumsdaine and W. Rehm}, 19085 title = {{Implementation and Performance Analysis of Non-Blocking Collective Operations 19086 for MPI}}, 19087 booktitle = {Proceedings of the 2007 International Conference on High Performance Computing, 19088 Networking, Storage and Analysis, SC07}, 19089 location = {Reno, NV}, 19090 publisher = {IEEE Computer Society/ACM}, 19091 source = {http://www.unixer.de/~htor/publications/}, 19092 month = nov, 19093 year = {2007} 19094} 19095 19096@InProceedings{ hoeflersiebretlumsdaine10, 19097 author = {T. Hoefler and C. Siebert and A. Lumsdaine}, 19098 title = {{Scalable Communication Protocols for Dynamic Sparse Data Exchange}}, 19099 booktitle = {Proceedings of the 2010 ACM SIGPLAN Symposium on Principles and Practice of 19100 Parallel Programming (PPoPP'10)}, 19101 month = jan, 19102 location = {Bangalore, India}, 19103 publisher = {ACM}, 19104 isbn = {978-1-60558-708-0}, 19105 source = {http://www.unixer.de/~htor/publications/}, 19106 pages = {159--168}, 19107 year = {2010} 19108} 19109 19110@Article{ ruppweinbubjungelgrasser15, 19111 title = {Pipelined iterative solvers with kernel fusion for graphics processing units}, 19112 author = {Rupp, Karl and Weinbub, Josef and J{\"u}ngel, Ansgar and Grasser, Tibor}, 19113 journal = {ACM Transactions on Mathematical Software (TOMS)}, 19114 volume = {43}, 19115 number = {2}, 19116 pages = {11}, 19117 year = {2016}, 19118 publisher = {ACM} 19119} 19120 19121@Article{ bai_hu_reichel_1994, 19122 title = {A {Newton} basis {GMRES} implementation}, 19123 volume = {14}, 19124 url = {}, 19125 number = {}, 19126 journal = {IMA Journal of Numerical Analysis}, 19127 author = {Z. Bai and D. Hu and L. Reichel}, 19128 year = {1994}, 19129 pages = {563--581} 19130} 19131 19132@Article{ chronopoulos_gear_1989, 19133 title = {{S-step} iterative methods for symmetric linear systems}, 19134 volume = {25}, 19135 url = {}, 19136 number = {}, 19137 journal = {Journal of Computational and Applied Mathematics}, 19138 author = {A. T. Chronopoulos and C. W. Gear}, 19139 year = {1989}, 19140 pages = {153--168} 19141} 19142 19143@Article{ chronopoulos_1996, 19144 title = {Parallel Iterative {S-step} Methods for Unsymmetric Linear Systems}, 19145 author = {A. T. Chronopoulos and C. D. Swanson}, 19146 journal = {Parallel Computing}, 19147 volume = {22}, 19148 number = {5}, 19149 year = {1996}, 19150 pages = {623--641} 19151} 19152 19153@Article{ chronopoulos_2010, 19154 author = {A. T. Chronopoulos and A. Kucherov}, 19155 title = {Block {S-step} {Krylov} Iterative Methods}, 19156 journal = {Numerical Linear Algebra with Applications}, 19157 volume = {17}, 19158 number = {1}, 19159 pages = {3--15}, 19160 year = {2010} 19161} 19162 19163@Article{ sturler_vorst_1995, 19164 title = {Reducing the effect of global communication in {GMRES(m)} and {CG} on parallel 19165 distributed memory computers}, 19166 volume = {18}, 19167 url = {}, 19168 number = {}, 19169 journal = {Applied Numerical Mathematics}, 19170 author = {E. De Sturler and H. A. van der Vorst}, 19171 year = {1995}, 19172 pages = {441--459} 19173} 19174 19175@Article{ joubert_carey_1992, 19176 title = {Parallelizable restarted iterative methods for nonsymmetric linear systems. part 19177 I: Theory}, 19178 volume = {44}, 19179 url = {}, 19180 number = {}, 19181 journal = {International journal of computer mathematics}, 19182 author = {W. D. Joubert and G. F. Carey}, 19183 year = {1992}, 19184 pages = {243--267} 19185} 19186 19187@Article{ elman_saadsaylor_1986, 19188 title = {A hybrid {Chebyshev} {Krylov}-subspace algorithm for solving nonsymmetric systems 19189 of linear equations}, 19190 volume = {7}, 19191 url = {}, 19192 number = {3}, 19193 journal = {SIAM Journal on Scientific and Statistical Computing}, 19194 author = {Howard Elman and Y. Saad and P. E. Saylor}, 19195 year = {1986}, 19196 pages = {840--855} 19197} 19198 19199@Article{ golub95innerand, 19200 author = {Eldar Giladi and Gene H. Golub and Joseph B. Keller}, 19201 title = {Inner and outer iterations for the {Chebyshev} algorithm}, 19202 journal = {SIAM J. Numer. Anal}, 19203 year = {1995}, 19204 volume = {35}, 19205 pages = {300--319} 19206} 19207 19208@Article{ golub_varga_1961, 19209 title = {{Chebyshev} semi-iterative methods, successive overrelaxation iterative methods, 19210 and second-order {Richardson} iterative methods, parts {I} and {II}}, 19211 volume = {3}, 19212 url = {}, 19213 number = {}, 19214 journal = {Numer. Math.}, 19215 author = {Gene Golub and R.S. Varga}, 19216 year = {1961}, 19217 pages = {147--168} 19218} 19219 19220@Article{ el_maliki_guenette_fortin_2011, 19221 title = {An efficient hierarchical preconditioner for quadratic discretizations of finite 19222 element problems}, 19223 volume = {18}, 19224 doi = {10.1002/nla.757}, 19225 number = {5}, 19226 journal = {Numerical Linear Algebra with Applications}, 19227 author = {A. {El maliki} and R. Guenette and M. Fortin}, 19228 year = {2011}, 19229 pages = {789-803} 19230} 19231 19232@Article{ adavani2008multigrid, 19233 title = {Multigrid Algorithms for Inverse Problems with Linear Parabolic {PDE} 19234 Constraints}, 19235 author = {Adavani, S.S. and Biros, G.}, 19236 journal = {SIAM Journal on Scientific Computing}, 19237 volume = {31}, 19238 number = {1}, 19239 pages = {369--397}, 19240 year = {2008}, 19241 publisher = {Society for Industrial and Applied Mathematics} 19242} 19243 19244@Article{ horton1995space, 19245 title = {A space-time multigrid method for parabolic {PDE}s}, 19246 author = {Horton, G. and Vandewalle, S.}, 19247 journal = {SIAM Journal on Scientific Computing}, 19248 volume = {16}, 19249 number = {4}, 19250 pages = {848--864}, 19251 year = {1995} 19252} 19253 19254@Article{ lewis2005model, 19255 title = {Model problems for the multigrid optimization of systems governed by differential 19256 equations}, 19257 author = {Lewis, R.M. and Nash, S.G.}, 19258 journal = {SIAM Journal on Scientific Computing}, 19259 volume = {26}, 19260 number = {6}, 19261 pages = {1811--1837}, 19262 year = {2005}, 19263 publisher = {Philadelphia, PA: SIAM, c1993-} 19264} 19265 19266@Article{ nash2000mgopt, 19267 title = {A multigrid approach to discretized optimization problems}, 19268 author = {Nash, S.G.}, 19269 journal = {Optimization Methods and Software}, 19270 volume = {14}, 19271 number = {1-2}, 19272 pages = {99--116}, 19273 year = {2000}, 19274 publisher = {Taylor \& Francis} 19275} 19276 19277@Article{ borzi2009multigrid, 19278 title = {Multigrid Methods for {PDE} Optimization}, 19279 author = {Borz{\`i}, A. and Schulz, V.}, 19280 journal = {SIAM Review}, 19281 volume = {51}, 19282 pages = {361}, 19283 year = {2009} 19284} 19285 19286@Article{ borzi2005multigrid, 19287 title = {A multigrid scheme for elliptic constrained optimal control problems}, 19288 author = {Borz{\`i}, A. and Kunisch, K.}, 19289 journal = {Computational Optimization and Applications}, 19290 volume = {31}, 19291 number = {3}, 19292 pages = {309--333}, 19293 year = {2005}, 19294 publisher = {Springer} 19295} 19296 19297@Article{ borzi2003multigrid, 19298 title = {Multigrid methods for parabolic distributed optimal control problems}, 19299 author = {Borz{\`i}, A.}, 19300 journal = {Journal of Computational and Applied Mathematics}, 19301 volume = {157}, 19302 number = {2}, 19303 pages = {365--382}, 19304 year = {2003}, 19305 publisher = {Elsevier} 19306} 19307 19308@Article{ ito2002receding, 19309 title = {Receding horizon optimal control for infinite dimensional systems}, 19310 author = {Ito, K. and Kunisch, K.}, 19311 journal = {ESAIM: Control, Optimisation and Calculus of Variations}, 19312 volume = {8}, 19313 number = {1}, 19314 pages = {741--760}, 19315 year = {2002}, 19316 publisher = {Cambridge University Press} 19317} 19318 19319@Article{ schulz1998solving, 19320 title = {Solving discretized optimization problems by partially reduced {SQP} methods}, 19321 author = {Schulz, V.H.}, 19322 journal = {Computing and Visualization in Science}, 19323 volume = {1}, 19324 number = {2}, 19325 pages = {83--96}, 19326 year = {1998}, 19327 publisher = {Springer} 19328} 19329 19330@Article{ hazra2005aerodynamic, 19331 title = {Aerodynamic shape optimization using simultaneous pseudo-timestepping}, 19332 author = {Hazra, S.B. and Schulz, V. and Brezillon, J. and Gauger, N.R.}, 19333 journal = {Journal of Computational Physics}, 19334 volume = {204}, 19335 number = {1}, 19336 pages = {46--64}, 19337 year = {2005}, 19338 publisher = {Elsevier} 19339} 19340 19341@Article{ mandel1985multilevel, 19342 title = {On multilevel iterative methods for integral equations of the second kind and 19343 related problems}, 19344 author = {Mandel, J.}, 19345 journal = {Numerische Mathematik}, 19346 volume = {46}, 19347 number = {1}, 19348 pages = {147--157}, 19349 year = {1985}, 19350 publisher = {Springer} 19351} 19352 19353@Article{ king1992multilevel, 19354 title = {Multilevel algorithms for ill-posed problems}, 19355 author = {King, J.T.}, 19356 journal = {Numerische Mathematik}, 19357 volume = {61}, 19358 number = {1}, 19359 pages = {311--334}, 19360 year = {1992}, 19361 publisher = {Springer} 19362} 19363 19364@Article{ kaltenbacher2001regularizing, 19365 title = {On the regularizing properties of a full multigrid method for ill-posed 19366 problems}, 19367 author = {Kaltenbacher, B.}, 19368 journal = {Inverse Problems}, 19369 volume = {17}, 19370 pages = {767}, 19371 year = {2001}, 19372 publisher = {IOP Publishing} 19373} 19374 19375@Article{ kaltenbacher2002multi, 19376 title = {A multi-grid method with a priori and a posteriori level choice for the 19377 regularization of nonlinear ill-posed problems}, 19378 author = {Kaltenbacher, B. and Schicho, J.}, 19379 journal = {Numerische Mathematik}, 19380 volume = {93}, 19381 number = {1}, 19382 pages = {77--107}, 19383 year = {2002}, 19384 publisher = {Springer} 19385} 19386 19387@Article{ burger2006regularizing, 19388 title = {Regularizing {N}ewton-{K}aczmarz Methods for Nonlinear Ill-Posed Problems}, 19389 author = {Burger, M. and Kaltenbacher, B.}, 19390 journal = {SIAM Journal on Numerical Analysis}, 19391 volume = {44}, 19392 pages = {153}, 19393 year = {2006} 19394} 19395 19396@Article{ draganescu2008optimal, 19397 title = {Optimal order multilevel preconditioners for regularized ill-posed problems}, 19398 author = {Andrei Dr{\u{a}}g{\u{a}}nescu and Todd F. Dupont}, 19399 journal = {Mathematics of Computation}, 19400 volume = {77}, 19401 number = {264}, 19402 pages = {2001--2038}, 19403 year = {2008} 19404} 19405 19406@Article{ bastian1998additive, 19407 title = {Additive and multiplicative multi-grid---a comparison}, 19408 author = {Bastian, P. and Wittum, G. and Hackbusch, W.}, 19409 journal = {Computing}, 19410 volume = {60}, 19411 number = {4}, 19412 pages = {345--364}, 19413 year = {1998}, 19414 publisher = {Springer} 19415} 19416 19417@Article{ fournier2001multiplicative, 19418 title = {Multiplicative and additive parallel multigrid algorithms for the acceleration of 19419 compressible flow computations on unstructured meshes}, 19420 author = {Fournier, L. and Lanteri, S.}, 19421 journal = {Applied Numerical Mathematics}, 19422 volume = {36}, 19423 number = {4}, 19424 pages = {401--426}, 19425 year = {2001}, 19426 publisher = {Elsevier} 19427} 19428 19429@Article{ chow2006survey, 19430 title = {A survey of parallelization techniques for multigrid solvers}, 19431 author = {Chow, E. and Falgout, R.D. and Hu, J.J. and Tuminaro, R.S. and Yang, U.M.}, 19432 journal = {Parallel Processing for Scientific Computing, MA Heroux, P. Raghavan, and HD 19433 Simon, eds}, 19434 volume = {20}, 19435 pages = {179--201}, 19436 year = {2006} 19437} 19438 19439@InBook{ brandt2001multiscale, 19440 title = {Multiscale scientific computation: {R}eview 2001}, 19441 author = {Brandt, A.}, 19442 booktitle = {Multiscale and Multiresolution Methods: Theory and Applications}, 19443 editors = {Barth, T.J. and Chan, T.F. and Haimes, R.}, 19444 series = {Lecture Notes in Computational Science and Engineering}, 19445 year = {2001}, 19446 volume = {20}, 19447 pages = {3--96}, 19448 publisher = {Springer Verlag} 19449} 19450 19451@InCollection{ brandt2003multigrid, 19452 title = {Multigrid solvers and multilevel optimization strategies}, 19453 author = {Brandt, A. and Ron, D.}, 19454 booktitle = {Multilevel Optimization and VLSICAD}, 19455 editors = {J. Cong and J.R. Shinnerl}, 19456 pages = {1--69}, 19457 publisher = {Kluwer Academic Publishers}, 19458 year = {2003} 19459} 19460 19461@InBook{ brandt2009principles, 19462 title = {Principles of systematic upscaling}, 19463 author = {Brandt, A.}, 19464 booktitle = {Bridging the Scales in Science and Engineering}, 19465 editors = {J. Fish}, 19466 publisher = {Oxford University Press}, 19467 pages = {193--215}, 19468 year = {2009} 19469} 19470 19471@Article{ livne2004coarsening, 19472 title = {Coarsening by compatible relaxation}, 19473 author = {Livne, O.E.}, 19474 journal = {Numerical Linear Algebra with Applications}, 19475 volume = {11}, 19476 number = {2-3}, 19477 pages = {205--227}, 19478 year = {2004}, 19479 publisher = {Wiley Online Library} 19480} 19481 19482@InProceedings{ brandt1986stochastic, 19483 title = {Multi-Level Approaches to Discrete-State and Stochastic Problems}, 19484 author = {Brandt, A. and Ron, D. and Amit, D.J.}, 19485 booktitle = {Multigrid methods II: proceedings of the 2nd European Conference on Multigrid 19486 Methods, held at Cologne, October 1-4, 1985}, 19487 volume = {1228}, 19488 pages = {65--98}, 19489 year = {1986}, 19490 organization = {Springer} 19491} 19492 19493@Article{ halko2011finding, 19494 author = {Nathan Halko and Per-Gunnar Martinsson and Joel A. Tropp}, 19495 title = {Finding Structure with Randomness: Probabilistic Algorithms for Constructing 19496 Approximate Matrix Decompositions}, 19497 journal = {SIAM Review}, 19498 volume = {53}, 19499 number = {2}, 19500 year = {2011}, 19501 pages = {217-288}, 19502 doi = {10.1137/090771806} 19503} 19504 19505@InProceedings{ mhdy09, 19506 author = {Mohiyuddin, M. and Hoemmen, M. and Demmel, J. and Yelick, K.}, 19507 booktitle = {Proceedings of SC09}, 19508 organization = {ACM}, 19509 title = {Minimizing communication in sparse matrix solvers}, 19510 doi = {10.1145/1654059.1654096}, 19511 year = {2009} 19512} 19513 19514@InProceedings{ vanrosendale83, 19515 title = {Minimizing inner product data dependencies in conjugate gradient iteration}, 19516 booktitle = {Proceedings of the IEEE International Conference on Parallel Processing}, 19517 author = {J. van Rosendale}, 19518 year = {1983}, 19519 publisher = {IEEE Computer Society} 19520} 19521 19522@PhDThesis{ vuduc95, 19523 title = {Quantitative performance modeling of scientific computations and creating 19524 locality in numerical algorithms}, 19525 author = {R. Vuduc}, 19526 journal = {Massachusetts Institute of Technology}, 19527 school = {Massachusetts Institute of Technology}, 19528 year = {1995} 19529} 19530 19531@Article{ simoncini2003flexible, 19532 title = {Flexible inner-outer {Krylov} subspace methods}, 19533 author = {Simoncini, V. and Szyld, D.B.}, 19534 journal = {SIAM Journal on Numerical Analysis}, 19535 pages = {2219--2239}, 19536 year = {2003}, 19537 publisher = {JSTOR} 19538} 19539 19540@Article{ parks2006recycling, 19541 title = {Recycling {K}rylov Subspaces for Sequences of Linear Systems}, 19542 author = {Parks, M.L. and de Sturler, E. and Mackey, G. and Johnson, D.D. and Maiti, S.}, 19543 journal = {SIAM Journal on Scientific Computing}, 19544 volume = {28}, 19545 number = {5}, 19546 pages = {1651--1674}, 19547 year = {2006}, 19548 publisher = {Society for Industrial and Applied Mathematics} 19549} 19550 19551@Article{ freund2003model, 19552 title = {Model reduction methods based on Krylov subspaces}, 19553 author = {Freund, R.W.}, 19554 journal = {Acta Numerica}, 19555 volume = {12}, 19556 number = {1}, 19557 pages = {267--319}, 19558 year = {2003}, 19559 publisher = {Cambridge Univ Press} 19560} 19561 19562@InBook{ gutknecht2006block, 19563 title = {Block {K}rylov space methods for linear systems with multiple right-hand sides: 19564 an introduction}, 19565 booktitle = {Modern Mathematical Models, Methods and Algorithms for Real World Systems}, 19566 author = {Gutknecht, M.H.}, 19567 editors = {Siddiqi A.H. and Duff I.S. and Christensen O.}, 19568 publisher = {Anamaya Publishers}, 19569 location = {New Delhi}, 19570 pages = {420-447}, 19571 year = {2006} 19572} 19573 19574@Article{ moulton1998black, 19575 title = {The black box multigrid numerical homogenization algorithm}, 19576 author = {Moulton, J.D. and Dendy, J.E. and Hyman, J.M. and others}, 19577 journal = {Journal of Computational Physics}, 19578 volume = {142}, 19579 number = {1}, 19580 pages = {80--108}, 19581 year = {1998}, 19582 publisher = {Elsevier} 19583} 19584 19585@Article{ neuss2001homogenization, 19586 title = {Homogenization and multigrid}, 19587 author = {Neuss, N. and J{\"a}ger, W. and Wittum, G.}, 19588 journal = {Computing}, 19589 volume = {66}, 19590 number = {1}, 19591 pages = {1--26}, 19592 year = {2001}, 19593 publisher = {Springer} 19594} 19595 19596@Article{ bai2002krylov, 19597 title = {Krylov subspace techniques for reduced-order modeling of large-scale dynamical 19598 systems}, 19599 author = {Bai, Z.}, 19600 journal = {Applied Numerical Mathematics}, 19601 volume = {43}, 19602 number = {1}, 19603 pages = {9--44}, 19604 year = {2002}, 19605 publisher = {Elsevier} 19606} 19607 19608@InProceedings{ dong2003piecewise, 19609 title = {Piecewise polynomial nonlinear model reduction}, 19610 author = {Dong, N. and Roychowdhury, J.}, 19611 booktitle = {Design Automation Conference, 2003. Proceedings}, 19612 pages = {484--489}, 19613 year = {2003}, 19614 organization = {IEEE} 19615} 19616 19617@Article{ bond2009stable, 19618 title = {Stable reduced models for nonlinear descriptor systems through piecewise-linear 19619 approximation and projection}, 19620 author = {Bond, B.N. and Daniel, L.}, 19621 journal = {IEEE Transactions on Computer-Aided Design of Integrated Circuits and Systems}, 19622 volume = {28}, 19623 number = {10}, 19624 pages = {1467--1480}, 19625 year = {2009}, 19626 publisher = {IEEE} 19627} 19628 19629@Article{ xin2000front, 19630 title = {Front Propagation in Heterogeneous Media}, 19631 author = {Xin, J.}, 19632 journal = {SIAM Review}, 19633 volume = {42}, 19634 number = {2}, 19635 pages = {161--230}, 19636 year = {2000}, 19637 publisher = {Society for Industrial and Applied Mathematics} 19638} 19639 19640@Article{ owhadi2011localized, 19641 title = {Localized Bases for Finite-Dimensional Homogenization Approximations with 19642 Nonseparated Scales and High Contrast}, 19643 author = {Owhadi, H. and Zhang, L.}, 19644 journal = {Multiscale Modeling and Simulation}, 19645 volume = {9}, 19646 pages = {1373}, 19647 year = {2011} 19648} 19649 19650@Article{ berlyand2010flux, 19651 title = {Flux norm approach to finite dimensional homogenization approximations with 19652 non-separated scales and high contrast}, 19653 author = {Berlyand, L. and Owhadi, H.}, 19654 journal = {Archive for rational mechanics and analysis}, 19655 volume = {198}, 19656 number = {2}, 19657 pages = {677--721}, 19658 year = {2010}, 19659 publisher = {Springer} 19660} 19661 19662@Article{ babuska2011optimal, 19663 title = {Optimal Local Approximation Spaces for Generalized Finite Element Methods with 19664 Application to Multiscale Problems}, 19665 author = {Babuska, I. and Lipton, R.}, 19666 journal = {Multiscale Modeling \& Simulation}, 19667 volume = {9}, 19668 pages = {373}, 19669 year = {2011} 19670} 19671 19672@Article{ boettinger2002phase, 19673 title = {Phase-Field Simulation of Solidification}, 19674 author = {Boettinger, W.J. and Warren, J.A. and Beckermann, C. and Karma, A.}, 19675 journal = {Annual review of materials research}, 19676 volume = {32}, 19677 number = {1}, 19678 pages = {163--194}, 19679 year = {2002}, 19680 publisher = {Annual Reviews} 19681} 19682 19683@Article{ karma1998quantitative, 19684 title = {Quantitative phase-field modeling of dendritic growth in two and three 19685 dimensions}, 19686 author = {Karma, A. and Rappel, W.J.}, 19687 journal = {Physical Review E}, 19688 volume = {57}, 19689 number = {4}, 19690 pages = {4323}, 19691 year = {1998}, 19692 publisher = {APS} 19693} 19694 19695@Article{ chen2002phase, 19696 title = {Phase-field models for microstructure evolution}, 19697 author = {Chen, L.Q.}, 19698 journal = {Annual review of materials research}, 19699 volume = {32}, 19700 number = {1}, 19701 pages = {113--140}, 19702 year = {2002}, 19703 publisher = {Annual Reviews} 19704} 19705 19706@Article{ galbally2010reductionuq, 19707 title = {Non-linear model reduction for uncertainty quantification in large-scale inverse 19708 problems}, 19709 author = {Galbally, D. and Fidkowski, K. and Willcox, K. and Ghattas, O.}, 19710 journal = {International journal for numerical methods in engineering}, 19711 volume = {81}, 19712 number = {12}, 19713 pages = {1581--1608}, 19714 year = {2010}, 19715 publisher = {Wiley Online Library} 19716} 19717 19718@Article{ griebel1995abstract, 19719 title = {On the abstract theory of additive and multiplicative {Schwarz} algorithms}, 19720 author = {Griebel, M. and Oswald, P.}, 19721 journal = {Numerische Mathematik}, 19722 volume = {70}, 19723 number = {2}, 19724 pages = {163--180}, 19725 year = {1995}, 19726 publisher = {Springer} 19727} 19728 19729@InProceedings{ voutchkov2006multiobjective, 19730 title = {Multiobjective optimization using surrogates}, 19731 author = {Voutchkov, I. and Keane, A.J.}, 19732 booktitle = {Adaptive Computing in Design and Manufacture}, 19733 pages = {167--175}, 19734 year = {2006}, 19735 publisher = {The MC Escher Company} 19736} 19737 19738@Article{ leary2001constraint, 19739 title = {A constraint mapping approach to the structural optimization of an expensive 19740 model using surrogates}, 19741 author = {Leary, S.J. and Bhaskar, A. and Keane, A.J.}, 19742 journal = {Optimization and Engineering}, 19743 volume = {2}, 19744 number = {4}, 19745 pages = {385--398}, 19746 year = {2001}, 19747 publisher = {Springer} 19748} 19749 19750@InProceedings{ legresley2000airfoil, 19751 title = {Airfoil design optimization using reduced order models based on proper orthogonal 19752 decomposition}, 19753 author = {LeGresley, P.A. and Alonso, J.J.}, 19754 booktitle = {Fluids 2000 Conference and Exhibit, Denver, CO}, 19755 year = {2000} 19756} 19757 19758@Book{ myers2009response, 19759 title = {Response surface methodology: process and product optimization using designed 19760 experiments}, 19761 author = {Myers, R.H. and Montgomery, D.C. and Anderson-Cook, C.M.}, 19762 volume = {705}, 19763 year = {2009}, 19764 publisher = {John Wiley \& Sons} 19765} 19766 19767@Article{ carlberg2012gnat, 19768 title = {The {GNAT} method for nonlinear model reduction: effective implementation and 19769 application to computational fluid dynamics and turbulent flows}, 19770 author = {Kevin Carlberg and Charbel Farhat and Julien Cortial and David Amsallem}, 19771 journal = {arXiv}, 19772 volume = {1207.1349}, 19773 year = {2012} 19774} 19775 19776@Article{ biros2008multilevel, 19777 title = {A multilevel algorithm for inverse problems with elliptic {PDE} constraints}, 19778 author = {Biros, G. and Dogan, G.}, 19779 journal = {Inverse Problems}, 19780 volume = {24}, 19781 pages = {034010}, 19782 year = {2008}, 19783 publisher = {IOP Publishing} 19784} 19785 19786@Article{ rees2010optimal, 19787 title = {Optimal Solvers for {PDE}-Constrained Optimization}, 19788 author = {Rees, T. and Dollar, H.S. and Wathen, A.J.}, 19789 journal = {SIAM Journal on Scientific Computing}, 19790 volume = {32}, 19791 pages = {271}, 19792 year = {2010} 19793} 19794 19795@Article{ rees2010block, 19796 title = {Block-triangular preconditioners for {PDE}-constrained optimization}, 19797 author = {Rees, T. and Stoll, M.}, 19798 journal = {Numerical Linear Algebra with Applications}, 19799 volume = {17}, 19800 number = {6}, 19801 pages = {977--996}, 19802 year = {2010}, 19803 publisher = {Wiley Online Library} 19804} 19805 19806@Article{ rees2011preconditioning, 19807 title = {Preconditioning Iterative Methods for the Optimal Control of the {S}tokes 19808 Equations}, 19809 author = {Rees, T. and Wathen, A.J.}, 19810 journal = {SIAM Journal on Scientific Computing}, 19811 volume = {33}, 19812 number = {5}, 19813 pages = {2903--2926}, 19814 year = {2011}, 19815 publisher = {Society for Industrial and Applied Mathematics} 19816} 19817 19818@Article{ vogel2007fbicg, 19819 title = {Flexible {BiCG} and flexible {Bi-CGSTAB} for nonsymmetric linear systems}, 19820 author = {Vogel,J.A.}, 19821 journal = {Applied Mathematics and Computation}, 19822 volume = {188}, 19823 number = {1}, 19824 pages = {226–-233}, 19825 year = {2007}, 19826 publisher = {Elsevier} 19827} 19828 19829@Unpublished{ leehammond2010, 19830 author = {B. Lee and G.E. Hammond}, 19831 title = {Parallel Performance of Preconditioned {Krylov} Solvers for the {Richards} 19832 Equation}, 19833 key = {multigrid}, 19834 note = {manuscript, 2010} 19835} 19836 19837@Article{ vandeneshop2004inexact, 19838 title = {Inexact {Krylov} Subspace Methods for Linear Systems}, 19839 author = {Jasper {van den} Eshof and Gerard L. G. Sleijpen}, 19840 journal = {SIAM Journal on Matrix Analysis and Applications}, 19841 volume = {26}, 19842 number = {1}, 19843 pages = {125--153}, 19844 year = {2004} 19845} 19846 19847@Article{ fbicg.fbcgs, 19848 title = {Flexible {BiCG} and flexible {Bi-CGSTAB} for nonsymmetric linear systems}, 19849 author = {Judith A. Vogel}, 19850 journal = {Applied Mathematics and Computation}, 19851 volume = {188}, 19852 number = {1}, 19853 pages = {226--233}, 19854 year = {2007} 19855} 19856 19857@Article{ simoncini2003inexact, 19858 title = {Theory of Inexact {Krylov} Subspace Methods and Applications to Scientific 19859 Computing}, 19860 author = {Valeria Simoncini and Daniel B. Szyld}, 19861 journal = {SIAM Journal on Scientific Computing}, 19862 volume = {25}, 19863 number = {2}, 19864 pages = {454--477}, 19865 year = {2003} 19866} 19867 19868@Article{ fqmr, 19869 title = {{FQMR}: A Flexible {Quasi-Minimal Residual} Method with Inexact Preconditioning}, 19870 author = {Daniel B. Szyld and Judith A. Vogel}, 19871 journal = {SIAM Journal on Scientific Computing}, 19872 volume = {23}, 19873 number = {2}, 19874 pages = {363--380}, 19875 year = {2001} 19876} 19877 19878@Article{ ipcg, 19879 title = {Inexact Preconditioned {Conjugate Gradient} Method with Inner-Outer Iteration}, 19880 author = {Gene H. Golub and Qiang Ye}, 19881 journal = {SIAM Journal on Scientific Computing}, 19882 volume = {21}, 19883 number = {4}, 19884 pages = {1305--1320}, 19885 year = {1999} 19886} 19887 19888@Article{ idr.sonneveld, 19889 title = {{IDR}(s): A Family of Simple and Fast Algorithms for Solving Large Nonsymmetric 19890 Systems of Linear Equations}, 19891 author = {Peter Sonneveld and Martin B. van Gijzen}, 19892 journal = {SIAM Journal on Scientific Computing}, 19893 volume = {31}, 19894 number = {2}, 19895 pages = {1035--1062}, 19896 year = {2008} 19897} 19898 19899@Article{ flexiblecg, 19900 title = {Flexible Conjugate Gradients}, 19901 author = {Yvan Notay}, 19902 journal = {SIAM Journal on Scientific Computing}, 19903 volume = {22}, 19904 number = {4}, 19905 pages = {1444--1460}, 19906 year = {2000} 19907} 19908 19909@Article{ generalizedcg, 19910 title = {A Black Box Generalized {Conjugate Gradient} Solver with Inner Iterations and 19911 Variable-Step Preconditioning}, 19912 author = {O. Axelsson and P. S. Vassilevski}, 19913 journal = {SIAM Journal on Matrix Analysis and Applications}, 19914 volume = {12}, 19915 number = {4}, 19916 pages = {625--644}, 19917 year = {1991} 19918} 19919 19920@Article{ bicg, 19921 title = {{Conjugate Gradient} methods for indefinite systems}, 19922 author = {R. Fletcher}, 19923 journal = {Lecture Notes in Mathematics}, 19924 volume = {506}, 19925 pages = {73--89}, 19926 year = {1976} 19927} 19928 19929@Article{ idr.bcgs, 19930 title = {{Bi-CGSTAB} as an induced dimension reduction method}, 19931 author = {Gerard L.G. Sleijpen and Peter Sonneveld and Martin B. van Gijzen}, 19932 journal = {Applied Numerical Mathematics}, 19933 volume = {60}, 19934 pages = {1100--1114}, 19935 year = {2010} 19936} 19937 19938@Article{ idr.bcgsl, 19939 title = {Exploiting {BiCGstab($\ell$)} strategies to induce dimension reduction}, 19940 author = {Gerard L.G. Sleijpen and Martin B. van Gijzen}, 19941 journal = {SIAM J. Sci. Comput.}, 19942 volume = {32}, 19943 number = {5}, 19944 pages = {2687--2709}, 19945 year = {2010} 19946} 19947 19948@Article{ idr.min.sync, 19949 title = {Minimizing synchronization in {IDR(s)}}, 19950 author = {T.P. Collignon and M.B. van Gijzen}, 19951 journal = {Numerical Linear Algebra with Applications}, 19952 volume = {18}, 19953 number = {5}, 19954 pages = {805--825}, 19955 year = {2011} 19956} 19957 19958@TechReport{ flexible.idr, 19959 title = {Flexible and Multi-Shift Induced Dimension Reduction Algorithms for solving Large 19960 Sparse Linear Systems}, 19961 author = {Martin B. van Gijzen and Gerard L.G. Sleijpen and Jens-Peter M. Zemke}, 19962 institution = {Delft University of Technology}, 19963 number = {11-06}, 19964 year = {2011} 19965} 19966 19967@Article{ vangenuchten1980, 19968 title = {A Closed-form Equation for Predicting the Hydraulic Conductivity of Unsaturated 19969 Soils}, 19970 author = {M. Th. van Genuchten}, 19971 journal = {Soil Science Society of America Journal}, 19972 volume = {44}, 19973 pages = {892--898}, 19974 year = {1980} 19975} 19976 19977@Article{ gmresr94, 19978 title = {{GMRESR}: a family of nested {GMRES} methods}, 19979 author = {H. A. Van der Vorst and C. Vuik}, 19980 journal = {Numerical Linear Algebra with Applications}, 19981 volume = {1}, 19982 number = {4}, 19983 pages = {369--386}, 19984 year = {1994} 19985} 19986 19987@Article{ knepley10, 19988 author = {Matthew G. Knepley}, 19989 title = {Removing the Barrier to Scalability in Parallel FMM}, 19990 journal = {CoRR}, 19991 volume = {abs/1008.2410}, 19992 note = {\url{http://arxiv.org/abs/1008.2410}}, 19993 year = {2010} 19994} 19995 19996@Article{ teng1998, 19997 author = {Shang-Hua Teng}, 19998 title = {Provably Good Partitioning and Load Balancing Algorithms for Parallel Adaptive 19999 N-Body Simulation}, 20000 journal = {SIAM J. Sci. Comput.}, 20001 volume = {19}, 20002 number = {2}, 20003 month = mar, 20004 pages = {635--656}, 20005 year = {1998}, 20006 issn = {1064-8275}, 20007 numpages = {22}, 20008 doi = {10.1137/S1064827595288942}, 20009 acmid = {289842}, 20010 issue_date = {March 1998}, 20011 publisher = {Society for Industrial and Applied Mathematics}, 20012 address = {Philadelphia, PA}, 20013 keywords = {N-body simulation, adaptive computing, hierarchical methods, load balancing, 20014 parallel processing, partitioning, scientific computing, the fast multipole 20015 method, tree-codes} 20016} 20017 20018@InProceedings{ skinnerkramer05, 20019 author = {David Skinner and William Kramer}, 20020 title = {Understanding the causes of performance variability in HPC workloads}, 20021 booktitle = {Workload Characterization Symposium, 2005. Proceedings of the IEEE 20022 International}, 20023 organization = {IEEE}, 20024 pages = {137--149}, 20025 year = {2005} 20026} 20027 20028@Article{ notay_2000, 20029 author = {Yvan Notay}, 20030 title = {Flexible {Conjugate Gradients}}, 20031 journal = {SIAM Journal on Scientific Computing}, 20032 volume = {22}, 20033 number = {4}, 20034 year = {2000}, 20035 pages = {1444--1460} 20036} 20037 20038@Article{ bereux1996, 20039 title = {Zero-relaxation limit versus operator splitting for two-phase fluid flow 20040 computations}, 20041 author = {Fran{\c{c}}ois B{\'e}reux}, 20042 journal = {Computer Methods in Applied Mechanics and Engineering}, 20043 volume = {133}, 20044 number = {1-2}, 20045 pages = {93--124}, 20046 year = {1996} 20047} 20048 20049@Article{ pawlowski2006globalization, 20050 title = {Globalization techniques for {N}ewton-{K}rylov methods and applications to the 20051 fully coupled solution of the {N}avier-{S}tokes equations}, 20052 author = {Pawlowski, Roger P and Shadid, John N and Simonis, Joseph P and Walker, Homer F}, 20053 journal = {SIAM Review}, 20054 volume = {48}, 20055 number = {4}, 20056 pages = {700--721}, 20057 year = {2006}, 20058 publisher = {SIAM} 20059} 20060 20061@Article{ roppshadid2009, 20062 title = {Stability of operator splitting methods for systems with indefinite operators: 20063 Advection--diffusion--reaction systems}, 20064 author = {David L Ropp and John N Shadid}, 20065 journal = {Journal of Computational Physics}, 20066 volume = {228}, 20067 number = {9}, 20068 pages = {3508--3516}, 20069 year = {2009} 20070} 20071 20072@Article{ brown1985experiments, 20073 title = {Experiments with quasi-{N}ewton methods in solving stiff {ODE} systems}, 20074 author = {Brown, P.N. and Hindmarsh, A.C. and Walker, H.F.}, 20075 journal = {SIAM Journal on Scientific and Statistical Computing}, 20076 volume = {6}, 20077 number = {2}, 20078 pages = {297--313}, 20079 year = {1985}, 20080 publisher = {SIAM} 20081} 20082 20083@Article{ bicgsl_1993, 20084 author = {GERARD L.G. SLEIJPEN and DIEDERIK R. FOKKEMA}, 20085 title = {{BiCGSTAB(l)} for Linear Equations involving Unsymmetric Matrices with Complex 20086 Spectrum}, 20087 journal = {Electronic Transactions on Numerical Analysis}, 20088 volume = {1}, 20089 year = {1993}, 20090 pages = {11--32} 20091} 20092 20093@Book{ brandt2011revised, 20094 title = {Multigrid Techniques: 1984 Guide with Applications to Fluid Dynamics, Revised 20095 Edition}, 20096 author = {Achi Brandt and Oren Livne}, 20097 year = {2011}, 20098 publisher = {SIAM} 20099} 20100 20101@Article{ axelsson1990algebraic, 20102 title = {Algebraic multilevel preconditioning methods, {II}}, 20103 author = {Axelsson, O. and Vassilevski, P.S.}, 20104 journal = {SIAM Journal on Numerical Analysis}, 20105 volume = {27}, 20106 number = {6}, 20107 pages = {1569--1590}, 20108 year = {1990}, 20109 publisher = {SIAM} 20110} 20111 20112@Article{ zulehner2002analysis, 20113 title = {Analysis of iterative methods for saddle point problems: a unified approach}, 20114 author = {Zulehner, W.}, 20115 journal = {Mathematics of computation}, 20116 volume = {71}, 20117 number = {238}, 20118 pages = {479--506}, 20119 year = {2002} 20120} 20121 20122@Article{ pralet2010, 20123 author = {L. Giraud and A. Haidar and S. Pralet}, 20124 title = {Using multiple levels of parallelism to enhance the performance of domain 20125 decomposition solvers}, 20126 journal = {Parallel Computing}, 20127 volume = {36}, 20128 number = {5-6}, 20129 pages = {285--296}, 20130 year = {2010} 20131} 20132 20133@Book{ brennerscottfem, 20134 title = {The Mathematical Theory of Finite Element Methods}, 20135 author = {Susanne C. Brenner and L. Ridgway Scott}, 20136 edition = {3rd Edition}, 20137 series = {Texts in Applied Mathematics}, 20138 year = {2008}, 20139 publisher = {Springer-Verlag} 20140} 20141 20142@Book{ ortega1987iterative, 20143 title = {Iterative solution of nonlinear equations in several variables}, 20144 author = {Ortega, James M and Rheinboldt, Werner C}, 20145 volume = {30}, 20146 publisher = {Society for Industrial and Applied Mathematics}, 20147 year = {1987} 20148} 20149 20150@InBook{ rheinboldtch6, 20151 author = {Werner C. Rheinboldt}, 20152 title = {6. Combinations of Processes}, 20153 booktitle = {Methods for Solving Systems of Nonlinear Equations}, 20154 chapter = {6}, 20155 pages = {59--74}, 20156 doi = {10.1137/1.9781611970012.ch6}, 20157 year = {1998} 20158} 20159 20160@Article{ allgowerbohmerpotrarheinboldt86, 20161 author = {E. Allgower and K. B\"ohmer and F. Potra and W.~C. Rheinboldt}, 20162 title = {A Mesh-Independence Principle for Operator Equations and Their Discretizations}, 20163 journal = {SIAM Journal on Numerical Analysis}, 20164 volume = {23}, 20165 number = {1}, 20166 pages = {160-169}, 20167 year = {1986}, 20168 doi = {10.1137/0723011} 20169} 20170 20171@Article{ rheinboldt76, 20172 author = {Werner C. Rheinboldt}, 20173 title = {On measures of ill-conditioning for nonlinear equations}, 20174 journal = {Mathematics of Computation}, 20175 volume = {30}, 20176 number = {133}, 20177 pages = {104--111}, 20178 year = {1976} 20179} 20180 20181@Article{ little61, 20182 author = {John D. C. Little}, 20183 title = {A Proof for the Queuing Formula: {$L = \lambda W$}}, 20184 journal = {Operations Research}, 20185 volume = {9}, 20186 number = {3}, 20187 pages = {383--387}, 20188 note = {\url{http://www.jstor.org/stable/167570}}, 20189 year = {1961} 20190} 20191 20192@Misc{ top500, 20193 author = {{TOP500 Supercomputer Sites}}, 20194 url = {http://www.top500.org}, 20195 year = {2013} 20196} 20197 20198@Misc{ hassediagram, 20199 author = {Wikipedia}, 20200 title = {Hasse Diagram}, 20201 url = {http://en.wikipedia.org/wiki/Hasse_diagram}, 20202 note = {\url{http://en.wikipedia.org/wiki/Hasse_diagram}}, 20203 year = {2015} 20204} 20205 20206@Misc{ groupoid, 20207 author = {Wikipedia}, 20208 title = {Groupoid}, 20209 url = {https://en.wikipedia.org/wiki/Groupoid}, 20210 note = {\url{http://en.wikipedia.org/wiki/Groupoid}}, 20211 year = {2015} 20212} 20213 20214@Misc{ cwcomplex, 20215 author = {Wikipedia}, 20216 title = {{CW} complex}, 20217 url = {http://en.wikipedia.org/wiki/CW_complex}, 20218 note = {\url{http://en.wikipedia.org/wiki/CW_complex}}, 20219 year = {2015} 20220} 20221 20222@Misc{ linearalgebra, 20223 author = {Wikipedia}, 20224 title = {Linear Algebra}, 20225 url = {https://en.wikipedia.org/wiki/Linear_algebra}, 20226 note = {\url{https://en.wikipedia.org/wiki/Linear_algebra}}, 20227 year = {2015} 20228} 20229 20230@Misc{ amdahlslaw, 20231 author = {Wikipedia}, 20232 title = {Amdahl's Law}, 20233 url = {https://en.wikipedia.org/wiki/Amdahl's_law}, 20234 note = {\url{https://en.wikipedia.org/wiki/Amdahl's_law}}, 20235 year = {2015} 20236} 20237 20238@Misc{ gustafsonslaw, 20239 author = {Wikipedia}, 20240 title = {Gustafson's Law}, 20241 url = {https://en.wikipedia.org/wiki/Gustafson's_law}, 20242 note = {\url{https://en.wikipedia.org/wiki/Gustafson's_law}}, 20243 year = {2015} 20244} 20245 20246@InProceedings{ amdahl1967, 20247 title = {Validity of the Single Processor Approach to Achieving Large Scale Computing 20248 Capabilities}, 20249 author = {Gene M. Amdahl}, 20250 booktitle = {Proceedings of the April 18-20, 1967, Spring Joint Computer Conference}, 20251 series = {AFIPS '67 (Spring)}, 20252 location = {Atlantic City, New Jersey}, 20253 pages = {483--485}, 20254 numpages = {3}, 20255 doi = {10.1145/1465482.1465560}, 20256 acmid = {1465560}, 20257 publisher = {ACM}, 20258 address = {New York, NY, USA}, 20259 year = {1967} 20260} 20261 20262@Article{ gustafson1988, 20263 title = {Reevaluating {Amdahl}'s Law}, 20264 author = {Gustafson, John L.}, 20265 journal = {Communications of the ACM}, 20266 volume = {31}, 20267 number = {5}, 20268 month = may, 20269 issn = {0001-0782}, 20270 pages = {532--533}, 20271 doi = {10.1145/42411.42415}, 20272 acmid = {42415}, 20273 year = {1988} 20274} 20275 20276@Book{ eijkhout2014, 20277 title = {Introduction to High Performance Scientific Computing}, 20278 author = {Victor Eijkhout}, 20279 url = {http://pages.tacc.utexas.edu/~eijkhout/Articles/EijkhoutIntroToHPC.pdf}, 20280 publisher = {TACC}, 20281 year = {2014} 20282} 20283 20284@Article{ korelc2002multilanguage, 20285 title = {Multi-language and multi-environment generation of nonlinear finite element 20286 codes}, 20287 author = {Korelc, J.}, 20288 journal = {Engineering with Computers}, 20289 volume = {18}, 20290 number = {4}, 20291 pages = {312--327}, 20292 year = {2002}, 20293 publisher = {Springer} 20294} 20295 20296@TechReport{ taylor2011feap, 20297 title = {{FEAP}: A Finite Element Analysis Program}, 20298 subtitle = {Version 8.3 User Manual}, 20299 author = {R. L. Taylor}, 20300 year = {2011}, 20301 institution = {University of California, Berkeley} 20302} 20303 20304@Article{ bergeraftosmismurman2005, 20305 title = {Analysis of slope limiters on irregular grids}, 20306 author = {Berger, Marsha and Aftosmis, Michael J and Murman, Scott M}, 20307 journal = {AIAA paper}, 20308 volume = {490}, 20309 pages = {2005}, 20310 year = {2005} 20311} 20312 20313@InProceedings{ ferreirabridgesbrightwell08, 20314 author = {Kurt B. Ferreira and Patrick Bridges and Ron Brightwell}, 20315 title = {Characterizing Application Sensitivity to OS Interference Using Kernel-level 20316 Noise Injection}, 20317 booktitle = {Proceedings of the 2008 ACM/IEEE Conference on Supercomputing}, 20318 series = {SC '08}, 20319 year = {2008}, 20320 isbn = {978-1-4244-2835-9}, 20321 location = {Austin, Texas}, 20322 pages = {19:1--19:12}, 20323 articleno = {19}, 20324 numpages = {12}, 20325 url = {http://dl.acm.org/citation.cfm?id=1413370.1413390}, 20326 acmid = {1413390}, 20327 publisher = {IEEE Press}, 20328 address = {Piscataway, NJ} 20329} 20330 20331@Article{ banach22, 20332 author = {Stefan Banach}, 20333 title = {Sur les op\'erations dans les ensembles abstraits et leur application aux 20334 \'equations int\'egrales}, 20335 journal = {Fund. Math.}, 20336 volume = {3}, 20337 pages = {133--181}, 20338 year = {1922} 20339} 20340 20341@Article{ bangerthbursteddeheisterkronbichler2012, 20342 author = {Wolfgang Bangerth and Carsten Burstedde and Timo Heister and Martin Kronbichler}, 20343 title = {Algorithms and Data Structures for Massively Parallel Generic Adaptive Finite 20344 Element Codes}, 20345 journal = {ACM Trans. Math. Softw.}, 20346 issue_date = {December 2011}, 20347 volume = {38}, 20348 number = {2}, 20349 month = jan, 20350 year = {2012}, 20351 issn = {0098-3500}, 20352 pages = {14:1--14:28}, 20353 articleno = {14}, 20354 numpages = {28}, 20355 doi = {10.1145/2049673.2049678}, 20356 acmid = {2049678}, 20357 publisher = {ACM}, 20358 address = {New York, NY, USA}, 20359 keywords = {Adaptive mesh refinement, object-orientation, parallel algorithms, software 20360 design} 20361} 20362 20363@Article{ eisenstatwalker1994, 20364 author = {Stanley Eisenstat and Homer Walker}, 20365 title = {Globally Convergent Inexact {N}ewton Methods}, 20366 journal = {SIAM Journal on Optimization}, 20367 volume = {4}, 20368 number = {2}, 20369 pages = {393--422}, 20370 year = {1994}, 20371 doi = {10.1137/0804022} 20372} 20373 20374@Book{ blumcuckershubsmale98, 20375 title = {Complexity and Real Computation}, 20376 author = {Lenore Blum and Felipe Cucker and Michael Shub and Steve Smale}, 20377 year = {1998}, 20378 publisher = {Springer} 20379} 20380 20381@Article{ caili2011, 20382 author = {Cai, X.-C. and Li, X.}, 20383 title = {Inexact {N}ewton Methods with Restricted Additive {S}chwarz Based Nonlinear 20384 Elimination for Problems with High Local Nonlinearity}, 20385 journal = {SIAM Journal on Scientific Computing}, 20386 volume = {33}, 20387 number = {2}, 20388 pages = {746-762}, 20389 year = {2011}, 20390 doi = {10.1137/080736272} 20391} 20392 20393@Article{ cai2009, 20394 author = {X.-C. Cai}, 20395 title = { Nonlinear overlapping domain decomposition methods}, 20396 journal = {Lecture Notes in Computational Science}, 20397 volume = {70}, 20398 pages = {217-224}, 20399 year = {2009} 20400} 20401 20402@Article{ lanzkronrosewilkes1996, 20403 title = {An analysis of approximate nonlinear elimination}, 20404 author = {Lanzkron, Paul J and Rose, Donald J and Wilkes, James T}, 20405 journal = {SIAM Journal on Scientific Computing}, 20406 volume = {17}, 20407 number = {2}, 20408 pages = {538--559}, 20409 year = {1996}, 20410 publisher = {SIAM} 20411} 20412 20413@TechReport{ gropp1993sowing, 20414 title = {Users manual for bfort: Producing {F}ortran interfaces to {C} source code}, 20415 author = {Gropp, W}, 20416 year = {1995}, 20417 number = {ANL/MCS-TM-208}, 20418 institution = {Argonne National Laboratory} 20419} 20420 20421@TechReport{ gropp1993sowing2, 20422 title = {Users Manual for doctext: Producing Documentation from Source Code}, 20423 author = {Gropp, W}, 20424 year = {1995}, 20425 number = {ANL/MCS-TM-206}, 20426 institution = {Argonne National Laboratory} 20427} 20428 20429@TechReport{ gropp1993simplified, 20430 title = {Simplified Linear Equation Solvers users manual}, 20431 author = {Gropp, W and Smith, B}, 20432 year = {1993}, 20433 number = {ANL--93/8}, 20434 institution = {Argonne National Laboratory} 20435} 20436 20437@Misc{ simplifiedbsd, 20438 author = {{University of California, Berkeley}}, 20439 title = {Simplified {Berkeley} Software Distribution License}, 20440 note = {see 20441 \url{http://en.wikipedia.org/wiki/BSD_licenses#2-clause_license_.28.22Simplified_BSD_License.22_or_.22FreeBSD_License.22.29}} 20442} 20443 20444@Book{ chaconstraub14, 20445 author = {Scott Chacon and Ben Straub}, 20446 title = {Pro Git}, 20447 publisher = {Apress}, 20448 year = {2014}, 20449 pages = {456}, 20450 note = {Available online at \url{http://git-scm.com/book/}} 20451} 20452 20453@Misc{ bitbucket, 20454 author = {Atlassian}, 20455 title = {Bitbucket}, 20456 note = {Platform available from \url{http://bitbucket.org}} 20457} 20458 20459@Misc{ gitworkflows, 20460 author = {GitWorkflows}, 20461 note = {Available at 20462 \url{https://www.kernel.org/pub/software/scm/git/docs/gitworkflows.html}} 20463} 20464 20465@Misc{ figshare, 20466 author = {FigShare}, 20467 note = {Available at \url{http://palgrave.figshare.com/}} 20468} 20469 20470@InProceedings{ beazley1996swig, 20471 title = {{SWIG}: An easy to use tool for integrating scripting languages with {C} and 20472 {C++}}, 20473 author = {Beazley, David M}, 20474 booktitle = {Proceedings of the 4th USENIX Tcl/Tk workshop}, 20475 pages = {129--139}, 20476 year = {1996} 20477} 20478 20479@Misc{ softwareproductivityworkshopreport14, 20480 author = {H. Johansen and L. C. McInnes and D. Bernholdt and J. Carver and M. Heroux and R. 20481 Hornung and P. Jones and B. Lucas and A. Siegel and T. Ndousse-Fetter}, 20482 title = {Software Productivity for Extreme-Scale Science}, 20483 note = {Report on DOE Workshop, January 13-14, 2014}, 20484 url = {http://www.orau.gov/swproductivity2014/SoftwareProductivityWorkshopReport2014.pdf}, 20485 year = {2014} 20486} 20487 20488@Misc{ softwareproductivitywhitepaper13, 20489 author = {H. Johansen and D. Bernholdt and B. Collins and M. Heroux and R. Jacob and P. 20490 Jones and L. C. McInnes and J. D. Moulton and T. Ndousse-Fetter and D. Post and W. 20491 Tang}, 20492 title = {Extreme-Scale Scientific Application Software Productivity: Harnessing the Full 20493 Capability of Extreme-Scale Computing}, 20494 note = {whitepaper submitted to DOE, available via 20495 \url{http://www.orau.gov/swproductivity2014/reference.htm}}, 20496 year = {2013} 20497} 20498 20499@Misc{ ideas:project, 20500 author = {Michael Heroux and Lois Curfman McInnes and J. David {Moulton (PIs)}}, 20501 title = {{Interoperable Design of Extreme-Scale Application Software (IDEAS)}}, 20502 howpublished = {\url{http://ideas-productivity.org}}, 20503 year = {2015} 20504} 20505 20506@TechReport{ keyesmcinneswoodwardetal2012, 20507 author = {D. E. Keyes and L. C. McInnes and C. Woodward and E. Constantinescu and D. Estep 20508 and B. Sheehan}, 20509 title = {First Steps Toward a Multiphysics Exemplars and Benchmarks Suite}, 20510 institution = {Argonne National Laboratory}, 20511 number = {ANL/MCS-TM-330}, 20512 month = oct, 20513 year = {2012} 20514} 20515 20516@Misc{ sawsfs-web-page, 20517 author = {Surtai Han and Barry Smith and Hong Zhang}, 20518 title = {{{SAWs Tutorial: Fieldsplit Preconditioner}}}, 20519 note = {\url{https://www.youtube.com/watch?v=-w0fPhmZT3c}}, 20520 year = {2015} 20521} 20522 20523@Misc{ sawshk-web-page, 20524 author = {Surtai Han and Barry Smith and Hong Zhang}, 20525 title = {{{SAWs Tutorial: Hierarchical Krylov Method}}}, 20526 note = {\url{https://www.youtube.com/watch?v=hWbqppTrcOw}}, 20527 year = {2015} 20528} 20529 20530@Misc{ sawsnestk-web-page, 20531 author = {Surtai Han and Barry Smith and Hong Zhang}, 20532 title = {{{SAWs Tutorial: Nested Krylov Method}}}, 20533 note = {\url{https://www.youtube.com/watch?v=kqPXZxMOJmA}}, 20534 year = {2015} 20535} 20536 20537@Misc{ m2acs:project, 20538 author = {M. {Anitescu et al.}}, 20539 title = {{Multifaceted Mathematics for Complex Energy Systems (M2ACS) {W}eb page}}, 20540 howpublished = {\url{http://www.mcs.anl.gov/MACS}}, 20541 year = {2015} 20542} 20543 20544@Misc{ hssmn13, 20545 author = {P. Hovland and B. Smith and M. Snir and L. C. McInnes and B. Norris}, 20546 title = {Exposing and Expanding Compiler Technologies to Improve Software Productivity in 20547 Developing Mathematical Libraries and Simulation Codes}, 20548 note = {whitepaper submitted to DOE Workshop on Software Productivity for Extreme-Scale 20549 Science, available via \url{http://www.orau.gov/swproductivity2014/papers.htm}}, 20550 year = {2013} 20551} 20552 20553@Misc{ atpesc:website, 20554 key = {{Argonne Training Program for Extreme-Scale Computing}}, 20555 title = {{Argonne Training Program for Extreme-Scale Computing (ATPESC)}}, 20556 howpublished = {\url{http://extremecomputingtraining.anl.gov}}, 20557 year = {2018} 20558} 20559 20560@Article{ barraultmadaynguyenpatera2004, 20561 author = {Maxime Barrault and Yvon Maday and Ngoc Cuong Nguyen and Anthony T. Patera}, 20562 title = {An empirical interpolation method: application to efficient reduced-basis 20563 discretization of partial differential equations}, 20564 journal = {Comptes Rendus Mathematique}, 20565 volume = {339}, 20566 number = {9}, 20567 pages = {667--672}, 20568 year = {2004}, 20569 issn = {1631-073X}, 20570 doi = {10.1016/j.crma.2004.08.006} 20571} 20572 20573@Article{ simongogotsi08, 20574 title = {Materials for electrochemical capacitors}, 20575 author = {Patrice Simon and Yury Gogotsi}, 20576 journal = {Nature Materials}, 20577 volume = {7}, 20578 number = {11}, 20579 pages = {845--854}, 20580 year = {2008}, 20581 doi = {10.1038/nmat2297} 20582} 20583 20584@Article{ vladsinghrollandmelinteajayangohy14, 20585 title = {Hybrid supercapacitor-battery materials for fast electrochemical charge storage}, 20586 author = {A. Vlad and N. Singh and J. Rolland and S. Melinte and P. M. Ajayan and J.-F. 20587 Gohy}, 20588 journal = {Scientific Reports}, 20589 volume = {4}, 20590 year = {2014}, 20591 doi = {10.1038/srep04315} 20592} 20593 20594@Article{ lichengshashurinkeidar12, 20595 title = {Review of Electrochemical Capacitors Based on Carbon Nanotubes and Graphene}, 20596 author = {J. Li and X. Cheng and A. Shashurin and M. Keidar}, 20597 journal = {Graphene}, 20598 volume = {1}, 20599 number = {1}, 20600 pages = {1--13}, 20601 year = {2012}, 20602 doi = {10.4236/graphene.2012.11001} 20603} 20604 20605@Article{ miller07, 20606 title = {A Brief History of Supercapacitors}, 20607 author = {John R. Miller}, 20608 journal = {Battery and Energy Storage Technology}, 20609 pages = {61--78}, 20610 year = {2007} 20611} 20612 20613@Book{ deshpande14, 20614 title = {Ultracapacitors: Future of Energy Storage}, 20615 author = {R. P. Deshpande}, 20616 publisher = {McGraw Hill Education}, 20617 isbn = {978-9339214050}, 20618 pages = {452}, 20619 year = {2014} 20620} 20621 20622@Article{ hojowboggs10, 20623 title = {Historical introduction to capacitor technology}, 20624 author = {J. Ho and T.R. Jow and S. Boggs}, 20625 journal = {IEEE Electrical Insulation Magazine}, 20626 month = jan, 20627 volume = {26}, 20628 number = {1}, 20629 pages = {20--25}, 20630 year = {2010}, 20631 doi = {10.1109/MEI.2010.5383924}, 20632 issn = {0883-7554} 20633} 20634 20635@Article{ gillespie14, 20636 title = {A review of steric interactions of ions: Why some theories succeed and others 20637 fail to acount for ion size}, 20638 author = {Dirk Gillespie}, 20639 journal = {Microfluidics and Nanofluidics}, 20640 volume = {18}, 20641 number = {5-6}, 20642 pages = {717--738}, 20643 year = {2015} 20644} 20645 20646@Article{ gillespievaliskoboda05, 20647 author = {Dirk Gillespie and Monica Valisk\'{o} and Dezs\H{o} Boda}, 20648 title = {Density functional theory of the electrical double layer: the RFD functional}, 20649 journal = {J. Phys.: Condens. Matter}, 20650 volume = {17}, 20651 pages = {6609--6626}, 20652 year = {2005} 20653} 20654 20655@Article{ valiskobodagillespie07, 20656 author = {Monica Valisk\'{o} and Dezs\H{o} Boda and Dirk Gillespie}, 20657 title = {Selective adsorption of ions with different diameter and valence at 20658 highly-charged interfaces}, 20659 journal = {J. Phys. Chem. C}, 20660 volume = {111}, 20661 pages = {15575--15585}, 20662 year = {2007} 20663} 20664 20665@Article{ gillespie08, 20666 author = {Dirk Gillespie}, 20667 title = {Energetics of divalent selectivity in a calcium channel: the ryanodine receptor 20668 case study}, 20669 journal = {Biophys. J.}, 20670 volume = {94}, 20671 pages = {1169--1184}, 20672 year = {2008} 20673} 20674 20675@Article{ liwuwang15, 20676 title = {Osmotic Pressure and Packaging Structure of Caged DNA}, 20677 author = {Zhidong Li and Jianzhong Wu and Zhen-Gang Wang}, 20678 journal = {Biophysical Journal}, 20679 volume = {94}, 20680 number = {3}, 20681 pages = {737--746}, 20682 doi = {10.1529/biophysj.107.112508}, 20683 url = {http://www.cell.com/biophysj/abstract/S0006-3495(08)70675-1}, 20684 year = {2015} 20685} 20686 20687@Article{ gillespie12, 20688 title = {High energy conversion efficiency in nanofluidic channels}, 20689 author = {Dirk Gillespie}, 20690 journal = {Nano Letters}, 20691 volume = {12}, 20692 pages = {1410--1416}, 20693 year = {2012} 20694} 20695 20696@Article{ dieterich79, 20697 title = {Modeling of rock friction: 1. Experimental results and constitutive equations}, 20698 author = {James H. Dieterich}, 20699 journal = {Journal of Geophysical Research: Solid Earth}, 20700 volume = {84}, 20701 number = {B5}, 20702 pages = {2161--2168}, 20703 year = {1979}, 20704 publisher = {Wiley Online Library} 20705} 20706 20707@Article{ bodakovacsgillespiekristof14, 20708 title = {Selective transport through a model calcium channel studied by Local Equilibrium 20709 Monte Carlo simulations coupled to the Nernst--Planck equation}, 20710 author = {Dezs{\H{o}} Boda and R{\'o}bert Kov{\'a}cs and Dirk Gillespie and Tam{\'a}s 20711 Krist{\'o}f}, 20712 journal = {Journal of Molecular Liquids}, 20713 volume = {189}, 20714 pages = {100--112}, 20715 year = {2014}, 20716 publisher = {Elsevier} 20717} 20718 20719@Article{ brandt05, 20720 title = {Multiscale solvers and systematic upscaling in computational physics}, 20721 author = {Brandt, A}, 20722 journal = {Computer Physics Communications}, 20723 volume = {169}, 20724 number = {1}, 20725 pages = {438--441}, 20726 year = {2005}, 20727 publisher = {Elsevier} 20728} 20729 20730@Article{ rosenfeld89, 20731 title = {Free-energy model for the inhomogeneous hard-sphere fluid mixture and 20732 density-functional theory of freezing}, 20733 author = {Yaakov Rosenfeld}, 20734 journal = {Physical review letters}, 20735 volume = {63}, 20736 number = {9}, 20737 pages = {980}, 20738 year = {1989}, 20739 publisher = {APS} 20740} 20741 20742@Article{ schindlermitchellmccabecummingslevan13, 20743 title = {Adsorption of Chain Molecules in Slit-Shaped Pores: Development of a SAFT-FMT-DFT 20744 Approach}, 20745 author = {Bryan J Schindler and Lucas A Mitchell and Clare McCabe and Peter T Cummings and 20746 M Douglas LeVan}, 20747 journal = {The Journal of Physical Chemistry C}, 20748 volume = {117}, 20749 number = {41}, 20750 pages = {21337--21350}, 20751 year = {2013}, 20752 publisher = {ACS Publications} 20753} 20754 20755@Misc{ tramonto, 20756 author = {Laura Frink and et. al.}, 20757 title = {TRAMONTO 3.0 web site}, 20758 url = {https://software.sandia.gov/DFTfluids/tramonto3_0.html}, 20759 year = {2014} 20760} 20761 20762@InCollection{ zhongyuenmoresiknepley15, 20763 author = {Shijie Zhong and David A. Yuen and Louis N. Moresi and Matthew G. Knepley}, 20764 title = {Numerical Methods for Mantle Convection}, 20765 booktitle = {Treatise on Geophysics}, 20766 publisher = {Elsevier}, 20767 volume = {7}, 20768 editor = {Gerald Schubert}, 20769 edition = {second}, 20770 year = {2015} 20771} 20772 20773@Article{ richarson1911, 20774 author = {Lewis Fry Richardson}, 20775 title = {The approximate arithmetical solution by finite differences of physical problems 20776 including differential equations, with an application to the stresses in a masonry 20777 dam}, 20778 journal = {Philosophical Transactions of the Royal Society A}, 20779 volume = {210}, 20780 number = {459--470}, 20781 pages = {307--357}, 20782 doi = {10.1098/rsta.1911.0009}, 20783 year = {1911} 20784} 20785 20786@Article{ kirkwood34, 20787 author = {John G. Kirkwood}, 20788 title = {Theory of Solutions of Molecules Containing Widely Separated Charges with Special 20789 Application to Zwitterions}, 20790 journal = {The Journal of Chemical Physics}, 20791 volume = {2}, 20792 number = {7}, 20793 year = {1934} 20794} 20795 20796@TechReport{ schoof1994exodus, 20797 title = {{EXODUS II}: a finite element data model}, 20798 author = {Larry A Schoof and Victor R Yarberry}, 20799 institution = {Sandia National Laboratories}, 20800 number = {SAND92-2137}, 20801 address = {Albuquerque, NM}, 20802 year = {1994} 20803} 20804 20805@Misc{ poirier1998cgns, 20806 author = {Diane Poirier and Steven R Allmaras and Douglas R McCarthy and Matthew F Smith 20807 and Fancis Y Enomoto}, 20808 title = {The CGNS system}, 20809 note = {AIAA Paper 98-3007}, 20810 year = {1998} 20811} 20812 20813@Article{ deyobarashephard2001, 20814 title = {Towards curvilinear meshing in 3D: the case of quadratic simplices}, 20815 author = {Saikat Dey and Robert M O'Bara and Mark S Shephard}, 20816 journal = {Computer-Aided Design}, 20817 volume = {33}, 20818 number = {3}, 20819 pages = {199--209}, 20820 year = {2001}, 20821} 20822 20823@InProceedings{ gomezhaimesgalbraith2022, 20824 title = {On Analysis Driven Shape Design Using B-Splines}, 20825 author = {Marlena Gomez and Robert Haimes and Marshall C Galbraith}, 20826 booktitle = {AIAA SciTech 2022 Forum}, 20827 pages = {1736}, 20828 year = {2022} 20829} 20830 20831@InProceedings{ cloughoberaizakrajsek2019, 20832 title = {Automated Wing Internal Structure Placement Guided by Finite Element Analysis}, 20833 author = {Justin L Clough and Assad A Oberai and Andrew J Zakrajsek}, 20834 booktitle = {AIAA Aviation 2019 Forum}, 20835 pages = {3369}, 20836 year = {2019} 20837} 20838 20839@InProceedings{ joegandhidannenhofferdalir2019, 20840 title = {Rapid generation of parametric aircraft structural models}, 20841 author = {John Joe and Viraj Gandhi and John Dannenhoffer and Hamid Dalir}, 20842 booktitle = {AIAA SciTech 2019 Forum}, 20843 pages = {2229}, 20844 year = {2019} 20845} 20846 20847@InProceedings{ haimesdannenhoffer2013, 20848 title = {The engineering sketch pad: A solid-modeling, feature-based, web-enabled system for building parametric geometry}, 20849 author = {Robert Haimes and John Dannenhoffer}, 20850 booktitle = {21st AIAA Computational Fluid Dynamics Conference}, 20851 pages = {3073}, 20852 year = {2013} 20853} 20854 20855@Article{ geuzaine2009gmsh, 20856 title = {Gmsh: A 3-D finite element mesh generator with built-in pre-and post-processing 20857 facilities}, 20858 author = {Christophe Geuzaine and Jean-Fran{\c{c}}ois Remacle}, 20859 journal = {International Journal for Numerical Methods in Engineering}, 20860 volume = {79}, 20861 number = {11}, 20862 pages = {1309--1331}, 20863 year = {2009}, 20864 publisher = {Wiley Online Library} 20865} 20866 20867@Article{ si2015, 20868 title = {{TetGen}, a {Delaunay}-Based Quality Tetrahedral Mesh Generator}, 20869 author = {Hang Si}, 20870 journal = {ACM Trans. on Mathematical Software}, 20871 volume = {41}, 20872 number = {2}, 20873 month = feb, 20874 doi = {10.1145/2629697}, 20875 year = {2015} 20876} 20877 20878@TechReport{ blackerbohnhoffedwards1994, 20879 title = {CUBIT mesh generation environment. Volume 1: Users manual}, 20880 author = {Ted D Blacker and William J Bohnhoff and Tony L Edwards}, 20881 institution = {Sandia National Labs., Albuquerque, NM (United States)}, 20882 year = {1994} 20883} 20884 20885@Article{ bjorck1994, 20886 title = {Numerics of Gram-Schmidt orthogonalization}, 20887 author = {{\AA}ke Bj{\"o}rck}, 20888 journal = {Linear Algebra and Its Applications}, 20889 volume = {197}, 20890 pages = {297--316}, 20891 year = {1994}, 20892 publisher = {Elsevier} 20893} 20894 20895@PhDThesis{ yood05, 20896 author = {Charles Nelson Yood}, 20897 title = {Argonne National Laboratory and the Emergence of Computer and Computational 20898 Science, 1946--1992}, 20899 school = {The Pennsylvania State University}, 20900 month = aug, 20901 year = {2005} 20902} 20903 20904@Article{ fearnleysander79, 20905 title = {Hermann Grassmann and the Creation of Linear Algebra}, 20906 author = {Desmond Fearnley-Sander}, 20907 journal = {The American Mathematical Monthly}, 20908 volume = {86}, 20909 pages = {809--817}, 20910 url = {http://www.maa.org/sites/default/files/pdf/upload_library/22/Ford/DesmondFearnleySander.pdf}, 20911 year = {1979} 20912} 20913 20914@InCollection{ knepley2012, 20915 author = {Matthew G. Knepley}, 20916 title = {Programming Languages for Scientific Computing}, 20917 booktitle = {Encyclopedia of Applied and Computational Mathematics}, 20918 publisher = {Springer}, 20919 year = {2012}, 20920 editor = {Bj\"orn Engquist}, 20921 doi = {10.1007/978-3-540-70529-1}, 20922 url = {http://arxiv.org/abs/1209.1711} 20923} 20924 20925@InBook{ knepley2015, 20926 title = {Programming Languages for Scientific Computing}, 20927 author = {Matthew G. Knepley}, 20928 booktitle = {Encyclopedia of Applied and Computational Mathematics}, 20929 editor = {Bj{\"o}rn Engquist}, 20930 publisher = {Springer Berlin Heidelberg}, 20931 address = {Berlin, Heidelberg}, 20932 pages = {1173--1181}, 20933 isbn = {978-3-540-70529-1}, 20934 doi = {10.1007/978-3-540-70529-1_250}, 20935 year = {2015} 20936} 20937 20938@Book{ hughes2000, 20939 author = {Thomas J. R. Hughes}, 20940 title = {The Finite Element Method: Linear Static and Dynamic Finite Element Analysis}, 20941 series = {Dover Civil and Mechanical Engineering}, 20942 pages = {704}, 20943 year = {2000}, 20944 isbn = {978-0486411811}, 20945 publisher = {Dover} 20946} 20947 20948@Article{ roache2002, 20949 title = {Code verification by the method of manufactured solutions}, 20950 author = {Patrick J. Roache}, 20951 journal = {Journal of Fluids Engineering}, 20952 volume = {124}, 20953 number = {1}, 20954 pages = {4--10}, 20955 year = {2002}, 20956 publisher = {American Society of Mechanical Engineers} 20957} 20958 20959@InCollection{ rokosgorman13, 20960 title = {PRAgMaTIc - Parallel Anisotropic Adaptive Mesh Toolkit}, 20961 author = {Georgios Rokos and Gerard Gorman}, 20962 booktitle = {Facing the Multicore-Challenge III}, 20963 series = {Lecture Notes in Computer Science}, 20964 editor = {Keller, Rainer and Kramer, David and Weiss, Jan-Philipp}, 20965 publisher = {Springer Berlin Heidelberg}, 20966 volume = {7686}, 20967 pages = {143-144}, 20968 doi = {10.1007/978-3-642-35893-7_22}, 20969 isbn = {978-3-642-35892-0}, 20970 year = {2013} 20971} 20972 20973@Misc{ hdf5:homepage, 20974 author = {{The HDF Group}}, 20975 title = {The {HDF5} Homepage}, 20976 howpublished = {\url{https://www.hdfgroup.org/HDF5/}}, 20977 year = {2015} 20978} 20979 20980@Misc{ paraview:homepage, 20981 author = {Kitware}, 20982 title = {The {ParaView} Homepage}, 20983 howpublished = {\url{http://www.paraview.org/}}, 20984 year = {2015} 20985} 20986 20987@Misc{ xdmf:homepage, 20988 author = {Kitware}, 20989 title = {The Extensible Data Model and Format ({XDMF})}, 20990 howpublished = {\url{http://www.xdmf.org/}}, 20991 year = {2015} 20992} 20993 20994@Article{ cullerkarp1993, 20995 title = {LogP: Towards a realistic model of parallel computation}, 20996 author = {David Culler and Richard Karp and David Patterson and Abhijit Sahay and Klaus 20997 Erik Schauser and Eunice Santos and Ramesh Subramonian and Thorsten Von Eicken}, 20998 journal = {SIGPLAN Notices}, 20999 volume = {28}, 21000 number = {7}, 21001 pages = {1--12}, 21002 year = {1993}, 21003 publisher = {ACM} 21004} 21005 21006@Article{ aggarwalvitter1988, 21007 title = {The input/output complexity of sorting and related problems}, 21008 author = {Alok Aggarwal and Jeffrey Vitter}, 21009 journal = {Communications of the ACM}, 21010 volume = {31}, 21011 number = {9}, 21012 pages = {1116--1127}, 21013 year = {1988}, 21014 publisher = {ACM} 21015} 21016 21017@InProceedings{ czechowskibattaglinomcclanahanchandramowlishwaranvuduc2011, 21018 author = {Kenneth Czechowski and Casey Battaglino and Chris McClanahan and Aparna 21019 Chandramowlishwaran and Richard Vuduc}, 21020 title = {Balance principles for algorithm-architecture co-design}, 21021 booktitle = {Proc.~USENIX Wkshp. Hot Topics in Parallelism (HotPar)}, 21022 month = may, 21023 address = {Berkeley, CA, USA}, 21024 url = {http://www.usenix.org/events/hotpar11/tech/final_files/Czechowski.pdf}, 21025 year = {2011} 21026} 21027 21028@Article{ williamswatermanpatterson2009, 21029 title = {Roofline: an insightful visual performance model for multicore architectures}, 21030 author = {Samuel Williams and Andrew Waterman and David Patterson}, 21031 journal = {Communications of the ACM}, 21032 volume = {52}, 21033 number = {4}, 21034 pages = {65--76}, 21035 year = {2009}, 21036 publisher = {ACM} 21037} 21038 21039@Misc{ roofline-web-page, 21040 author = {Samuel Williams and {et. al.}}, 21041 title = {{R}oofline {P}erformance {M}odel}, 21042 key = {Roofline}, 21043 url = {http://crd.lbl.gov/departments/computer-science/performance-and-algorithms-research/research/roofline/}, 21044 howpublished = {\url{http://crd.lbl.gov/departments/computer-science/performance-and-algorithms-research/research/roofline/}} 21045} 21046 21047@Misc{ roofline-talk2008, 21048 author = {Samuel Williams and David Patterson}, 21049 title = {{R}oofline {P}erformance {M}odel}, 21050 key = {Roofline}, 21051 year = {2008}, 21052 note = {ParLab Summer Retreat}, 21053 url = {http://crd.lbl.gov/assets/pubs_presos/parlab08-roofline-talk.pdf}, 21054 howpublished = {\url{http://crd.lbl.gov/assets/pubs_presos/parlab08-roofline-talk.pdf}} 21055} 21056 21057@Article{ lee2006, 21058 title = {The problem with threads}, 21059 author = {Edward A Lee}, 21060 journal = {Computer}, 21061 volume = {39}, 21062 number = {5}, 21063 pages = {33--42}, 21064 year = {2006}, 21065 url = {http://ptolemy.eecs.berkeley.edu/publications/papers/06/problemwithThreads/}, 21066 publisher = {IEEE Computer Society Press} 21067} 21068 21069@Article{ hoefler2012, 21070 title = {{Optimization principles for collective neighborhood communications}}, 21071 author = {Torsten Hoefler and Timo Schneider}, 21072 journal = {International Conference for High Performance Computing, Networking, Storage and 21073 Analysis, SC}, 21074 doi = {10.1109/SC.2012.86}, 21075 isbn = {9781467308069}, 21076 issn = {21674329}, 21077 year = {2012} 21078} 21079 21080@Book{ grahamknuthpatashnik1989, 21081 title = {Concrete Mathematics}, 21082 author = {Ronald L Graham and Donald E Knuth and Oren Patashnik}, 21083 publisher = {Addison-Wesley}, 21084 year = {1989} 21085} 21086 21087@Book{ jackson1962, 21088 title = {Classical Electrodynamics}, 21089 author = {John David Jackson}, 21090 publisher = {John Wiley \& Sons}, 21091 year = {1962} 21092} 21093 21094@Article{ leveque2013, 21095 title = {Top Ten Reasons to Not Share Your Code (and why you should anyway)}, 21096 author = {Randall J. LeVeque}, 21097 journal = {SIAM News}, 21098 volume = {46}, 21099 number = {3}, 21100 month = apr, 21101 url = {http://faculty.washington.edu/rjl/pubs/topten/}, 21102 year = {2013} 21103} 21104 21105@InProceedings{ wang2014, 21106 title = {Fjos: Practical, predictable, and efficient system support for fork/join 21107 parallelism}, 21108 author = {Qi Wang and Gabriel Parmer}, 21109 booktitle = {Real-Time and Embedded Technology and Applications Symposium (RTAS), 2014 IEEE 21110 20th}, 21111 pages = {25--36}, 21112 year = {2014}, 21113 organization = {IEEE} 21114} 21115 21116@Article{ fangsaad2009, 21117 author = {Haw-ren Fang and Yousef Saad}, 21118 title = {Two classes of multisecant methods for nonlinear acceleration}, 21119 journal = {Numerical Linear Algebra with Applications}, 21120 volume = {16}, 21121 number = {3}, 21122 pages = {197--221}, 21123 year = {2009}, 21124 doi = {10.1002/nla.617} 21125} 21126 21127@Misc{ hpcchallenge, 21128 title = {HPC Challenge}, 21129 author = {Jack Dongarra and Piotr Luszczek and others}, 21130 url = {http://icl.cs.utk.edu/hpcc/hpcc_results_lat_band.cgi?display=opt}, 21131 year = {2015} 21132} 21133 21134@InProceedings{ hoeflerschneiderlumsdaine2008, 21135 title = {Accurately measuring collective operations at massive scale}, 21136 author = {Torsten Hoefler and Timo Schneider and Andrew Lumsdaine}, 21137 booktitle = {Proceedings of the 22nd IEEE International Symposium on Parallel and Distributed 21138 Processing (IPDPS)}, 21139 pages = {1--8}, 21140 year = {2008}, 21141 doi = {10.1109/IPDPS.2008.4536494}, 21142 organization = {IEEE} 21143} 21144 21145@Book{ potraptak1984, 21146 title = {Nondiscrete Induction and Iterative Processes}, 21147 author = {Florian A. Potra and Vlastimil Pt{\'a}k}, 21148 series = {Research Notes in Mathematics}, 21149 year = {1984}, 21150 publisher = {Pitman} 21151} 21152 21153@Book{ pilz1977, 21154 title = {Near-rings: the theory and its applications}, 21155 author = {G{\"u}nter Pilz}, 21156 year = {1977}, 21157 publisher = {New York} 21158} 21159 21160@Article{ birkenjameson2009, 21161 title = {{On nonlinear preconditioners in {N}ewton-{K}rylov methods for unsteady flows}}, 21162 author = {Philipp Birken and Antony Jameson}, 21163 journal = {International Journal for Numerical Methods in Fluids}, 21164 volume = {62}, 21165 number = {5}, 21166 pages = {565--573}, 21167 publisher = {John Wiley \& Sons, Ltd.}, 21168 doi = {10.1002/fld.2030}, 21169 issn = {1097-0363}, 21170 year = {2010} 21171} 21172 21173@Article{ anderson1965, 21174 title = {Iterative procedures for nonlinear integral equations}, 21175 author = {Donald G Anderson}, 21176 journal = {Journal of the ACM (JACM)}, 21177 volume = {12}, 21178 number = {4}, 21179 pages = {547--560}, 21180 year = {1965}, 21181 publisher = {ACM} 21182} 21183 21184@Article{ ptak1966, 21185 title = {Some metric aspects of the open mapping and closed graph theorems}, 21186 author = {Vlastimil Pt{\'a}k}, 21187 journal = {Mathematische Annalen}, 21188 volume = {163}, 21189 number = {2}, 21190 pages = {95--104}, 21191 year = {1966}, 21192 publisher = {Springer} 21193} 21194 21195@Article{ ptak1974, 21196 title = {A quantitative refinement of the closed graph theorem}, 21197 author = {Vlastimil Pt{\'a}k}, 21198 journal = {Czechoslovak Mathematical Journal}, 21199 volume = {24}, 21200 number = {3}, 21201 pages = {503--506}, 21202 year = {1974}, 21203 publisher = {Institute of Mathematics, Academy of Sciences of the Czech Republic} 21204} 21205 21206@Article{ ptak1975, 21207 title = {The rate of convergence of {Newton's} process}, 21208 author = {Vlastimil Pt{\'a}k}, 21209 journal = {Numerische Mathematik}, 21210 volume = {25}, 21211 number = {3}, 21212 pages = {279--285}, 21213 year = {1975}, 21214 publisher = {Springer} 21215} 21216 21217@Article{ ptak1976, 21218 title = {Nondiscrete mathematical induction and iterative existence proofs}, 21219 author = {Vlastimil Pt{\'a}k}, 21220 journal = {Linear algebra and its applications}, 21221 volume = {13}, 21222 number = {3}, 21223 pages = {223--238}, 21224 year = {1976}, 21225 publisher = {Elsevier} 21226} 21227 21228@Article{ ptak1977, 21229 title = {What should be a rate of convergence?}, 21230 author = {Vlastimil Pt{\'a}k}, 21231 journal = {RAIRO-Analyse num{\'e}rique}, 21232 volume = {11}, 21233 number = {3}, 21234 pages = {279--286}, 21235 year = {1977} 21236} 21237 21238@Article{ potraptak1980, 21239 title = {Sharp error bounds for {Newton's} process}, 21240 author = {Florian A Potra and Vlastimil Pt{\'a}k}, 21241 journal = {Numerische Mathematik}, 21242 volume = {34}, 21243 number = {1}, 21244 pages = {63--72}, 21245 year = {1980}, 21246 publisher = {Springer} 21247} 21248 21249@Article{ liesen2014, 21250 title = {Pt\'ak's nondiscrete induction and its application to matrix iterations}, 21251 author = {J{\"o}rg Liesen}, 21252 journal = {IMA Journal of Numerical Analysis}, 21253 doi = {10.1093/imanum/drv037}, 21254 archiveprefix = {arXiv}, 21255 eprint = {1405.2683}, 21256 primaryclass = {math-na}, 21257 year = {2015} 21258} 21259 21260@Book{ traub1964, 21261 title = {Iterative Methods for the Solution of Equations}, 21262 author = {Joseph F Traub}, 21263 year = {1964}, 21264 publisher = {Prentice-Hall, Englewood Cliffs, NJ} 21265} 21266 21267@InProceedings{ shalfvecpar2010, 21268 title = {Exascale Computing Technology Challenges}, 21269 author = {John Shalf and Sudip Dosanjh and John Morrison}, 21270 booktitle = {J.M.L.M. Palma et al. (Eds.): VECPAR 2010, LNCS 6449}, 21271 pages = {1–-25}, 21272 year = {2010} 21273} 21274 21275@Article{ frechet1907, 21276 title = {Sur les ensembles de fonctions et les op\'erations lin\'eaires}, 21277 author = {Maurice Ren\'e Fr\'echet}, 21278 journal = {C. R. Acad. Sci. Paris}, 21279 volume = {144}, 21280 pages = {1414--1416}, 21281 year = {1907} 21282} 21283 21284@Article{ riesz1907, 21285 title = {Sur une esp\'ece de g\'eom\'etrie analytique des syst\'emes de fonctions sommables}, 21286 author = {Frigyes Riesz}, 21287 journal = {C. R. Acad. Sci. Paris}, 21288 volume = {144}, 21289 pages = {1409--1411}, 21290 year = {1907} 21291} 21292 21293@Article{ riesz1909, 21294 title = {Sur les op\'erations fonctionnelles lin\'eaires}, 21295 author = {Frigyes Riesz}, 21296 journal = {C. R. Acad. Sci. Paris}, 21297 volume = {149}, 21298 pages = {974--977}, 21299 year = {1909} 21300} 21301 21302@Misc{ rieszmarkovkakutanirepresentationtheorem, 21303 author = {Wikipedia}, 21304 title = {Riesz-Markov-Kakutani Representation Theorem}, 21305 url = {http://en.wikipedia.org/wiki/Riesz-Markov-Kakutani_representation_theorem}, 21306 note = {\url{http://en.wikipedia.org/wiki/Riesz-Markov-Kakutani_representation_theorem}}, 21307 year = {2015} 21308} 21309 21310@Article{ markov1938, 21311 title = {On mean values and exterior densities}, 21312 author = {Andrey Markov}, 21313 journal = {Rec. Math. Moscou}, 21314 volume = {4}, 21315 pages = {165--190}, 21316 year = {1938} 21317} 21318 21319@Article{ kakutani1941, 21320 title = {Concrete representation of abstract {(M)}-spaces. (A characterization of the 21321 space of continuous functions.)}, 21322 author = {Shizuo Kakutani}, 21323 journal = {Ann. of Math.}, 21324 volume = {2}, 21325 number = {42}, 21326 pages = {994--1024}, 21327 doi = {10.2307/1968778}, 21328 year = {1941} 21329} 21330 21331@Article{ michoskimeyersonisaacwaelbroeck2014, 21332 title = {Discontinuous Galerkin methods for plasma physics in the scrape-off layer of 21333 tokamaks}, 21334 author = {Craig Michoski and D. Meyerson and Tobin Isaac and F. Waelbroeck}, 21335 journal = {Journal of Computational Physics}, 21336 volume = {274}, 21337 pages = {898--919}, 21338 year = {2014}, 21339 publisher = {Elsevier} 21340} 21341 21342@InProceedings{ bursteddeghattasgurnisisaacstadlerwarburtonwilcox2010, 21343 title = {Extreme-scale AMR}, 21344 author = {Carsten Burstedde and Omar Ghattas and Michael Gurnis and Tobin Isaac and Georg 21345 Stadler and Tim Warburton and Lucas Wilcox}, 21346 booktitle = {Proceedings of the 2010 ACM/IEEE International Conference for High Performance 21347 Computing, Networking, Storage and Analysis}, 21348 pages = {1--12}, 21349 year = {2010}, 21350 organization = {IEEE Computer Society}, 21351 doi = {10.1109/SC.2010.25} 21352} 21353 21354@InProceedings{ isaacbursteddeghattas2012, 21355 title = {Low-cost parallel algorithms for 2: 1 octree balance}, 21356 author = {Tobin Isaac and Carsten Burstedde and Omar Ghattas}, 21357 booktitle = {Parallel \& Distributed Processing Symposium (IPDPS), 2012 IEEE 26th 21358 International}, 21359 pages = {426--437}, 21360 year = {2012}, 21361 organization = {IEEE}, 21362 doi = {10.1109/IPDPS.2012.47} 21363} 21364 21365@Article{ isaacpetrastadlerghattas2015, 21366 title = {Scalable and efficient algorithms for the propagation of uncertainty from data 21367 through inference to prediction for large-scale problems, with application to flow 21368 of the {Antarctic} ice sheet}, 21369 author = {Tobin Isaac and Noemi Petra and Georg Stadler and Omar Ghattas}, 21370 journal = {Journal of Computational Physics}, 21371 volume = {296}, 21372 pages = {348--368}, 21373 year = {2015}, 21374 publisher = {Elsevier}, 21375 doi = {10.1016/j.jcp.2015.04.047} 21376} 21377 21378@Article{ isaacbursteddewilcoxghattas2015, 21379 title = {Recursive Algorithms for Distributed Forests of Octrees}, 21380 author = {Tobin Isaac and Carsten Burstedde and Lucas C Wilcox and Omar Ghattas}, 21381 journal = {SIAM Journal on Scientific Computing}, 21382 volume = {37}, 21383 number = {5}, 21384 pages = {C497-C531}, 21385 eprint = {1406.0089}, 21386 eprinttype = {arXiv}, 21387 year = {2015}, 21388 doi = {10.1137/140970963} 21389} 21390 21391@Article{ isaacstadlerghattas2015, 21392 title = {Solution of nonlinear {S}tokes equations discretized by high-order finite 21393 elements on nonconforming and anisotropic meshes, with application to ice sheet 21394 dynamics}, 21395 author = {Isaac, Tobin and Stadler, Georg and Ghattas, Omar}, 21396 journal = {SIAM Journal on Scientific Computing}, 21397 number = {6}, 21398 pages = {804--833}, 21399 volume = {37}, 21400 year = {2015}, 21401 doi = {10.1137/140974407} 21402} 21403 21404@InProceedings{ rudimalossiisaacstadlergurnisstaarineichenbekascurionighattas2015, 21405 title = {An extreme-scale implicit solver for complex {PDEs}: highly heterogeneous flow in 21406 earth's mantle}, 21407 author = {Johann Rudi and A Cristiano I Malossi and Tobin Isaac and Georg Stadler and 21408 Michael Gurnis and Peter WJ Staar and Yves Ineichen and Costas Bekas and 21409 Alessandro Curioni and Omar Ghattas}, 21410 booktitle = {Proceedings of the International Conference for High Performance Computing, 21411 Networking, Storage and Analysis}, 21412 pages = {5}, 21413 year = {2015}, 21414 organization = {ACM}, 21415 doi = {10.1145/2807591.2807675} 21416} 21417 21418@Article{ bunchhopcroft1974, 21419 title = {Triangular factorization and inversion by fast matrix multiplication}, 21420 author = {James R Bunch and John E Hopcroft}, 21421 journal = {Mathematics of Computation}, 21422 volume = {28}, 21423 number = {125}, 21424 pages = {231--236}, 21425 doi = {10.2307/2005828}, 21426 year = {1974} 21427} 21428 21429@Article{ nemirovsky1991, 21430 title = {On optimality of Krylov's information when solving linear operator equations}, 21431 author = {A.S Nemirovsky}, 21432 journal = {Journal of Complexity}, 21433 volume = {7}, 21434 number = {2}, 21435 pages = {121--130}, 21436 doi = {10.1016/0885-064X(91)90001-E}, 21437 year = {1991} 21438} 21439 21440@Misc{siamcseprize, 21441 author = {{PETSc Team}}, 21442 title = {{SIAM/ACM} {P}rize in {C}omputational {S}cience and {E}ngineering}, 21443 key = {{SIAM/ACM} {P}rize in {C}omputational {S}cience and {E}ngineering}, 21444 url = {https://www.siam.org/prizes/sponsored/cse.php}, 21445 year = {2015} 21446} 21447 21448@Article{ rathgeber2017, 21449 title = {Firedrake: automating the finite element method by composing abstractions}, 21450 author = {Rathgeber, Florian and Ham, David A and Mitchell, Lawrence and Lange, Michael and 21451 Luporini, Fabio and McRae, Andrew TT and Bercea, Gheorghe-Teodor and Markall, 21452 Graham R and Kelly, Paul HJ}, 21453 archiveprefix = {arXiv}, 21454 journal = {ACM Transaction on Mathematical Software}, 21455 eprint = {1501.01809}, 21456 volume = {43}, 21457 issue = {3}, 21458 number = {24}, 21459 year = {2017}, 21460 url = {http://arxiv.org/abs/1501.01809} 21461} 21462 21463@Article{ kirby2006b, 21464 title = {Topological optimization of the evaluation of finite element matrices}, 21465 author = {Robert C Kirby and Anders Logg and L Ridgway Scott and Andy R. Terrel}, 21466 journal = {SIAM Journal on Scientific Computing}, 21467 volume = {28}, 21468 number = {1}, 21469 pages = {224--240}, 21470 year = {2006}, 21471 publisher = {SIAM} 21472} 21473 21474@Article{ luporini2015, 21475 author = {Luporini, Fabio and Varbanescu, Ana Lucia and Rathgeber, Florian and Bercea, 21476 Gheorghe-Teodor and Ramanujam, J. and Ham, David A. and Kelly, Paul H. J.}, 21477 title = {Cross-Loop Optimization of Arithmetic Intensity for Finite Element Local 21478 Assembly}, 21479 journal = {ACM Trans. Archit. Code Optim.}, 21480 issue_date = {January 2015}, 21481 volume = {11}, 21482 number = {4}, 21483 month = jan, 21484 year = {2015}, 21485 issn = {1544-3566}, 21486 pages = {57:1--57:25}, 21487 articleno = {57}, 21488 numpages = {25}, 21489 doi = {10.1145/2687415}, 21490 acmid = {2687415}, 21491 publisher = {ACM}, 21492 address = {New York, NY, USA}, 21493 keywords = {Finite element integration, SIMD vectorization, compilers, local assembly, 21494 optimizations} 21495} 21496 21497@Article{ markall2012, 21498 title = {Finite element assembly strategies on multi- and many-core architectures}, 21499 author = {Markall, G. R. and Slemmer, A. and Ham, D. A. and Kelly, P. H. J. and Cantwell, 21500 C. D. and Sherwin, S. J.}, 21501 journal = {International Journal for Numerical Methods in Fluids}, 21502 year = {2013}, 21503 volume = {71}, 21504 pages = {80--97}, 21505 doi = {10.1002/fld.3648} 21506} 21507 21508@Article{ markall2010, 21509 title = {Towards generating optimised finite element solvers for GPUs from high-level 21510 specifications}, 21511 author = {Graham R. Markall and David A. Ham and Paul H. J. Kelly}, 21512 journal = {Procedia Computer Science}, 21513 volume = {1}, 21514 number = {1}, 21515 pages = {1815--1823}, 21516 year = {2010}, 21517 note = {{ICCS} 2010}, 21518 doi = {10.1016/j.procs.2010.04.203} 21519} 21520 21521@Article{ longkirbywaanders2010, 21522 title = {Unified embedded parallel finite element computations via software-based 21523 Fr{\'e}chet differentiation}, 21524 author = {Kevin Long and Robert Kirby and Bart van Bloemen Waanders}, 21525 journal = {SIAM Journal on Scientific Computing}, 21526 volume = {32}, 21527 number = {6}, 21528 pages = {3323--3351}, 21529 year = {2010}, 21530 publisher = {SIAM} 21531} 21532 21533@Article{ kirby2010, 21534 title = {From functional analysis to iterative methods}, 21535 author = {Robert C Kirby}, 21536 journal = {SIAM review}, 21537 volume = {52}, 21538 number = {2}, 21539 pages = {269--293}, 21540 year = {2010}, 21541 publisher = {SIAM} 21542} 21543 21544@Article{ kirby2014, 21545 title = {Low-Complexity Finite Element Algorithms for the de Rham Complex on Simplices}, 21546 author = {Robert C Kirby}, 21547 journal = {SIAM Journal on Scientific Computing}, 21548 volume = {36}, 21549 number = {2}, 21550 pages = {A846--A868}, 21551 year = {2014}, 21552 publisher = {SIAM} 21553} 21554 21555@Article{ kirby2011, 21556 title = {Fast simplicial finite element algorithms using Bernstein polynomials}, 21557 author = {Robert C Kirby}, 21558 journal = {Numerische Mathematik}, 21559 volume = {117}, 21560 number = {4}, 21561 pages = {631--652}, 21562 year = {2011}, 21563 publisher = {Springer} 21564} 21565 21566@Article{ arnoldfalkwinther2006, 21567 title = {Finite element exterior calculus, homological techniques, and applications}, 21568 author = {Arnold, Douglas N and Falk, Richard S and Winther, Ragnar}, 21569 journal = {Acta numerica}, 21570 volume = {15}, 21571 pages = {1--155}, 21572 year = {2006}, 21573 publisher = {Cambridge Univ Press} 21574} 21575 21576@Article{ arnoldlogg2014, 21577 title = {Periodic table of the finite elements}, 21578 author = {Douglas Arnold and Anders Logg}, 21579 month = nov, 21580 journal = {SIAM News}, 21581 year = {2014} 21582} 21583 21584@Article{ janssonhoffmanjansson2012, 21585 title = {Framework for massively parallel adaptive finite element computational fluid 21586 dynamics on tetrahedral meshes}, 21587 author = {Jansson, Niclas and Hoffman, Johan and Jansson, Johan}, 21588 journal = {SIAM Journal on Scientific Computing}, 21589 volume = {34}, 21590 number = {1}, 21591 pages = {C24--C41}, 21592 year = {2012}, 21593 publisher = {SIAM} 21594} 21595 21596@Article{ rogneshamcottermcrae2013, 21597 title = {Automating the solution of PDEs on the sphere and other manifolds in FEniCS 1.2}, 21598 author = {Rognes, Marie E and Ham, David A and Cotter, Colin J and McRae, Andrew TT}, 21599 journal = {Geoscientific Model Development}, 21600 volume = {6}, 21601 number = {6}, 21602 pages = {2099--2119}, 21603 year = {2013}, 21604 publisher = {Copernicus GmbH} 21605} 21606 21607@Book{ loggmardalwells2012, 21608 title = {Automated solution of differential equations by the finite element method: The 21609 {FEniCS} book}, 21610 author = {Logg, Anders and Mardal, Kent-Andre and Wells, Garth}, 21611 volume = {84}, 21612 year = {2012}, 21613 publisher = {Springer Science \& Business Media} 21614} 21615 21616@Article{ cotterkirby2014, 21617 title = {Mixed finite elements for global tide models}, 21618 author = {Colin J Cotter and Robert C Kirby}, 21619 archiveprefix = {arXiv}, 21620 journal = {Submitted}, 21621 eprint = {1410.0045}, 21622 year = {2014}, 21623 url = {http://arxiv.org/abs/1410.0045} 21624} 21625 21626@Article{ kirbykieu2015, 21627 title = {Symplectic-mixed finite element approximation of linear acoustic wave equations}, 21628 author = {Robert C Kirby and Thinh Tri Kieu}, 21629 journal = {Numerische Mathematik}, 21630 volume = {130}, 21631 number = {2}, 21632 pages = {257--291}, 21633 year = {2015}, 21634 publisher = {Springer} 21635} 21636 21637@Article{ brennankirby2015, 21638 title = {Finite element approximation and preconditioners for a coupled thermo-acoustic 21639 model}, 21640 author = {Brian Brennan and Robert C Kirby}, 21641 journal = {Submitted to Computers and Mathematics with Applications}, 21642 year = {2015} 21643} 21644 21645@Article{ howlekirbydillon2013, 21646 title = {Block preconditioners for coupled physics problems}, 21647 author = {Victoria E Howle and Robert C Kirby and Geoffrey Dillon}, 21648 journal = {SIAM Journal on Scientific Computing}, 21649 volume = {35}, 21650 number = {5}, 21651 pages = {S368--S385}, 21652 year = {2013}, 21653 publisher = {SIAM} 21654} 21655 21656@Book{ malekstrakos2014, 21657 title = {Preconditioning and the conjugate gradient method in the context of solving 21658 PDEs}, 21659 author = {Josef M{\'a}lek and Zden\u{e}k Strako\u{s}}, 21660 volume = {1}, 21661 year = {2014}, 21662 publisher = {SIAM} 21663} 21664 21665@Article{ desturler1995, 21666 title = {Reducing the effect of global communication in GMRES(m) and \{CG\} on parallel 21667 distributed memory computers}, 21668 author = {E. de Sturler and H.A. van der Vorst}, 21669 journal = {Applied Numerical Mathematics}, 21670 volume = {18}, 21671 number = {4}, 21672 pages = {441--459}, 21673 year = {1995}, 21674 doi = {10.1016/0168-9274(95)00079-A} 21675} 21676 21677@Article{ velicmaymoresi2009, 21678 title = {A fast robust algorithm for computing discrete voronoi diagrams}, 21679 author = {Velic, Mirko and May, Dave and Moresi, Louis}, 21680 journal = {Journal of Mathematical Modelling and Algorithms}, 21681 volume = {8}, 21682 number = {3}, 21683 pages = {343--355}, 21684 year = {2009}, 21685 publisher = {Springer} 21686} 21687 21688@Article{ may2012, 21689 title = {Volume reconstruction of point cloud data sets derived from computational 21690 geodynamic simulations}, 21691 author = {May, DA}, 21692 journal = {Geochemistry, Geophysics, Geosystems}, 21693 volume = {13}, 21694 number = {5}, 21695 year = {2012}, 21696 publisher = {Wiley Online Library} 21697} 21698 21699@Article{ quenettehodkinson2010, 21700 title = {StgDomain--scalable parallel domain software components for particle-in-cell 21701 finite element methods}, 21702 author = {Quenette, Steve and Hodkinson, Luke}, 21703 journal = {Concurrency and Computation: Practice and Experience}, 21704 volume = {22}, 21705 number = {12}, 21706 pages = {1593--1603}, 21707 year = {2010}, 21708 publisher = {Wiley Online Library} 21709} 21710 21711@Book{ velic2005, 21712 title = {Gauge Invariant Integration and Perturbation of Petrov Type D Spacetimes}, 21713 author = {Velic, Mirko}, 21714 year = {2005}, 21715 publisher = {Monash University} 21716} 21717 21718@Article{ velicknepleymay2016, 21719 title = {Numerically Stable Exact Solutions for Variable-Viscosity Stokes Equations}, 21720 author = {Mirko Velic and Louis Moresi and Dave May and Matthew Knepley}, 21721 note = {in preparation}, 21722 year = {2016} 21723} 21724 21725@Article{ traubwozniakowski1979, 21726 title = {Convergence and complexity of Newton iteration for operator equations}, 21727 author = {Joseph Frederick Traub and H. Wo{\'z}niakowski}, 21728 journal = {Journal of the ACM (JACM)}, 21729 volume = {26}, 21730 number = {2}, 21731 pages = {250--258}, 21732 year = {1979}, 21733 publisher = {ACM} 21734} 21735 21736@Article{ sterck2013, 21737 title = {Steepest descent preconditioning for nonlinear {GMRES} optimization}, 21738 author = {Hans De Sterck}, 21739 journal = {Numerical Linear Algebra with Applications}, 21740 volume = {20}, 21741 number = {3}, 21742 pages = {453--471}, 21743 year = {2013} 21744} 21745 21746@Article{ sterckwinlaw2015, 21747 title = {A nonlinearly preconditioned conjugate gradient algorithm for {rank-R} canonical 21748 tensor approximation}, 21749 author = {Hans De Sterck and Manda Winlaw}, 21750 journal = {Numerical Linear Algebra with Applications}, 21751 volume = {22}, 21752 number = {3}, 21753 pages = {410--432}, 21754 year = {2015} 21755} 21756 21757@Article{ sterckhowse2015, 21758 title = {Nonlinearly preconditioned optimization on {Grassman} manifolds for computing 21759 approximate {Tucker} tensor decompositions}, 21760 author = {Hans De Sterck and Alexander Howse}, 21761 journal = {SIAM Journal on Scientific Computing}, 21762 note = {submitted}, 21763 year = {2015} 21764} 21765 21766@Book{ ladevezesimmonds1999, 21767 title = {Nonlinear computational structural mechanics: {N}ew approaches and 21768 non-incremental methods of calculation}, 21769 author = {P. Ladev{\`e}ze and J.G. Simmonds}, 21770 series = {{M}echanical {E}ngineering {S}eries}, 21771 url = {http://books.google.com/books?id=McZRAAAAMAAJ}, 21772 isbn = {9780387985947}, 21773 lccn = {98029990}, 21774 year = {1999}, 21775 publisher = {Springer} 21776} 21777 21778@InProceedings{ walkerwoodwardyang2010, 21779 title = {An accelerated fixed-point iteration for solution of variably saturated flow}, 21780 author = {Homer F Walker and Carol S Woodward and Ulrike M Yang}, 21781 booktitle = {Proc. XVIII International Conference on Water Resources, Barcelona}, 21782 year = {2010} 21783} 21784 21785@Article{ lottwalkerwoodwardyang2012, 21786 title = {An accelerated {P}icard method for nonlinear systems related to variably 21787 saturated flow}, 21788 author = {P. A. Lott and H. F. Walker and C. S. Woodward and U. M. Yang}, 21789 journal = {Advances in Water Resources}, 21790 volume = {38}, 21791 number = {0}, 21792 pages = {92--101}, 21793 doi = {10.1016/j.advwatres.2011.12.013}, 21794 year = {2012} 21795} 21796 21797@TechReport{ mohrrude1998, 21798 title = {Communication Reduced Parallel Multigrid: Analysis and Experiments}, 21799 author = {Marcus Mohr and Ulrich R\"ude}, 21800 type = {Technical Report}, 21801 number = {394}, 21802 institution = {University of Augsburg}, 21803 year = {1998} 21804} 21805 21806@InProceedings{ mohr2000, 21807 title = {Low Communication Parallel Multigrid}, 21808 author = {Mohr, Marcus}, 21809 booktitle = {Euro-Par 2000 Parallel Processing}, 21810 pages = {806--814}, 21811 year = {2000}, 21812 organization = {Springer} 21813} 21814 21815@Article{ brandtdiskin1994, 21816 title = {Multigrid solvers on decomposed domains}, 21817 author = {Achi Brandt and Boris Diskin}, 21818 journal = {Contemporary Mathematics}, 21819 volume = {157}, 21820 year = {1994}, 21821 publisher = {AMERICAN MATHEMATICAL SOCIETY} 21822} 21823 21824@InProceedings{ prabhuetal2011, 21825 title = {A Survey of the Practice of Computational Science}, 21826 author = {Prabhu, Prakash and Jablin, Thomas B. and Raman, Arun and Zhang, Yun and Huang, 21827 Jialu and Kim, Hanjun and Johnson, Nick P. and Liu, Feng and Ghosh, Soumyadeep and 21828 Beard, Stephen and Oh, Taewook and Zoufaly, Matthew and Walker, David and August, 21829 David I.}, 21830 booktitle = {State of the Practice Reports}, 21831 series = {SC '11}, 21832 year = {2011}, 21833 isbn = {978-1-4503-1139-7}, 21834 location = {Seattle, Washington}, 21835 pages = {19:1--19:12}, 21836 articleno = {19}, 21837 numpages = {12}, 21838 doi = {10.1145/2063348.2063374}, 21839 acmid = {2063374}, 21840 publisher = {ACM}, 21841 address = {New York, NY, USA} 21842} 21843 21844@PhDThesis{ dinarthesis1979, 21845 title = {Fast methods for the numerical solution of boundary value problems}, 21846 author = {N. Dinar}, 21847 school = {Weizmann Institute of Science}, 21848 year = {1979} 21849} 21850 21851@Article{ thomasdiskinbrandt2001, 21852 title = {Textbook multigrid efficiency for the incompressible Navier--Stokes equations: 21853 high Reynolds number wakes and boundary layers}, 21854 author = {James L Thomas and Boris Diskin and Achi Brandt}, 21855 journal = {Computers \& fluids}, 21856 volume = {30}, 21857 number = {7}, 21858 pages = {853--874}, 21859 year = {2001}, 21860 publisher = {Elsevier} 21861} 21862 21863@Article{ greenbaumptakstrakos1996, 21864 title = {Any nonincreasing convergence curve is possible for {GMRES}}, 21865 author = {Anne Greenbaum and Vlastimil Pt{\'a}k and Zden{\v{e}}k Strako{\v{s}}}, 21866 journal = {SIAM Journal on Matrix Analysis and Applications}, 21867 volume = {17}, 21868 number = {3}, 21869 pages = {465--469}, 21870 year = {1996}, 21871 publisher = {SIAM} 21872} 21873 21874@Article{ nangiapatankarbhalla2019, 21875 title = {A {DLM} immersed boundary method based wave-structure interaction solver for high 21876 density ratio multiphase flows}, 21877 author = {Nishant Nangia and Neelesh A Patankar and Amneet Pal Singh Bhalla}, 21878 journal = {Journal of Computational Physics}, 21879 volume = {398}, 21880 pages = {108804}, 21881 year = {2019} 21882} 21883 21884@Article{ bhallanangiadafnakisbraccomattiazzo2019, 21885 title = {Simulating water-entry/exit problems using {Eulerian}-{Lagrangian} and 21886 fully-{Eulerian} fictitious domain methods within the open-source {IBAMR} 21887 library}, 21888 author = {Amneet Pal Singh Bhalla and Nishant Nangia and Panagiotis Dafnakis and Giovanni 21889 Bracco and Giuliana Mattiazzo}, 21890 journal = {Applied Ocean Research}, 21891 note = {In press}, 21892 year = {2019} 21893} 21894 21895@Article{ bhallagriffithpatankardonev2013, 21896 title = {A minimally-resolved immersed boundary model for reaction-diffusion problems}, 21897 author = {Amneet Pal Singh Bhalla and Boyce E. Griffith and Neelesh A. Patankar and 21898 Alexander Donev}, 21899 journal = {Journal of Chemical Physics}, 21900 volume = {139}, 21901 number = {21}, 21902 pages = {214112}, 21903 year = {2013} 21904} 21905 21906@Article{ bhallabalegriffithpatankar2014, 21907 title = {Fully resolved immersed electrohydrodynamics for particle motion, 21908 electrolocation, and self-propulsion}, 21909 author = {Amneet Pal Singh Bhalla and R. Bale and Boyce E. Griffith and Neelesh A. 21910 Patankar}, 21911 journal = {Journal of Computational Physics}, 21912 volume = {256}, 21913 pages = {88--108}, 21914 year = {2014} 21915} 21916 21917@Article{ usabiagakallemovdelmottebhallagriffithdonev2016, 21918 title = {Hydrodynamics of suspensions of passive and active rigid particles: a rigid 21919 multiblob approach}, 21920 author = {F. Balboa Usabiaga and B. Kallemov and B. Delmotte and Amneet Pal Singh Bhalla 21921 and Boyce E. Griffith and Alexander Donev}, 21922 journal = {Communications in Applied Mathematics and Computational Science}, 21923 volume = {11}, 21924 number = {2}, 21925 pages = {217--296}, 21926 year = {2016} 21927} 21928 21929@Article{ koubhallagriffithpandolfinokahrilaspatankar2015, 21930 title = {A fully resolved active musculo-mechanical model for esophageal transport}, 21931 author = {W. Kou and Amneet Pal Singh Bhalla and Boyce E. Griffith and J.E. Pandolfino and 21932 P.J. Kahrilas and Neelesh A. Patankar}, 21933 journal = {Journal of Computational Physics}, 21934 volume = {298}, 21935 pages = {446--465}, 21936 year = {2015} 21937} 21938 21939@Article{ balenevelnbhallamaciverpatankar2015, 21940 title = {Convergent evolution of mechanically optimal locomotion in aquatic invertebrates 21941 and vertebrates}, 21942 author = {R. Bale and I. D. Neveln and Amneet Pal Singh Bhalla and M.A. MacIver and Neelesh 21943 A. Patankar}, 21944 journal = {PLoS Biology}, 21945 volume = {13}, 21946 number = {4}, 21947 pages = {1--22}, 21948 year = {2015} 21949} 21950 21951@Article{ balehaobhallapatankar2014, 21952 title = {Energy efficiency and allometry of movement of swimming and flying animals}, 21953 author = {Rahul Bale and Max Hao and Amneet Pal Singh Bhalla and Neelesh A Patankar}, 21954 journal = {Proceedings of the National Academy of Sciences}, 21955 volume = {111}, 21956 number = {21}, 21957 pages = {7517--7521}, 21958 year = {2014} 21959} 21960 21961@Article{ bhallabalegriffithpatankar2013, 21962 title = {A unified mathematical framework and an adaptive numerical method for 21963 fluid--structure interaction with rigid, deforming, and elastic bodies}, 21964 author = {Amneet Pal Singh Bhalla and Rahul Bale and Boyce E Griffith and Neelesh A 21965 Patankar}, 21966 journal = {Journal of Computational Physics}, 21967 volume = {250}, 21968 pages = {446--476}, 21969 year = {2013}, 21970 publisher = {Elsevier} 21971} 21972 21973@Article{ takeikatz2013, 21974 title = {Consequences of viscous anisotropy in a deforming, two-phase aggregate. Part 1. 21975 Governing equations and linearized analysis}, 21976 author = {Yasuko Takei and Richard F. Katz}, 21977 journal = {Journal of Fluid Mechanics}, 21978 volume = {734}, 21979 issn = {1469-7645}, 21980 pages = {424--455}, 21981 numpages = {32}, 21982 doi = {10.1017/jfm.2013.482}, 21983 month = nov, 21984 year = {2013} 21985} 21986 21987@Misc{ stewart2011, 21988 title = {Fredholm, Hilbert, Schmidt: Three Fundamental Papers on Integral Equations}, 21989 author = {G. W. Stewart}, 21990 note = {Translated with commentary by G. W. Stewart}, 21991 url = {http://www.cs.umd.edu/~stewart/FHS.pdf}, 21992 year = {2011} 21993} 21994 21995@Article{ douglisnirenberg1955, 21996 title = {nterior Estimates for Elliptic Systems of Partial Differential Equations}, 21997 author = {Avron Douglis and Louis Nirenberg}, 21998 journal = {Communications on Pure and Applied Mathematics}, 21999 volume = {8}, 22000 pages = {503--538}, 22001 year = {1955} 22002} 22003 22004@Article{ gorelickgalunsharonbasribrandt2006, 22005 title = {Shape Representation and Classification Using the Poisson Equation}, 22006 author = {Lena Gorelick and Meirav Galun and Eitan Sharon and Ronen Basri and Achi Brandt}, 22007 journal = {IEEE Transactions on Pattern Analysis and Machine Intelligence}, 22008 volume = {28}, 22009 number = {12}, 22010 pages = {1991--2005}, 22011 year = {2006} 22012} 22013 22014@Article{ salsbury2006, 22015 title = {Analysis of errors in {Still's} equation for macromolecular electrostatic 22016 solvation energies}, 22017 author = {Freddie R. Salsbury Jr.}, 22018 journal = {Molecular Physics}, 22019 volume = {104}, 22020 number = {08}, 22021 pages = {1299--1309}, 22022 year = {2006} 22023} 22024 22025@Article{ sigalov2006, 22026 title = {Analytical electrostatics for biomolecules: {Beyond} the generalized {Born} 22027 approximation}, 22028 author = {G. Sigalov and A. Fenley and A. Onufriev}, 22029 journal = {Journal of Chemical Physics}, 22030 volume = {124}, 22031 number = {124902}, 22032 year = {2006} 22033} 22034 22035@Article{ dennard1974, 22036 title = {Design of ion-implanted {MOSFET's} with very small physical dimensions}, 22037 author = {Robert H Dennard and Fritz H Gaensslen and V Leo Rideout and Ernest Bassous and 22038 Andre R LeBlanc}, 22039 journal = {IEEE Journal of Solid-State Circuits}, 22040 volume = {9}, 22041 number = {5}, 22042 pages = {256--268}, 22043 year = {1974} 22044} 22045 22046@Article{ zeegeijn2015, 22047 author = {Field G. {V}an~{Z}ee and Robert A. {v}an~{d}e~{G}eijn}, 22048 title = {{BLIS}: A Framework for Rapidly Instantiating {BLAS} Functionality}, 22049 journal = {ACM Transactions on Mathematical Software}, 22050 volume = {41}, 22051 number = {3}, 22052 pages = {14:1--14:33}, 22053 month = jun, 22054 year = {2015}, 22055 issue_date = {jun}, 22056 doi = {10.1145/2764454} 22057} 22058 22059@Article{ campbell1976, 22060 title = {Assessing the Impact of Planned Social Change}, 22061 author = {Donald T. Campbell}, 22062 journal = {Occasional Paper Series, The Public Affairs Center}, 22063 number = {8}, 22064 publisher = {Dartmouth College}, 22065 year = {1976} 22066} 22067 22068@Article{ smaldinomcelreath2016, 22069 title = {The natural selection of bad science}, 22070 author = {Paul E. Smaldino and Richard McElreath}, 22071 journal = {Royal Society Open Science}, 22072 volume = {3}, 22073 number = {9}, 22074 url = {http://rsos.royalsocietypublishing.org/content/3/9/160384}, 22075 eprint = {http://rsos.royalsocietypublishing.org/content/3/9/160384.full.pdf}, 22076 doi = {10.1098/rsos.160384}, 22077 year = {2016}, 22078 publisher = {The Royal Society} 22079} 22080 22081@Article{ harlowwelch1965, 22082 title = {Numerical calculation of time-dependent viscous incompressible flow of fluid with 22083 free surface}, 22084 author = {Francis H Harlow and J Eddie Welch}, 22085 journal = {Physics of fluids}, 22086 volume = {8}, 22087 number = {12}, 22088 pages = {2182--2189}, 22089 url = {http://www.cs.rpi.edu/~cutler/classes/advancedgraphics/S12/papers/harlow_welch.pdf}, 22090 year = {1965} 22091} 22092 22093@Article{ diskinthomasmineck2005, 22094 title = {{On Quantitative Analysis Methods for Multigrid Solutions}}, 22095 author = {Boris Diskin and James L. Thomas and Raymond E. Mineck}, 22096 journal = {SIAM Journal on Scientific Computing}, 22097 volume = {27}, 22098 number = {1}, 22099 pages = {108--129}, 22100 doi = {10.1137/030601521}, 22101 issn = {1064-8275}, 22102 year = {2005} 22103} 22104 22105@TechReport{ scott2012, 22106 title = {Fostering Interactions Between the Geosciences and Mathematics, Statistics, and 22107 Computer Science}, 22108 author = {L. Ridgway Scott and Jed Brown and George W. Bergantz and Dan Cooley and Clint 22109 Dawson and Maarten de Hoop and Donald Estep and Natasha Flyer and Efi 22110 Foufoula-Georgiou and Michael Ghil and Matthew G. Knepley and Randall J. LeVeque 22111 and Lek-Heng Lim and Serge Prudhomme and Adrian Sandu and Frederik J. Simons and 22112 Philip B. Stark and Michael Stein and Seth Stein and Toshiro Tanimoto and Daniel 22113 Tartakovsky and Jonathan Weare and Robert Weiss and Grady B. Wright and Dave 22114 Yuen}, 22115 institution = {University of Chicago}, 22116 number = {2012-02}, 22117 url = {http://cs.uchicago.edu/files/tr_authentic/TR-2012-02.pdf}, 22118 year = {2012} 22119} 22120 22121@Article{ roth2010, 22122 title = {Fundamental measure theory for hard-sphere mixtures: a review}, 22123 author = {Roland Roth}, 22124 journal = {J. Phys. Cond. Mat.}, 22125 volume = {22}, 22126 pages = {063102}, 22127 year = {2010} 22128} 22129 22130@Article{ wu2008, 22131 title = {Density functional theory for liquid structure and thermodynamics}, 22132 author = {J. Z. Wu}, 22133 journal = {Struct. Bond.}, 22134 doi = {10.1007/430_2008_3}, 22135 year = {2008} 22136} 22137 22138@Article{ goel2008, 22139 title = {Molecular solvent model of cylindrical electric double layers: a systematic study 22140 by {Monte Carlo} simulations and density functional theory}, 22141 author = {T. Goel and C. N. Patra and S. K. Ghosh and T. Mukherjee}, 22142 journal = {J. Chem. Phys.}, 22143 volume = {129}, 22144 pages = {154707}, 22145 year = {2008} 22146} 22147 22148@Article{ marchxiaoyubiros2015, 22149 title = {{ASKIT:} An efficient, parallel library for high-dimensional kernel summations}, 22150 author = {William B March and Bo Xiao and Chenhan D Yu and George Biros}, 22151 journal = {SIAM Journal on Scientific Computing (to appear)}, 22152 year = {2015} 22153} 22154 22155@InProceedings{ yangduraiswamigumerovdavis2003, 22156 title = {Improved fast gauss transform and efficient kernel density estimation}, 22157 author = {Changjiang Yang and Ramani Duraiswami and Nail A Gumerov and Larry Davis}, 22158 booktitle = {Proceedings of the Ninth IEEE International Conference on Computer Vision}, 22159 pages = {664--671}, 22160 year = {2003}, 22161 organization = {IEEE} 22162} 22163 22164@Article{ fornberglarssonflyer2011, 22165 title = {Stable computations with Gaussian radial basis functions}, 22166 author = {Bengt Fornberg and Elisabeth Larsson and Natasha Flyer}, 22167 journal = {SIAM Journal on Scientific Computing}, 22168 volume = {33}, 22169 number = {2}, 22170 pages = {869--892}, 22171 year = {2011}, 22172 publisher = {SIAM} 22173} 22174 22175@InProceedings{ srinivasanqiduraiswami2010, 22176 title = {GPUML: Graphical processors for speeding up kernel machines}, 22177 author = {Balaji Vasan Srinivasan and H Qi and Ramani Duraiswami}, 22178 booktitle = {SIAM Conf. on Data Mining. Workshop on High Performance Analytics-Algorithms, 22179 Implementations, and Applications}, 22180 year = {2010} 22181} 22182 22183@Article{ jadamecbillen2010, 22184 title = {Reconciling surface plate motions with rapid three-dimensional mantle flow around 22185 a slab edge}, 22186 author = {Margarete A Jadamec and Magali I Billen}, 22187 journal = {Nature}, 22188 volume = {465}, 22189 number = {7296}, 22190 pages = {338--341}, 22191 year = {2010} 22192} 22193 22194@Article{ jadamecbillen2012, 22195 title = {The role of rheology and slab shape on rapid mantle flow: Three-dimensional 22196 numerical models of the Alaska slab edge}, 22197 author = {Margarete A Jadamec and Magali I Billen}, 22198 journal = {Journal of Geophysical Research: Solid Earth}, 22199 volume = {117}, 22200 number = {B2}, 22201 year = {2012} 22202} 22203 22204@Article{ jadamec2015, 22205 title = {Slab-driven Mantle Weakening and Rapid Mantle Flow}, 22206 author = {Margarete A Jadamec}, 22207 journal = {Subduction Dynamics: From Mantle Flow to Mega Disasters}, 22208 volume = {211}, 22209 pages = {135}, 22210 year = {2015} 22211} 22212 22213@Article{ durancejadamecfalloonnicholls2012, 22214 title = {Magmagenesis within the {H}unter {R}idge {R}ift {Z}one resolved from 22215 olivine-hosted melt inclusions and geochemical modelling with insights from 22216 geodynamic models}, 22217 author = {Patricia MJ Durance and Margarete A Jadamec and TJ Falloon and IA Nicholls}, 22218 journal = {Australian Journal of Earth Sciences}, 22219 volume = {59}, 22220 number = {6}, 22221 pages = {913--931}, 22222 year = {2012} 22223} 22224 22225@Article{ sharplesmoresijadamecrevote2015, 22226 title = {Styles of rifting and fault spacing in numerical models of crustal extension}, 22227 author = {Wendy Sharples and Louis N Moresi and Margarete A Jadamec and Jerico Revote}, 22228 journal = {Journal of Geophysical Research: Solid Earth}, 22229 volume = {120}, 22230 number = {6}, 22231 pages = {4379--4404}, 22232 year = {2015} 22233} 22234 22235@Article{ hayniejadamec2017, 22236 title = {Tectonic drivers of the {Wrangell}-block forearc sliver: Insights from 3D 22237 geodynamic models}, 22238 author = {Kirstie L Haynie and Margarete A Jadamec}, 22239 journal = {Tectonics}, 22240 note = {in review}, 22241 year = {2017} 22242} 22243 22244@Article{ cammaranoromanowiczstixrudelithgowbertellonixu2009, 22245 title = {Inferring the thermochemical structure of the upper mantle from seismic data}, 22246 author = {Fabio Cammarano and Barbara Romanowicz and Lars Stixrude and Carolina 22247 Lithgow-Bertelloni and Wenbo Xu}, 22248 journal = {Geophysical Journal International}, 22249 volume = {179}, 22250 number = {2}, 22251 pages = {1169--1185}, 22252 year = {2009} 22253} 22254 22255@Article{ zhong2006, 22256 title = {Constraints on thermochemical convection of the mantle from plume heat flux, 22257 plume excess temperature, and upper mantle temperature}, 22258 author = {Shijie Zhong}, 22259 journal = {Journal of Geophysical Research: Solid Earth}, 22260 volume = {111}, 22261 number = {B4}, 22262 year = {2006} 22263} 22264 22265@Article{ billenhirth2007, 22266 title = {Rheologic controls on slab dynamics}, 22267 author = {Magali I Billen and Greg Hirth}, 22268 journal = {Geochemistry, Geophysics, Geosystems}, 22269 volume = {8}, 22270 number = {8}, 22271 year = {2007} 22272} 22273 22274@Article{ hirthkohlstedt2003, 22275 title = {Rheology of the upper mantle and the mantle wedge: A view from the 22276 experimentalists}, 22277 author = {Greg Hirth and David Kohlstedt}, 22278 journal = {Inside the subduction Factory}, 22279 pages = {83--105}, 22280 year = {2003} 22281} 22282 22283@Article{ longsilver2008, 22284 title = {The subduction zone flow field from seismic anisotropy: A global view}, 22285 author = {Maureen D Long and Paul G Silver}, 22286 journal = {science}, 22287 volume = {319}, 22288 number = {5861}, 22289 pages = {315--318}, 22290 year = {2008} 22291} 22292 22293@Article{ karatowu1993, 22294 title = {Rheology of the upper mantle: A synthesis}, 22295 author = {Shun-ichiro Karato and Patrick Wu}, 22296 journal = {Science}, 22297 volume = {260}, 22298 number = {5109}, 22299 pages = {771--778}, 22300 year = {1993} 22301} 22302 22303@Article{ long2013mantle, 22304 title = {Mantle flow in subduction systems: The mantle wedge flow field and implications 22305 for wedge processes}, 22306 author = {Long, Maureen D and Wirth, Erin A}, 22307 journal = {Journal of Geophysical Research: Solid Earth}, 22308 volume = {118}, 22309 number = {2}, 22310 pages = {583--606}, 22311 year = {2013}, 22312 publisher = {Wiley Online Library} 22313} 22314 22315@Article{ hoernle2008arc, 22316 title = {Arc-parallel flow in the mantle wedge beneath Costa Rica and Nicaragua}, 22317 author = {Hoernle, Kaj and Abt, David L and Fischer, Karen M and Nichols, Holly and Hauff, 22318 Folkmar and Abers, Geoffrey A and van den Bogaard, Paul and Heydolph, Ken and 22319 Alvarado, Guillermo and Protti, Marino and others}, 22320 journal = {Nature}, 22321 volume = {451}, 22322 number = {7182}, 22323 pages = {1094--1097}, 22324 year = {2008}, 22325 publisher = {Nature Publishing Group} 22326} 22327 22328@Article{ savage1999, 22329 title = {Seismic anisotropy and mantle deformation: what have we learned from shear wave 22330 splitting?}, 22331 author = {MK Savage}, 22332 journal = {Reviews of Geophysics}, 22333 volume = {37}, 22334 number = {1}, 22335 pages = {65--106}, 22336 year = {1999} 22337} 22338 22339@InProceedings{ akcelikbirosdraganescuhillghattaswaanders2005, 22340 title = {Dynamic data-driven inversion for terascale simulations: Real-time identification 22341 of airborne contaminants}, 22342 author = {Volkan Ak{\c{c}}elik and George Biros and Andrei Draganescu and Judith Hill and 22343 Omar Ghattas and Bart Van Bloemen Waanders}, 22344 booktitle = {Proceedings of the 2005 ACM/IEEE conference on Supercomputing}, 22345 pages = {43}, 22346 year = {2005}, 22347 organization = {IEEE Computer Society} 22348} 22349 22350@Article{ draganescusoane2013, 22351 title = {Multigrid solution of a distributed optimal control problem constrained by the 22352 {Stokes} equations}, 22353 author = {Andrei Dr{\u{a}}g{\u{a}}nescu and Ana Maria Soane}, 22354 journal = {Applied Mathematics and Computation}, 22355 volume = {219}, 22356 number = {10}, 22357 pages = {5622--5634}, 22358 year = {2013} 22359} 22360 22361@Article{ zhonggurnis1995, 22362 title = {Mantle convection with plates and mobile, faulted plate margins}, 22363 author = {Shijie Zhong and Michael Gurnis}, 22364 journal = {Science}, 22365 volume = {267}, 22366 number = {5199}, 22367 pages = {838}, 22368 year = {1995} 22369} 22370 22371@Article{ studerbobinchahidmousavicandesdahan2012, 22372 title = {Compressive fluorescence microscopy for biological and hyperspectral imaging}, 22373 author = {Vincent Studer and J{\'e}rome Bobin and Makhlad Chahid and Hamed Shams Mousavi 22374 and Emmanuel Candes and Maxime Dahan}, 22375 journal = {Proceedings of the National Academy of Sciences}, 22376 volume = {109}, 22377 number = {26}, 22378 pages = {E1679--E1687}, 22379 year = {2012} 22380} 22381 22382@Article{ borsukhigdonstowreckhow2001, 22383 title = {A {Bayesian} hierarchical model to predict benthic oxygen demand from organic 22384 matter loading in estuaries and coastal zones}, 22385 author = {Mark E Borsuk and David Higdon and Craig A Stow and Kenneth H Reckhow}, 22386 journal = {Ecological Modelling}, 22387 volume = {143}, 22388 number = {3}, 22389 pages = {165--181}, 22390 year = {2001} 22391} 22392 22393@Article{ liebermanwillcox2012, 22394 title = {Goal-oriented inference: Approach, linear theory, and application to advection 22395 diffusion}, 22396 author = {Chad Lieberman and Karen Willcox}, 22397 journal = {SIAM Journal on Scientific Computing}, 22398 volume = {34}, 22399 number = {4}, 22400 pages = {A1880--A1904}, 22401 year = {2012} 22402} 22403 22404@Article{ chaillatbiros2012, 22405 title = {{FaIMS}: A fast algorithm for the inverse medium problem with multiple 22406 frequencies and multiple sources for the scalar {Helmholtz} equation}, 22407 author = {St{\'e}phanie Chaillat and George Biros}, 22408 journal = {Journal of Computational Physics}, 22409 volume = {231}, 22410 number = {12}, 22411 pages = {4403--4421}, 22412 year = {2012} 22413} 22414 22415@Article{ farhattezaurdjellouli2002, 22416 title = {On the solution of three-dimensional inverse obstacle acoustic scattering 22417 problems by a regularized {Newton} method}, 22418 author = {Charbel Farhat and Radek Tezaur and Rabia Djellouli}, 22419 journal = {Inverse problems}, 22420 volume = {18}, 22421 number = {5}, 22422 pages = {1229}, 22423 year = {2002} 22424} 22425 22426@Article{ orozcoghattas1992, 22427 title = {Massively parallel aerodynamic shape optimization}, 22428 author = {Orozco, Carlos E and Ghattas, ON}, 22429 journal = {Computing Systems in Engineering}, 22430 volume = {3}, 22431 number = {1-4}, 22432 pages = {311--320}, 22433 year = {1992} 22434} 22435 22436@Article{ reutheralonsorimlingerjameson1999, 22437 title = {Aerodynamic shape optimization of supersonic aircraft configurations via an 22438 adjoint formulation on distributed memory parallel computers}, 22439 author = {James Reuther and Juan Jose Alonso and Mark J Rimlinger and Antony Jameson}, 22440 journal = {Computers \& fluids}, 22441 volume = {28}, 22442 number = {4}, 22443 pages = {675--700}, 22444 year = {1999} 22445} 22446 22447@Article{ rudistadlerghattas2016, 22448 title = {Weighted {BFBT} Preconditioner for {Stokes} Flow Problems with Highly 22449 Heterogeneous Viscosity}, 22450 author = {Johan Rudi and Georg Stadler and Omar Ghattas}, 22451 journal = {ArXiv e-prints}, 22452 archiveprefix = {arXiv}, 22453 primaryclass = {math.NA}, 22454 eprint = {1607.03936}, 22455 month = jul, 22456 year = {2016} 22457} 22458 22459@Article{ borzikunisch2006, 22460 title = {A globalization strategy for the multigrid solution of elliptic optimal control 22461 problems}, 22462 author = {Borzi, A and Kunisch, K}, 22463 journal = {Optimisation Methods and Software}, 22464 volume = {21}, 22465 number = {3}, 22466 pages = {445--459}, 22467 year = {2006} 22468} 22469 22470@Article{ nash2000, 22471 title = {A multigrid approach to discretized optimization problems}, 22472 author = {Stephen G Nash}, 22473 journal = {Optimization Methods and Software}, 22474 volume = {14}, 22475 number = {1-2}, 22476 pages = {99--116}, 22477 year = {2000} 22478} 22479 22480@Article{ jameson1983, 22481 title = {Solution of the Euler equations for two dimensional transonic flow by a multigrid 22482 method}, 22483 author = {Antony Jameson}, 22484 journal = {Applied mathematics and computation}, 22485 volume = {13}, 22486 number = {3-4}, 22487 pages = {327--355}, 22488 year = {1983} 22489} 22490 22491@Article{ billen2008, 22492 title = {Modeling the dynamics of subducting slabs}, 22493 author = {Magali I Billen}, 22494 journal = {Annu. Rev. Earth Planet. Sci.}, 22495 volume = {36}, 22496 pages = {325--356}, 22497 year = {2008} 22498} 22499 22500@Article{ gerya2011, 22501 title = {Future directions in subduction modeling}, 22502 author = {Taras Gerya}, 22503 journal = {Journal of Geodynamics}, 22504 volume = {52}, 22505 number = {5}, 22506 pages = {344--378}, 22507 year = {2011} 22508} 22509 22510@Article{ tackley2000, 22511 title = {Mantle convection and plate tectonics: Toward an integrated physical and chemical 22512 theory}, 22513 author = {Paul J Tackley}, 22514 journal = {Science}, 22515 volume = {288}, 22516 number = {5473}, 22517 pages = {2002--2007}, 22518 year = {2000} 22519} 22520 22521@Article{ caseydewey1984, 22522 title = {Initiation of subduction zones along transform and accreting plate boundaries, 22523 triple-junction evolution, and forearc spreading centres—implications for 22524 ophiolitic geology and obduction}, 22525 author = {JF Casey and JF Dewey}, 22526 journal = {Geological Society, London, Special Publications}, 22527 volume = {13}, 22528 number = {1}, 22529 pages = {269--290}, 22530 year = {1984} 22531} 22532 22533@Article{ doughertyclayton2014, 22534 title = {Seismicity and structure in central {Mexico}: Evidence for a possible slab tear 22535 in the {South Cocos} plate}, 22536 author = {Sara L Dougherty and Robert W Clayton}, 22537 journal = {Journal of Geophysical Research: Solid Earth}, 22538 volume = {119}, 22539 number = {4}, 22540 pages = {3424--3447}, 22541 year = {2014} 22542} 22543 22544@Article{ syracusemaceiraprietozhangammon2016, 22545 title = {Multiple plates subducting beneath Colombia, as illuminated by seismicity and 22546 velocity from the joint inversion of seismic and gravity data}, 22547 author = {Ellen M Syracuse and Monica Maceira and German A Prieto and Haijiang Zhang and 22548 Charles J Ammon}, 22549 journal = {Earth and Planetary Science Letters}, 22550 volume = {444}, 22551 pages = {139--149}, 22552 year = {2016} 22553} 22554 22555@Article{ bowergurnisflament2015, 22556 title = {Assimilating lithosphere and slab history in 4-D Earth models}, 22557 author = {Dan J Bower and Michael Gurnis and Nicolas Flament}, 22558 journal = {Physics of the Earth and Planetary Interiors}, 22559 volume = {238}, 22560 pages = {8--22}, 22561 year = {2015} 22562} 22563 22564@Book{ ciarlet1976, 22565 title = {Numerical analysis of the finite element method}, 22566 author = {Philippe G Ciarlet}, 22567 volume = {59}, 22568 year = {1976}, 22569 publisher = {Presses de l'Universit{\'e} de Montr{\'e}al} 22570} 22571 22572@InProceedings{ liumellorcrummey2013, 22573 title = {A data-centric profiler for parallel programs}, 22574 author = {Xu Liu and John Mellor-Crummey}, 22575 booktitle = {2013 SC-International Conference for High Performance Computing, Networking, 22576 Storage and Analysis (SC)}, 22577 pages = {1--12}, 22578 year = {2013}, 22579 organization = {IEEE} 22580} 22581 22582@InCollection{ ernstgander2012, 22583 title = {Why it is difficult to solve Helmholtz problems with classical iterative 22584 methods}, 22585 author = {Oliver G Ernst and Martin J Gander}, 22586 booktitle = {Numerical analysis of multiscale problems}, 22587 pages = {325--363}, 22588 url = {http://www.mathe.tu-freiberg.de/~ernst/PubArchive/helmholtzDurham.pdf}, 22589 year = {2012} 22590} 22591 22592@Article{ warburtonkarniadakis1999, 22593 title = {A discontinuous {G}alerkin method for the viscous {MHD} equations}, 22594 author = {Timothy C Warburton and George E Karniadakis}, 22595 journal = {Journal of Computational Physics}, 22596 volume = {152}, 22597 number = {2}, 22598 pages = {608--641}, 22599 year = {1999} 22600} 22601 22602@Article{ salahsoulaimanihabashi2001, 22603 title = {A finite element method for magnetohydrodynamics}, 22604 author = {Nizar Ben Salah and Azzeddine Soulaimani and Wagdi G Habashi}, 22605 journal = {Computer Methods in Applied Mechanics and Engineering}, 22606 volume = {43}, 22607 number = {190}, 22608 pages = {5867--5892}, 22609 year = {2001} 22610} 22611 22612@Article{ nesliturktezersezgin2005, 22613 title = {The finite element method for {MHD} flow at high {Hartmann} numbers}, 22614 author = {Ali I Nesliturk and M Tezer-Sezgin}, 22615 journal = {Computer methods in applied mechanics and engineering}, 22616 volume = {194}, 22617 number = {9}, 22618 pages = {1201--1224}, 22619 year = {2005} 22620} 22621 22622@Article{ strakschellart2016, 22623 title = {Control of Slab Width on Subduction-Induced Upper Mantle Flow and Associated 22624 Upwellings: Insights from Analog Models}, 22625 author = {Vincent Strak and Wouter P Schellart}, 22626 journal = {Journal of Geophysical Research: Solid Earth}, 22627 year = {2016} 22628} 22629 22630@InBook{ kirbyloggrognesterrel2012, 22631 title = {Common and unusual finite elements}, 22632 author = {Robert C. Kirby and Anders Logg and Marie E. Rognes and Andy R. Terrel}, 22633 editor = {Anders Logg and Kent-Andre Mardal and Garth Wells}, 22634 booktitle = {Automated Solution of Differential Equations by the Finite Element Method: The 22635 {FEniCS} Book}, 22636 publisher = {Springer Berlin Heidelberg}, 22637 address = {Berlin, Heidelberg}, 22638 pages = {95--119}, 22639 isbn = {978-3-642-23099-8}, 22640 doi = {10.1007/978-3-642-23099-8_3}, 22641 year = {2012} 22642} 22643 22644@InBook{ kirbymardal2012, 22645 author = {Robert C. Kirby and Kent-Andre Mardal}, 22646 title = {Constructing general reference finite elements}, 22647 editor = {Anders Logg and Kent-Andre Mardal and Garth Wells}, 22648 booktitle = {Automated Solution of Differential Equations by the Finite Element Method: The 22649 {FEniCS} Book}, 22650 publisher = {Springer Berlin Heidelberg}, 22651 address = {Berlin, Heidelberg}, 22652 pages = {121--132}, 22653 isbn = {978-3-642-23099-8}, 22654 doi = {10.1007/978-3-642-23099-8_4}, 22655 year = {2012} 22656} 22657 22658@Book{ wriggers2008, 22659 title = {Nonlinear finite element methods}, 22660 author = {Peter Wriggers}, 22661 publisher = {Springer Science \& Business Media}, 22662 year = {2008} 22663} 22664 22665@Book{ zienkiewicztaylor1977, 22666 title = {The finite element method}, 22667 author = {Zienkiewicz, Olgierd Cecil and Taylor, Robert Leroy and Taylor, Robert Lee}, 22668 publisher = {McGraw-hill London}, 22669 volume = {3}, 22670 year = {1977} 22671} 22672 22673@Article{ rogneskirbylogg2009, 22674 title = {Efficient assembly of {H(div)} and {H(curl)} conforming finite elements}, 22675 author = {Marie E Rognes and Robert C Kirby and Anders Logg}, 22676 journal = {SIAM Journal on Scientific Computing}, 22677 volume = {31}, 22678 number = {6}, 22679 pages = {4130--4151}, 22680 year = {2009} 22681} 22682 22683@Book{ kelley03, 22684 title = {Solving nonlinear equations with Newton's method}, 22685 author = {Carl T. Kelley}, 22686 publisher = {SIAM}, 22687 year = {2003} 22688} 22689 22690@Article{ turing1937, 22691 title = {The Chemical Basis of Morphogenesis}, 22692 author = {A. M. Turing}, 22693 journal = {Philosophical Transactions of the Royal Society B: Biological Sciences}, 22694 volume = {237}, 22695 number = {641}, 22696 pages = {37--72}, 22697 doi = {10.1098/rstb.1952.0012}, 22698 issn = {0080-4622}, 22699 url = {http://rstb.royalsocietypublishing.org/content/237/641/37}, 22700 eprint = {http://rstb.royalsocietypublishing.org/content/237/641/37.full.pdf}, 22701 year = {1952} 22702} 22703 22704@Article{ fabienknepleymillsriviere2017, 22705 title = {Manycore parallel computing for a hybridizable discontinuous {Galerkin} nested 22706 multigrid method}, 22707 author = {Maurice S. Fabien and Matthew G. Knepley and Richard Mills and B\'eatrice M. 22708 Rivi\`ere}, 22709 journal = {SIAM Journal on Scientific Computing}, 22710 url = {https://arxiv.org/abs/1705.09907}, 22711 volume = {41}, 22712 number = {2}, 22713 pages = {C73--C96}, 22714 doi = {10.1137/17M1128903}, 22715 year = {2018} 22716} 22717 22718@Article{ fabienknepleyriviere2018, 22719 title = {A hybridizable discontinuous Galerkin method for two-phase flow in heterogeneous 22720 porous media}, 22721 author = {Maurice S. Fabien and Matthew G. Knepley and B\'eatrice M. Rivier\'e}, 22722 journal = {International Journal for Numerical Methods in Engineering}, 22723 volume = {116}, 22724 number = {3}, 22725 pages = {161--177}, 22726 doi = {10.1002/nme.5919}, 22727 year = {2018} 22728} 22729 22730@Article{ fabienknepleyriviere2020, 22731 title = {A high order hybridizable discontinuous Galerkin method for incompressible 22732 miscible displacement in heterogeneous media}, 22733 author = {Maurice S. Fabien and Matthew G. Knepley and B\'eatrice M. Rivi\`ere}, 22734 journal = {Results in Applied Mathematics}, 22735 url = {https://arxiv.org/abs/1809.00747}, 22736 volume = {8}, 22737 pages = {100089}, 22738 doi = {10.1016/j.rinam.2019.100089}, 22739 year = {2020} 22740} 22741 22742@Article{ fabienknepleyriviere2019b, 22743 title = {Families of Interior Penalty Hybridizable discontinuous Galerkin methods for 22744 second order elliptic problems}, 22745 author = {Maurice S. Fabien and Matthew G. Knepley and B\'eatrice M. Rivi\`ere}, 22746 journal = {Journal of Numerical Mathematics}, 22747 volume = {28}, 22748 number = {3}, 22749 pages = {161--174}, 22750 doi = {10.1515/jnma-2019-0027}, 22751 year = {2019} 22752} 22753 22754@Article{ fabien2019, 22755 title = {A {GPU}-Accelerated Hybridizable Discontinuous {Galerkin} Method for Linear 22756 Elasticity}, 22757 author = {Maurice S. Fabien}, 22758 journal = {Communications in Computational Physics}, 22759 volume = {27}, 22760 number = {2}, 22761 pages = {513--545}, 22762 issn = {1991-7120}, 22763 doi = {10.4208/cicp.OA-2018-0235}, 22764 year = {2019} 22765} 22766 22767@Unpublished{ awanoufabienguzmanstern2020, 22768 title = {Hybridization and postprocessing in finite element exterior calculus}, 22769 author = {Gerard Awanou and Maurice Fabien and Johnny Guzm\'an and Ari Stern}, 22770 eprint = {2008.00149}, 22771 note = {preprint}, 22772 primaryclass = {math.NA}, 22773 year = {2020} 22774} 22775 22776@Article{ fabienguzmanneilanzytoon2022, 22777 title = {Low-order divergence-free approximations for the Stokes problem on Worsey--Farin and Powell--Sabin splits}, 22778 author = {Maurice Fabien and Johnny Guzm{\'a}n and Michael Neilan and Ahmed Zytoon}, 22779 journal = {Computer Methods in Applied Mechanics and Engineering}, 22780 volume = {390}, 22781 pages = {114444}, 22782 year = {2022}, 22783} 22784 22785@Article{ chaabanegiraultrivierethompson2018, 22786 title = {A stable enriched {G}alerkin element for the {S}tokes problem}, 22787 author = {Nabil Chaabane and Vivette Girault and B\'eatrice Rivi\`ere and Travis Thompson}, 22788 journal = {Applied Numerical Mathematics}, 22789 volume = {132}, 22790 pages = {1--21}, 22791 issn = {0168-9274}, 22792 doi = {https://doi.org/10.1016/j.apnum.2018.04.008}, 22793 url = {http://www.sciencedirect.com/science/article/pii/S0168927418300977}, 22794 year = {2018} 22795} 22796 22797@Article{ thompsonriviereknepley2018, 22798 title = {An Implicit Discontinuous Galerkin Method For Modeling Acute Edema and 22799 Resuscitation In The Small Intestine}, 22800 author = {Travis Thompson and B\'eatrice M. Rivi\`ere and Matthew G. Knepley}, 22801 journal = {Mathematical Medicine and Biology}, 22802 volume = {36}, 22803 number = {4}, 22804 pages = {513--548}, 22805 doi = {10.1093/imammb/dqz00}, 22806 year = {2019} 22807} 22808 22809@Article{ kevrekidisthompsongoriely2020, 22810 title = {Anisotropic Diffusion and Traveling Waves of Toxic Proteins in Neurodegenerative 22811 Diseases}, 22812 author = {P. G. Kevrekidis and Travis Thompson and Alain Goriely}, 22813 journal = {Physics Letters A}, 22814 volume = {384}, 22815 number = {36}, 22816 pages = {126935}, 22817 year = {2020} 22818} 22819 22820@Article{ mardalrognesthompson2021, 22821 title = {Accurate Discretization Of Poroelasticity Without {Darcy} Stability -- 22822 {Stokes-Biot} Stability Revisited}, 22823 author = {Kent-Andre Mardal and Marie E. Rognes and Travis B. Thompson}, 22824 journal = {BIT Numerical Mathematics}, 22825 pages = {1--36}, 22826 year = {2021} 22827} 22828 22829@Article{ piersantileethompsonmardalrognes2021, 22830 title = {Parameter robust preconditioning by congruence for multiple-network 22831 poroelasticity}, 22832 author = {Piersanti, Eleonora and Lee, Jeonghun J and Thompson, Travis and Mardal, K-A and 22833 Rognes, Marie E}, 22834 journal = {SIAM Journal on Scientific Computing}, 22835 volume = {43}, 22836 number = {4}, 22837 pages = {B984--B1007}, 22838 year = {2021}, 22839 publisher = {SIAM} 22840} 22841 22842@Article{ walkerknepleyaagaardwilliams2023, 22843 title = {Multiphysics Modeling in {PyLith}: Poroelasticity}, 22844 author = {Robert L. Walker and Matthew G. Knepley and Brad T. Aagaard and Charles A. Williams}, 22845 journal = {Geophysical Journal International}, 22846 volume = {235}, 22847 number = {3}, 22848 pages = {2442--2475}, 22849 doi = {10.1093/gji/ggad370}, 22850 year = {2023} 22851} 22852 22853@Article{ bhavsar2024influence, 22854 title = {Influence of initial slab dip, inter-plate coupling, and nonlinear rheology on dynamic weakening at the lithosphere-asthenosphere boundary}, 22855 author = {Vivek Bhavsar and Margarete A. Jadamec and Matthew G. Knepley}, 22856 journal = {Journal of Geophysical Research: Solid Earth}, 22857 note = {Submitted}, 22858 year = {2024}, 22859} 22860 22861@InProceedings{ actorfuentesriviere2020b, 22862 title = {Identification of Kernels in a Convolutional Neural Network: Connections Between 22863 Level Set Equation and Deep Learning for Image Segmentation}, 22864 author = {Jonas A. Actor and David T. Fuentes and B\'eatrice M. Rivi\`ere}, 22865 booktitle = {Proceedings of the SPIE Medical Imaging Conference}, 22866 year = {2020} 22867} 22868 22869@Article{ actorfuentesriviere2020, 22870 title = {Robust Regularized Networks in the Presence of Noise}, 22871 author = {Jonas A. Actor and David T. Fuentes and B\'eatrice M. Rivi\`ere}, 22872 journal = {Medical Image Analysis}, 22873 note = {In revision}, 22874 year = {2020} 22875} 22876 22877@Book{ byerly1893, 22878 title = {An elementary treatise on Fourier's series: and spherical, cylindrical, and 22879 ellipsoidal harmonics, with applications to problems in mathematical physics}, 22880 author = {William Elwood Byerly}, 22881 publisher = {Dover}, 22882 year = {1893} 22883} 22884 22885@Book{ hobson1931, 22886 title = {The theory of spherical and ellipsoidal harmonics}, 22887 author = {Ernest William Hobson}, 22888 year = {1931}, 22889 publisher = {CUP Archive} 22890} 22891 22892@Book{ dassios2012, 22893 title = {Ellipsoidal harmonics: theory and applications}, 22894 author = {George Dassios}, 22895 volume = {146}, 22896 year = {2012}, 22897 publisher = {Cambridge University Press} 22898} 22899 22900@Book{ miller1977, 22901 title = {Symmetry and separation of variables}, 22902 author = {Miller, Jr, Willard}, 22903 year = {1977}, 22904 address = {Reading, MA}, 22905 publisher = {Addison-Wesley Publishing Co., Inc.} 22906} 22907 22908@TechReport{ epanet-users-manual, 22909 author = {Lewis A. Rossman}, 22910 title = {{EPANET 2} Users Manual}, 22911 institution = {Water Supply and Water Resources Division, National Risk Management Research 22912 Laboratory, Cincinnati, OH 45268}, 22913 year = {2000} 22914} 22915 22916@Article{ klocknerbarnettgreengardoneil2013, 22917 title = {Quadrature by expansion: A new method for the evaluation of layer potentials}, 22918 author = {Andreas Kl{\"o}ckner and Alexander Barnett and Leslie Greengard and Michael 22919 O'Neil}, 22920 journal = {Journal of Computational Physics}, 22921 volume = {252}, 22922 pages = {332--349}, 22923 year = {2013} 22924} 22925 22926@Article{ turcksinkronbichlerbangerth2016, 22927 title = {WorkStream--A Design Pattern for Multicore-Enabled Finite Element Computations}, 22928 author = {Bruno Turcksin and Martin Kronbichler and Wolfgang Bangerth}, 22929 journal = {ACM Transactions on Mathematical Software)}, 22930 volume = {43}, 22931 number = {1}, 22932 pages = {2}, 22933 year = {2016} 22934} 22935 22936@Article{ vitushkin1954, 22937 title = {On {Hilbert's} thirteenth problem}, 22938 author = {A. G. Vitushkin}, 22939 journal = {Dokl. Akad. Nauk SSSR}, 22940 volume = {95}, 22941 pages = {701--704}, 22942 year = {1954} 22943} 22944 22945@Article{ kolmogorov1957, 22946 title = {On the representation of continuous functions of several variables as 22947 superpositions of continuous functions of one variable and addition}, 22948 author = {Andrei N. Kolmogorov}, 22949 journal = {Dokl. Akad. Nauk SSSR}, 22950 pages = {953--956}, 22951 volume = {114:5}, 22952 note = {English transl. Amer. Math. Soc. Transl. (2) 28 (1963), 55}, 22953 year = {1957} 22954} 22955 22956@Article{ fridman1967, 22957 title = {Improvement in the smoothness of functions in the {Kolmogorov Superposition 22958 Theorem}}, 22959 author = {B. L. Fridman}, 22960 journal = {Dokl. Akad. Nauk SSR}, 22961 volume = {177:5}, 22962 pages = {1019--1022}, 22963 note = {English transl. Soviet Math. Dokl. 8, 6 (1967), 1550-1553}, 22964 year = {1967} 22965} 22966 22967@Article{ sprecher1972, 22968 title = {An improvement in The {Superposition Theorem of Kolmogorov}}, 22969 author = {David Sprecher}, 22970 journal = {Journal of Mathematical Analysis and Applications}, 22971 volume = {38}, 22972 pages = {208--213}, 22973 year = {1972} 22974} 22975 22976@Article{ diaconisshahshahani1984, 22977 title = {On nonlinear functions of linear combinations}, 22978 author = {Persi Diaconis and Mehrdad Shahshahani}, 22979 journal = {SIAM Journal on Scientific and Statistical Computing}, 22980 volume = {5}, 22981 number = {1}, 22982 pages = {175--191}, 22983 year = {1984}, 22984 publisher = {SIAM} 22985} 22986 22987@InProceedings{ hechtnielsen1987, 22988 title = {Kolmogorov's mapping neural network existence theorem}, 22989 author = {R. Hecht-Nielsen}, 22990 booktitle = {Proceedings of the International Conference on Neural Networks}, 22991 volume = {III}, 22992 pages = {11--14}, 22993 publisher = {IEEE Press}, 22994 year = {1987} 22995} 22996 22997@InProceedings{ hechtnielsen1989, 22998 title = {Theory of the back-propagation neural network}, 22999 author = {R. Hecht-Nielsen}, 23000 booktitle = {Proceedings of the International Joint Conference on Neural Networks}, 23001 volume = {I}, 23002 pages = {593--608}, 23003 publisher = {IEEE Press}, 23004 year = {1989} 23005} 23006 23007@Article{ girosipoggio1989, 23008 title = {Representation properties of networks: {Kolmogorov's} theorem is irrelevant}, 23009 author = {Federico Girosi and Tomaso Poggio}, 23010 journal = {Neural Computation}, 23011 volume = {1}, 23012 number = {4}, 23013 pages = {465--469}, 23014 year = {1989}, 23015 publisher = {MIT Press} 23016} 23017 23018@InBook{ koppen2002, 23019 title = {On the Training of a Kolmogorov Network}, 23020 author = {Mario K\"oppen}, 23021 pages = {474--9}, 23022 publisher = {ICANN 2002, LNCS 2415}, 23023 year = {2002} 23024} 23025 23026@PhDThesis{ bryant2008, 23027 title = {Analysis of {Kolmogorov's} superposition theorem and its implementation in 23028 applications with low and high dimensional data}, 23029 author = {Donald W Bryant}, 23030 school = {University of Central Florida}, 23031 year = {2008} 23032} 23033 23034@InCollection{ griebel2006, 23035 title = {Sparse Grids for Higher Dimensional Problems}, 23036 author = {Michael Griebel}, 23037 booktitle = {Foundations of Computational Mathematics}, 23038 editor = {Luis M. Pardo and Allan Pinkus and Endre Suli and Michael J. Todd}, 23039 publisher = {Cambridge University Press}, 23040 pages = {106--161}, 23041 doi = {10.1017/CBO9780511721571.004}, 23042 url = {https://www.cambridge.org/core/books/foundations-of-computational-mathematics-santander-2005/sparse-grids-for-higher-dimensional-problems/C6E91FFE07DF5F6C069B80805B216B50}, 23043 month = jun, 23044 day = {29}, 23045 year = {2006} 23046} 23047 23048@Article{ braungriebel2009, 23049 title = {On a constructive proof of {Kolmogorov}'s superposition theorem}, 23050 author = {Jurgen Bra\"un and Michael Griebel}, 23051 journal = {Constructive Approximation}, 23052 pages = {653--675}, 23053 volume = {30}, 23054 year = {2009} 23055} 23056 23057@InProceedings{ lenifougerolletruchetet2009, 23058 title = {Kolmogorov superposition theorem and its application to wavelet image 23059 decompositions}, 23060 author = {Pierre-Emmanuel Leni and Yohan D Fougerolle and Fr{\'{e}}d{\'{e}}ric Truchetet}, 23061 booktitle = {Electronic Imaging-Wavelet Applications in Industrial Processing VI, Proceedings 23062 of the SPIE}, 23063 pages = {724804--724804}, 23064 doi = {10.1117/12.805916}, 23065 url = {http://le2i.cnrs.fr/IMG/publications/2228{\_}main.pdf{\%}5Cnhttp://proceedings.spiedigitallibrary.org/proceeding.aspx?articleid=1335035}, 23066 year = {2009} 23067} 23068 23069@Article{ oseledets2011, 23070 title = {Tensor-train decomposition}, 23071 author = {Ivan V Oseledets}, 23072 journal = {SIAM Journal on Scientific Computing}, 23073 volume = {33}, 23074 number = {5}, 23075 pages = {2295--2317}, 23076 year = {2011} 23077} 23078 23079@PhDThesis{ liu2015, 23080 title = {Kolmogorov superposition theorem and its applications}, 23081 author = {Xing Liu}, 23082 school = {Imperial College London}, 23083 year = {2015} 23084} 23085 23086@Article{ lecunbengiohinton2015, 23087 title = {Deep learning}, 23088 author = {Yann LeCun and Yoshua Bengio and Geoffrey Hinton}, 23089 journal = {Nature}, 23090 volume = {521}, 23091 number = {7553}, 23092 pages = {436--444}, 23093 year = {2015} 23094} 23095 23096@Book{ trefethen2013, 23097 title = {Approximation theory and approximation practice}, 23098 author = {Lloyd N Trefethen}, 23099 publisher = {SIAM}, 23100 year = {2013} 23101} 23102 23103@Article{ butlergrahammattiswalsh2017, 23104 title = {A measure-theoretic interpretation of sample based numerical integration with 23105 applications to inverse and prediction problems under uncertainty}, 23106 author = {Troy Butler and Lindsey Graham and S. Mattis and S. Walsh}, 23107 journal = {SIAM Journal on Scientific Computing}, 23108 volume = {39}, 23109 number = {5}, 23110 pages = {A2072--A2098}, 23111 year = {2017} 23112} 23113 23114@Article{ logg2009, 23115 title = {Efficient representation of computational meshes}, 23116 author = {Anders Logg}, 23117 journal = {International Journal of Computational Science and Engineering}, 23118 volume = {4}, 23119 number = {4}, 23120 pages = {283--295}, 23121 year = {2009} 23122} 23123 23124@Article{ agelekandersonbangerthbarth2017, 23125 title = {On orienting edges of unstructured two-and three-dimensional meshes}, 23126 author = {Rainer Agelek and Michael Anderson and Wolfgang Bangerth and William L Barth}, 23127 journal = {ACM Transactions on Mathematical Software (TOMS)}, 23128 volume = {44}, 23129 number = {1}, 23130 pages = {5}, 23131 year = {2017} 23132} 23133 23134@Article{ actorknepley2018, 23135 title = {An Algorithm for Computing {Lipschitz} Inner Functions in {Kolmogorov's 23136 Superposition Theorem}}, 23137 author = {Jonas Actor and Matthew G. Knepley}, 23138 eprint = {1712.08286}, 23139 archiveprefix = {arXiv}, 23140 primaryclass = {math.na}, 23141 note = {\url{http://arxiv.org/abs/1712.08286}}, 23142 year = {2018} 23143} 23144 23145@Book{ driscollhaletrefethen2014, 23146 title = {Chebfun guide}, 23147 author = {Tobin A Driscoll and Nicholas Hale and Lloyd N Trefethen}, 23148 publisher = {Pafnuty Publications, Oxford}, 23149 year = {2014} 23150} 23151 23152@Article{ johntobiska2000, 23153 title = {Numerical performance of smoothers in coupled multigrid methods for the parallel 23154 solution of the incompressible Navier-Stokes equations}, 23155 author = {Volker John and Lutz Tobiska}, 23156 journal = {International Journal for Numerical Methods in Fluids}, 23157 volume = {33}, 23158 number = {4}, 23159 pages = {453--473}, 23160 year = {2000} 23161} 23162 23163@Article{ vanka1986, 23164 title = {Block-implicit multigrid calculation of two-dimensional recirculating flows}, 23165 author = {S. P. Vanka}, 23166 journal = {Computer Methods in Applied Mechanics and Engineering}, 23167 volume = {59}, 23168 number = {1}, 23169 pages = {29--48}, 23170 year = {1986} 23171} 23172 23173@Article{ bartelgunther2018, 23174 author = {Andreas Bartel and Michael G\"unther}, 23175 title = {{PDAEs} in refined electrical network modeling}, 23176 journal = {SIAM Review}, 23177 volume = {60}, 23178 number = {1}, 23179 pages = {56--91}, 23180 doi = {10.1137/17M1113643}, 23181 year = {2018} 23182} 23183 23184@Article{ matpower, 23185 author = {Ray D. Zimmerman and Carlos E. Murillo-S{\'a}nchez and Robert J. Thomas}, 23186 title = {{MATPOWER}: Steady-state operations, planning and analysis tools for power 23187 systems research and education}, 23188 journal = {IEEE Transactions on Power Systems}, 23189 volume = {26}, 23190 number = {1}, 23191 pages = {12--19}, 23192 year = {2011}, 23193 doi = {10.1109/TPWRS.2010.2051168} 23194} 23195 23196@Article{ betrieyan2018, 23197 author = {G. Betrie and E. Yan}, 23198 title = {Development and Verification of Thermoelectric Power Plant Model for Assessing 23199 Energy and Water Nexus}, 23200 journal = {Applied Energy, Submitted}, 23201 volume = {}, 23202 number = {}, 23203 pages = {}, 23204 doi = {}, 23205 year = {2018} 23206} 23207 23208@Article{ faeth2012, 23209 author = {P. Faeth}, 23210 title = {{U.S.} Energy Security and Water: The Challenges We Face}, 23211 journal = {Environment: Science and Policy for Sustainable Development}, 23212 volume = {54(1)}, 23213 number = {1}, 23214 pages = {4--19}, 23215 year = {2012}, 23216 doi = {10.1080/00139157.2012.639595} 23217} 23218 23219@InProceedings{ hagberg2008, 23220 title = {Exploring network structure, dynamics, and function using {NetworkX}}, 23221 author = {Hagberg, Aric A. and Schult, Daniel A. and Swart, Pieter J.}, 23222 booktitle = {Proceedings of the 7th Python in Science Conference (SciPy2008), Ga\"{e}l 23223 Varoquaux, Travis Vaught, and Jarrod Millman (Eds), (Pasadena, CA USA)}, 23224 year = {2008}, 23225 pages = {11--15} 23226} 23227 23228@Misc{ simulink-web-page, 23229 author = {Mathworks}, 23230 title = {{SIMULINK} web page}, 23231 note = {\url{https://www.mathworks.com/products/simulink.html}}, 23232 year = {2017} 23233} 23234 23235@Misc{ labview-web-page, 23236 author = {National Instruments}, 23237 title = {{LabVIEW} web page}, 23238 note = {\url{http://www.ni.com/labview/}}, 23239 key = {labview}, 23240 year = {2017} 23241} 23242 23243@Misc{ modelica-web-page, 23244 author = {Modelica Association}, 23245 title = {Modelica web page}, 23246 note = {\url{https://www.modelica.org/}}, 23247 year = {2017} 23248} 23249 23250@InProceedings{ yangsc16, 23251 author = {C. Yang and W. Xue and H. Fu and H. You and X. Wang and Y. Ao and F. Liu and L. 23252 Gan and P. Xu and L. Wang and G. Yang and W. Zheng}, 23253 booktitle = {{SC '16}: Proceedings of the International Conference for High Performance 23254 Computing, Networking, Storage and Analysis}, 23255 title = {{10M-Core} Scalable Fully-Implicit Solver for Nonhydrostatic Atmospheric 23256 Dynamics}, 23257 note = {Gordon Bell Award}, 23258 year = {2016} 23259} 23260 23261@InProceedings{ bekassc15, 23262 author = {C. Bekas and A. Curioni and O. Ghattas and M. Gurnis and Y. Ineichen and T. Isaac 23263 and C. Malossi and J. Rudi and G. Stadler and P.W.J. Staar}, 23264 booktitle = {{SC '15}: Proceedings of the International Conference for High Performance 23265 Computing, Networking, Storage and Analysis}, 23266 title = {An Extreme-Scale Implicit Solver for Complex {PDEs}: Highly Heterogeneous Flow in 23267 Earth's Mantle}, 23268 note = {Gordon Bell Award}, 23269 year = {2015} 23270} 23271 23272@Misc{ improving-software-whitepaper2017, 23273 author = {M. Heroux and L.C. McInnes}, 23274 title = {Improving and accelerating scientific discovery through better software}, 23275 note = {whitepaper for 2017 ASCR Applied Mathematics PI Meeting}, 23276 doi = {10.6084/m9.figshare.5339692}, 23277 year = {2017} 23278} 23279 23280@Misc{ doe:40thanniversarycollection, 23281 title = {{DOE Office of Science} 40th anniversary collection of 40 major papers that have 23282 changed the face of science}, 23283 key = {Department of Energy, Office of Science}, 23284 howpublished = {\url{https://science.energy.gov/news/doe-science-at-40}}, 23285 year = {2017} 23286} 23287 23288@Misc{ siam:fellowsprogram, 23289 title = {{Society for Industrial and Applied Mathematics, Fellows Program}}, 23290 key = {SIAM}, 23291 howpublished = {\url{http://www.siam.org/prizes/fellows}} 23292} 23293 23294@Misc{ r-and-d100:awards2009, 23295 title = {{R\&D100 Award Winners 2009}}, 23296 key = {{R\&D100 Award Winners 2009}}, 23297 howpublished = {\url{https://www.rdmag.com/2009/08/2009-r-d-100-award-winners}} 23298} 23299 23300@Misc{ xsdk:website, 23301 title = {{xSDK: Extreme-scale Scientific Software Development Kit}}, 23302 key = {xSDK: Extreme-scale Scientific Software Development Kit}, 23303 howpublished = {\url{https://xsdk.info}} 23304} 23305 23306@Misc{ xsdk-community-installation-policies2017, 23307 title = {{xSDK} Community Installation Policies: {GNU Autoconf} and {CMake} Options}, 23308 author = {R. Bartlett and J. Sarich and B. Smith and T. Gamblin and {xSDK developers}}, 23309 note = {version 0.3, November 7, 2017}, 23310 doi = {10.6084/m9.figshare.4495133}, 23311 year = {2017} 23312} 23313 23314@Misc{ xsdk-community-package-policies2017, 23315 title = {{xSDK} Community Package Policies}, 23316 author = {B. Smith and R. Bartlett and {xSDK developers}}, 23317 note = {version 0.3, November 7, 2017}, 23318 doi = {10.6084/m9.figshare.4495136}, 23319 year = {2017} 23320} 23321 23322@Misc{ ideas-what-are-interoperable-libraries, 23323 title = {What Are Interoperable Software Libraries: Introducing the {xSDK}}, 23324 author = {Lois Curfman McInnes and Michael A. Heroux and Xiaoye Li and Barry Smith and 23325 Ulrike Yang and {all xSDK developers}}, 23326 note = {IDEAS {\em WhatIs} document, version 0.2, April 25, 2016, available via 23327 \url{https://ideas-productivity.org/resources/howtos/}}, 23328 year = {2016} 23329} 23330 23331@Misc{ ideas-productivity:website, 23332 title = {{IDEAS Scientific Software Productivity Project}}, 23333 key = {IDEAS Scientific Software Productivity Project}, 23334 howpublished = {\url{https://ideas-productivity.org}} 23335} 23336 23337@Misc{ ecp:website, 23338 key = {{U.S. DOE Exascale Computing Project (ECP)}}, 23339 title = {{U.S. DOE Exascale Computing Project (ECP)}}, 23340 note = {\url{https://exascaleproject.org}}, 23341 year = {2018} 23342} 23343 23344@Misc{ siam-cse-jan2018, 23345 author = {Ulrich R\"{u}de and Karen Willcox and Lois Curfman McInnes and Hans {De Sterck} 23346 and George Biros and Hans Bungartz and James Corones and Evin Cramer and James 23347 Crowley and Omar Ghattas and Max Gunzburger and Michael Hanke and Robert Harrison 23348 and Michael Heroux and Jan Hesthaven and Peter Jimack and Chris Johnson and Kirk 23349 E. Jordan and David E. Keyes and Rolf Krause and Vipin Kumar and Stefan Mayer and 23350 Juan Meza and Knut Martin M{\o}rken and J. Tinsley Oden and Linda Petzold and 23351 Padma Raghavan and Suzanne M. Shontz and Anne Trefethen and Peter Turner and 23352 Vladimir Voevodin and Barbara Wohlmuth and Carol S. Woodward}, 23353 title = {Research and Education in Computational Science and Engineering}, 23354 note = {available via \url{https://arxiv.org/abs/1610.02608}, to appear in {\em SIAM 23355 Review}}, 23356 year = {2018} 23357} 23358 23359@Misc{ doe-appliedmathpimeeting2017, 23360 author = {Jeff Hittinger and Lois Curfman McInnes and Abani Patra and Nathan Baker and 23361 Miranda Holmes-Cerfon and Barney Maccabe and Esmong Ng and Pieter Swart and Karen 23362 Willcox and Steven Lee}, 23363 title = {{Report on the 2017 ASCR Applied Mathematics Principal Investigators Meeting}}, 23364 note = {\url{http://www.orau.gov/ascr-appliedmath-pi2017}}, 23365 year = {2017} 23366} 23367 23368@Misc{ doe-fusionintegratedsimulationsworkshopreport2015, 23369 author = {P. Bonoli and L. C. {McInnes (Chairs)}}, 23370 title = {{Report on the DOE Workshop on Integrated Simulations for Magnetic Fusion Energy 23371 Sciences}}, 23372 note = {available via 23373 \url{http://science.energy.gov/~/media/fes/pdf/workshop-reports/2016/ISFusionWorkshopReport_11-12-2015.pdf}}, 23374 year = {2015} 23375} 23376 23377@Misc{ sisc-specialissueintro, 23378 title = {Introduction to {SISC} Special section associated with {CSE15} on {'CSE 23379 Software'} and {'Big Data in CSE'}}, 23380 author = {H. {De Sterck} and C. Johnson and L.C. McInnes}, 23381 month = nov, 23382 year = {2016}, 23383 journal = {SIAM J. Sci. Comput.}, 23384 doi = {10.1137/16N974188} 23385} 23386 23387@Article{ xsdk-foundations2017, 23388 title = {{xSDK} Foundations: Toward an Extreme-scale Scientific Software Development Kit}, 23389 author = {R. Bartlett and I. Demeshko and T. Gamblin and G. Hammond and M. Heroux and J. 23390 Johnson and A. Klinvex and X. Li and L.C. McInnes and J.D. Moulton and D. 23391 Osei-Kuffuor and J. Sarich and B. Smith and J. Willenbring and U.M. Yang}, 23392 journal = {Supercomputing Frontiers and Innovations}, 23393 month = feb, 23394 year = {2017}, 23395 note = {available via \url{https://arxiv.org/abs/1702.08425}} 23396} 23397 23398@Misc{ openfoam:website, 23399 title = {{OpenFOAM}}, 23400 author = {OpenFOAM Team}, 23401 key = {OpenFOAM}, 23402 howpublished = {\url{https://openfoam.com}} 23403} 23404 23405@Misc{ mfem:website, 23406 title = {{MFEM}}, 23407 author = {Tzanio Kolev and MFEM Team}, 23408 key = {MFEM}, 23409 howpublished = {\url{https://mfem.org}} 23410} 23411 23412@Misc{ deal.ii:website, 23413 title = {{{deal.II}: An open-source finite element library}}, 23414 author = {Wolfgang Bangerth and Deal.II Team}, 23415 howpublished = {\url{http://www.dealii.org}}, 23416 year = {2018} 23417} 23418 23419@Misc{ ibamr:website, 23420 title = {{{IBAMR}: Immersed Boundary Method Adaptive Mesh Refinement Software Infrastructure}}, 23421 author = {Boyce Griffith and IBAMR Team}, 23422 howpublished = {\url{https://ibamr.github.io/}}, 23423 year = {2023} 23424} 23425 23426@Misc{ fission-gas-scidac:website, 23427 title = {{Simulation of Fission Gas in Uranium Oxide Nuclear Fuel}}, 23428 author = {A. David {Andersson (PI)}}, 23429 howpublished = {SciDAC project, \url{https://collab.cels.anl.gov/display/FissionGasSciDAC2}}, 23430 year = {2018} 23431} 23432 23433@Misc{ tokamak-disruption-scidac:project, 23434 title = {{Tokamak Disruption Simulation}}, 23435 author = {Xianzhu {Tang (PI)}}, 23436 howpublished = {SciDAC project}, 23437 year = {2018} 23438} 23439 23440@InProceedings{ duplyakin2018memory, 23441 title = {Evaluating Active Learning with Cost and Memory Awareness}, 23442 author = {Duplyakin, Dmitry and Brown, Jed and Calhoun, Donna}, 23443 booktitle = {2018 IEEE International Parallel and Distributed Processing Symposium (IPDPS)}, 23444 pages = {214--223}, 23445 year = {2018}, 23446 organization = {IEEE}, 23447 pdf = {https://jedbrown.org/files/DuplyakinBrownCalhoun-ActiveLearningCostMemoryAware-2018.pdf} 23448} 23449 23450@InProceedings{ duplyakin2016active, 23451 author = {Dmitry Duplyakin and Jed Brown and Robert Ricci}, 23452 title = {Active Learning in Performance Analysis}, 23453 booktitle = {Proceedings of the IEEE Cluster Conference}, 23454 year = {2016}, 23455 month = sep, 23456 url = {http://www.flux.utah.edu/paper/duplyakin-cluster16}, 23457 pdf = {https://jedbrown.org/files/DuplyakinBrownRicci-ActiveLearningPerformanceAnalysis-2016.pdf} 23458} 23459 23460@Misc{ xgc1:website, 23461 title = {{XGC1 project website}}, 23462 author = {C. S. Chang and others}, 23463 howpublished = {\url{https://epsi.pppl.gov/computing/xgc-1}}, 23464 year = {2018} 23465} 23466 23467@Misc{ wdmapp-bhattacharjee-ecp:website, 23468 title = {{WDMApp: High-Fidelity Whole Device Modeling of Magnetically Confined Fusion 23469 Plasmas}}, 23470 author = {A. Bhattacharjee and others}, 23471 note = {ECP application project}, 23472 howpublished = {\url{https://www.exascaleproject.org/activity/energy-applications}}, 23473 year = {2018} 23474} 23475 23476@Misc{ subsurface-steefel-ecp:website, 23477 title = {{Subsurface: Exascale Subsurface Simulator of Coupled Flow, Transport, Reactions, 23478 and Mechanics}}, 23479 note = {ECP application project}, 23480 author = {C. Steefel and others}, 23481 howpublished = {\url{https://www.exascaleproject.org/activity/earth-space-science-applications}}, 23482 year = {2018} 23483} 23484 23485@Article{ chombo-crunch:2014, 23486 title = {High-Resolution Simulation of Pore-Scale Reactive Transport Processes Associated 23487 with Carbon Sequestration}, 23488 author = {D. Trebotich and M. F. Adams and S. Molins and C. Steefel and C. Shen}, 23489 journal = {Computing in Science and Engineering}, 23490 volume = {16}, 23491 issue = {6}, 23492 year = {2014}, 23493 pages = {22--31}, 23494 doi = {10.1109/MCSE.2014.77} 23495} 23496 23497@Article{ courantfriedrichslewy1967, 23498 title = {On the partial difference equations of mathematical physics}, 23499 author = {Richard Courant and Kurt Friedrichs and Hans Lewy}, 23500 journal = {IBM journal of Research and Development}, 23501 volume = {11}, 23502 number = {2}, 23503 pages = {215--234}, 23504 year = {1967}, 23505 publisher = {IBM} 23506} 23507 23508@Article{ erway2017solving, 23509 title = {On solving large-scale limited-memory quasi-Newton equations}, 23510 author = {Erway, Jennifer B and Marcia, Roummel F}, 23511 journal = {Linear Algebra and its Applications}, 23512 volume = {515}, 23513 pages = {196--225}, 23514 year = {2017}, 23515 publisher = {Elsevier} 23516} 23517 23518@Article{ griewank2012broyden, 23519 title = {Broyden updating, the good and the bad!}, 23520 author = {Griewank, Andreas}, 23521 journal = {Optimization Stories, Documenta Mathematica. Extra Volume: Optimization Stories}, 23522 pages = {301--315}, 23523 year = {2012} 23524} 23525 23526@Book{ tarantola2005, 23527 title = {Inverse problem theory and methods for model parameter estimation}, 23528 author = {Albert Tarantola}, 23529 volume = {89}, 23530 year = {2005}, 23531 publisher = {SIAM} 23532} 23533 23534@Article{ rutkaikristof2010, 23535 title = {Dynamic Monte Carlo simulation in mixtures}, 23536 author = {G{\'a}bor Rutkai and Tam{\'a}s Krist{\'o}f}, 23537 journal = {The Journal of Chemical Physics}, 23538 volume = {132}, 23539 number = {10}, 23540 pages = {104107}, 23541 year = {2010}, 23542 publisher = {AIP} 23543} 23544 23545@Book{ vogel2002, 23546 title = {Computational methods for inverse problems}, 23547 author = {Curtis R Vogel}, 23548 volume = {23}, 23549 year = {2002}, 23550 publisher = {SIAM} 23551} 23552 23553@Article{ malqvistpeterseim2014, 23554 title = {Localization of elliptic multiscale problems}, 23555 author = {Axel M{\aa}lqvist and Daniel Peterseim}, 23556 journal = {Mathematics of Computation}, 23557 volume = {83}, 23558 number = {290}, 23559 pages = {2583--2603}, 23560 year = {2014} 23561} 23562 23563@Article{ brandtbrannickkahllivshits2011, 23564 title = {Bootstrap {AMG}}, 23565 author = {Achi Brandt and James Brannick and Karsten Kahl and Irene Livshits}, 23566 journal = {SIAM Journal on Scientific Computing}, 23567 volume = {33}, 23568 number = {2}, 23569 pages = {612--632}, 23570 year = {2011} 23571} 23572 23573@InProceedings{ barralalauzet2014, 23574 title = {Large displacement body-fitted {FSI} simulations using a mesh-connectivity-change 23575 moving mesh strategy}, 23576 author = {Nicolas Barral and Fr{\'e}d{\'e}ric Alauzet}, 23577 booktitle = {44th AIAA Fluid Dynamics Conference}, 23578 pages = {2773}, 23579 year = {2014} 23580} 23581 23582@InProceedings{ barralalauzetloseille2015, 23583 title = {Metric-based anisotropic mesh adaptation for three-dimensional time-dependent 23584 problems involving moving geometries}, 23585 author = {Nicolas Barral and Fr{\'e}d{\'e}ric Alauzet and Adrien Loseille}, 23586 booktitle = {53rd AIAA Aerospace Sciences Meeting}, 23587 pages = {2039}, 23588 year = {2015} 23589} 23590 23591@Article{ barralolivieralauzet2017, 23592 title = {Time-accurate anisotropic mesh adaptation for three-dimensional time-dependent 23593 problems with body-fitted moving geometries}, 23594 author = {Nicolas Barral and G{\'e}raldine Olivier and Fr{\'e}d{\'e}ric Alauzet}, 23595 journal = {Journal of Computational Physics}, 23596 volume = {331}, 23597 pages = {157--187}, 23598 year = {2017} 23599} 23600 23601@Article{ ibanezbarralkrakosloseillemichalpark2017, 23602 title = {First Benchmark of the Unstructured Grid Adaptation Working Group}, 23603 author = {Daniel Ibanez and Nicolas Barral and Joshua Krakos and Adrien Loseille and Todd 23604 Michal and Mike Park}, 23605 journal = {Procedia engineering}, 23606 volume = {203}, 23607 pages = {154--166}, 23608 year = {2017} 23609} 23610 23611@InProceedings{ parkbarralibanezkamenetskiykrakosmichalloseille2018, 23612 title = {Unstructured Grid Adaptation and Solver Technology for Turbulent Flows}, 23613 author = {Michael A Park and Nicolas Barral and Daniel Ibanez and Dmitry S Kamenetskiy and 23614 Joshua A Krakos and Todd R Michal and Adrien Loseille}, 23615 booktitle = {2018 AIAA Aerospace Sciences Meeting}, 23616 pages = {1103}, 23617 year = {2018} 23618} 23619 23620@InProceedings{ barralangeloudiskramergormanpiggott2018, 23621 title = {An anisotropic mesh adaptation approach for regional tidal energy hydrodynamics 23622 modelling}, 23623 author = {Nicolas Barral and Athanasios Angeloudis and Stephan C Kramer and Gerard J Gorman 23624 and Matthew D Piggott}, 23625 booktitle = {EGU General Assembly Conference Abstracts}, 23626 volume = {20}, 23627 pages = {19168}, 23628 year = {2018} 23629} 23630 23631@Article{ principe2009, 23632 title = {{Mathematical models for thermally coupled low speed flows}}, 23633 author = {Javier Principe and Ramon Codina}, 23634 journal = {Advances in Theoretical and Applied Mechanics}, 23635 volume = {2}, 23636 number = {1-4}, 23637 pages = {93--112}, 23638 url = {http://www.m-hikari.com/atam/atam2009/atam1-4-2009/principeATAM1-4-2009.pdf}, 23639 year = {2009} 23640} 23641 23642@Book{ vandervorst2003, 23643 title = {Iterative {K}rylov Methods for Large Linear Systems}, 23644 author = {van der Vorst, H.}, 23645 isbn = {9780521818285}, 23646 publisher = {Cambridge University Press}, 23647 year = {2003} 23648} 23649 23650@Book{ peres2006, 23651 author = {Asher Peres}, 23652 title = {Quantum theory: concepts and methods}, 23653 volume = {57}, 23654 publisher = {Springer Science \& Business Media}, 23655 year = {2006} 23656} 23657 23658@Book{ kuttler2012, 23659 title = {Linear algebra: theory and applications}, 23660 author = {Kenneth Kuttler}, 23661 url = {http://www.math.byu.edu/~klkuttle/Linearalgebra.pdf}, 23662 year = {2012} 23663} 23664 23665@Book{ elman_silvester_wathen_2014, 23666 place = {Oxford}, 23667 title = {Finite elements and fast iterative solvers: with applications in incompressible 23668 fluid dynamics}, 23669 publisher = {Oxford University Press}, 23670 author = {Elman, Howard C. and Silvester, David J. and Wathen, Andrew J.}, 23671 url = {https://global.oup.com/academic/product/finite-elements-and-fast-iterative-solvers-9780199678792?cc=us&lang=en&}, 23672 year = {2014} 23673} 23674 23675@Article{ alametal2007, 23676 title = {An evaluation of the ORNL Cray XT3}, 23677 author = {S. R. Alam and R. F. Barrett and M. R. Fahey and J. A. Kuehn and O. E. B. Messer 23678 and R. T. Mills and P. C. Roth and J. S. Vetter and P. H. Worley}, 23679 journal = {International Journal of High Performance Computing Applications}, 23680 volume = {22}, 23681 number = {1}, 23682 pages = {52--80}, 23683 doi = {10.1177/1094342007085019}, 23684 year = {2007} 23685} 23686 23687@Article{ plazacarey2000, 23688 title = {Local refinement of simplicial grids based on the skeleton}, 23689 author = {Plaza, A. and Carey, Graham F.}, 23690 journal = {Applied Numerical Mathematics}, 23691 doi = {10.1016/S0168-9274(99)00022-7}, 23692 issn = {01689274}, 23693 volume = {32}, 23694 number = {2}, 23695 pages = {195--218}, 23696 year = {2000} 23697} 23698 23699@Article{ carsonstrakos2020, 23700 title = {On the cost of iterative computations}, 23701 author = {Eric Carson and Zden\v{e}k Strako\v{s}}, 23702 journal = {Phil. Trans. R. Soc. A}, 23703 volume = {378}, 23704 number = {20190050}, 23705 doi = {10.1098/rsta.2019.0050}, 23706 url = {https://royalsocietypublishing.org/doi/full/10.1098/rsta.2019.0050}, 23707 year = {2020} 23708} 23709 23710@Article{ schoberl1999, 23711 title = {Multigrid methods for a parameter dependent problem in primal variables}, 23712 author = {Joachim Sch{\"o}berl}, 23713 journal = {Numerische Mathematik}, 23714 volume = {84}, 23715 number = {1}, 23716 pages = {97--119}, 23717 year = {1999} 23718} 23719 23720@Article{ wuleexuzikatanov2008, 23721 title = {Convergence analysis on iterative methods for semidefinite systems}, 23722 author = {Jinbiao Wu and Young-Ju Lee and Jinchao Xu and Ludmil Zikatanov}, 23723 journal = {Journal of Computational Mathematics}, 23724 pages = {797--815}, 23725 year = {2008} 23726} 23727 23728@Article{ maierrannacher2016, 23729 title = {Duality-based adaptivity in finite element discretization of heterogeneous 23730 multiscale problems}, 23731 author = {Maier, Matthias and Rannacher, Rolf}, 23732 journal = {Journal of Numerical Mathematics}, 23733 volume = {24}, 23734 number = {3}, 23735 pages = {167--187}, 23736 year = {2016} 23737} 23738 23739@Article{ maierrannacher2018, 23740 title = {A duality-based optimization approach for model adaptivity in heterogeneous 23741 multiscale problems}, 23742 author = {Maier, Matthias and Rannacher, Rolf}, 23743 journal = {Multiscale Modeling \& Simulation}, 23744 volume = {16}, 23745 number = {1}, 23746 pages = {412--428}, 23747 year = {2018} 23748} 23749 23750@Article{ margetismaierluskin2017, 23751 title = {On the Wiener--Hopf method for surface plasmons: Diffraction from semiinfinite 23752 metamaterial sheet}, 23753 author = {Margetis, Dionisios and Maier, Matthias and Luskin, Mitchell}, 23754 journal = {Studies in Applied Mathematics}, 23755 volume = {139}, 23756 number = {4}, 23757 pages = {599--625}, 23758 year = {2017} 23759} 23760 23761@Article{ maiermargetisluskin2017b, 23762 title = {Dipole excitation of surface plasmon on a conducting sheet: Finite element 23763 approximation and validation}, 23764 author = {Maier, Matthias and Margetis, Dionisios and Luskin, Mitchell}, 23765 journal = {Journal of Computational Physics}, 23766 volume = {339}, 23767 pages = {126--145}, 23768 year = {2017} 23769} 23770 23771@Article{ maiermargetisluskin2018, 23772 title = {Generation of surface plasmon-polaritons by edge effects}, 23773 author = {Matthias Maier and Dionisios Margetis and Mitchell Luskin}, 23774 journal = {Communications in Mathematical Sciences}, 23775 volume = {16}, 23776 number = {1}, 23777 pages = {77--95}, 23778 url = {http://arxiv.org/abs/1702.00848}, 23779 year = {2018} 23780} 23781 23782@Article{ maiermattheakiskaxirasluskinmargetis2018, 23783 title = {Universal behavior of a dispersive Dirac cone in gradient-index plasmonic 23784 metamaterials}, 23785 author = {Maier, Matthias and Mattheakis, Marios and Kaxiras, Efthimios and Luskin, 23786 Mitchell and Margetis, Dionisios}, 23787 journal = {Physical Review B}, 23788 volume = {97}, 23789 number = {3}, 23790 pages = {035307}, 23791 year = {2018} 23792} 23793 23794@Article{ maiermattheakiskaxirasluskinmargetis2019, 23795 title = {Homogenization of plasmonic crystals: seeking the epsilon-near-zero effect}, 23796 author = {Maier, Matthias and Mattheakis, Marios and Kaxiras, Efthimios and Luskin, 23797 Mitchell and Margetis, Dionisios}, 23798 journal = {Proceedings of the Royal Society A}, 23799 volume = {475}, 23800 number = {2230}, 23801 pages = {20190220}, 23802 year = {2019} 23803} 23804 23805@Article{ maiermargetisluskin2020, 23806 title = {Finite-size effects in wave transmission through plasmonic crystals: A tale of 23807 two scales}, 23808 author = {Maier, Matthias and Luskin, Mitchell and Margetis, Dionisios}, 23809 journal = {Physical Review B}, 23810 volume = {102}, 23811 number = {7}, 23812 pages = {075308}, 23813 year = {2020} 23814} 23815 23816@Article{ margetismaierstauberlowluskin2020, 23817 title = {Nonretarded edge plasmon-polaritons in anisotropic two-dimensional materials}, 23818 author = {Margetis, Dionisios and Maier, Matthias and Stauber, Tobias and Low, Tony and 23819 Luskin, Mitchell}, 23820 journal = {Journal of Physics A: Mathematical and Theoretical}, 23821 volume = {53}, 23822 number = {5}, 23823 pages = {055201}, 23824 year = {2020} 23825} 23826 23827@Article{ maiermargetismellet2020, 23828 title = {Homogenization of time-harmonic Maxwell’s equations in nonhomogeneous plasmonic 23829 structures}, 23830 author = {Maier, Matthias and Margetis, Dionisios and Mellet, Antoine}, 23831 journal = {Journal of Computational and Applied Mathematics}, 23832 volume = {377}, 23833 pages = {112909}, 23834 year = {2020} 23835} 23836 23837@Article{ maierkronbichler2021, 23838 title = {Efficient parallel 3D computation of the compressible Euler equations with an 23839 invariant-domain preserving second-order finite-element scheme}, 23840 author = {Maier, Matthias and Kronbichler, Martin}, 23841 journal = {ACM Transactions on Parallel Computing}, 23842 volume = {8}, 23843 number = {3}, 23844 pages = {1--30}, 23845 year = {2021} 23846} 23847 23848@Article{ guermondmaierpopovtomas2021, 23849 title = {Second-order invariant domain preserving approximation of the compressible 23850 Navier--Stokes equations}, 23851 author = {Guermond, Jean-Luc and Maier, Matthias and Popov, Bojan and Tomas, Ignacio}, 23852 journal = {Computer Methods in Applied Mechanics and Engineering}, 23853 volume = {375}, 23854 pages = {113608}, 23855 year = {2021} 23856} 23857 23858@Article{ liliptonmaier2021, 23859 title = {Lorentz Resonance in the Homogenization of Plasmonic Crystals}, 23860 author = {Li, Wei and Lipton, Robert and Maier, Matthias}, 23861 eprint = {2009.12166}, 23862 archiveprefix = {arXiv}, 23863 primaryclass = {phys.optics}, 23864 year = {2021} 23865} 23866 23867@Article{ songmaierluskin2020, 23868 title = {Nonlinear eigenvalue problems for coupled Helmholtz equations modeling 23869 gradient-index graphene waveguides}, 23870 author = {Song, Jung Heon and Maier, Matthias and Luskin, Mitchell}, 23871 journal = {Journal of Computational Physics}, 23872 volume = {423}, 23873 pages = {109871}, 23874 year = {2020} 23875} 23876 23877@Article{ songmaierluskin2019, 23878 title = {Adaptive finite element simulations of waveguide configurations involving 23879 parallel 2D material sheets}, 23880 author = {Song, Jung Heon and Maier, Matthias and Luskin, Mitchell}, 23881 journal = {Computer Methods in Applied Mechanics and Engineering}, 23882 volume = {351}, 23883 pages = {20--34}, 23884 year = {2019} 23885} 23886 23887% 23888% <a name="consults"></a><H3><center>Users Who have Visited ANL for Consulting on PETSc</center></H3> 23889% 23890% 23891@Unpublished{ rob1, 23892 author = {Rob Kunz}, 23893 institution = {Computational Mechanics Division, Applied Research Laboratory, The Pennsylvania 23894 State University}, 23895 url = {http://www.arl.psu.edu/areas/compmech/compmech.html}, 23896 sponsors = {U.S. Navy, NRC}, 23897 note = {Using the PETSc and hypre linear solvers to solve pressure equations in CFD 23898 simulations, including lake warming by power plants}, 23899 dates = {Oct 3 and 4, 2002}, 23900 email = {rfk@wt.arl.psu.edu} 23901} 23902 23903@Unpublished{ au1, 23904 author = {Feng Wang and William Appelbe}, 23905 institution = {VPAC, Victorian Partnership for Advanced Computing, Melbourne, Australia}, 23906 url = {http://www.vpac.org}, 23907 sponsors = { }, 23908 note = {Using PETSc for a Variety of Geophysical Simulations}, 23909 dates = {Nov 22, 2002} 23910} 23911 23912@Unpublished{ carl1, 23913 author = {Carl Sovinec}, 23914 institution = {Applied Physics, University of Wisconsin}, 23915 url = {http://nimrodteam.org}, 23916 sponsors = {DOE Office of Fusion Research}, 23917 note = {Investigating using PETSc for NIMROD}, 23918 dates = {Nov 21, 2002}, 23919 email = {sovinec@engr.wisc.edu} 23920} 23921 23922@Unpublished{ au1b, 23923 author = {Pablo Carrica and Robert Wilson}, 23924 institution = {INSTITUTE HYDRAULIC RESEARCH, University of Iowa}, 23925 url = {http://}, 23926 sponsors = {Office of Naval Research}, 23927 note = {Using PETSc for a hydrodynamics of ships and submarines}, 23928 dates = {Sept, 2002}, 23929 email = {pablo-carrica@uiowa.edu and robert-wilson@uiowa.edu} 23930} 23931 23932% ------------------- TAO References ---------------------- 23933@Article{ benson:2001:csp, 23934 author = {Steven J. Benson and Lois Curfman McInnes and Jorge J. More'}, 23935 title = {A Case Study in the Performance and Scalability of Optimization Algorithms}, 23936 journal = {{ACM} Transactions on Mathematical Software}, 23937 volume = {27}, 23938 number = {3}, 23939 month = sep, 23940 year = {2001}, 23941 pages = {361--376} 23942} 23943 23944@TechReport{ tao-user-ref-2000, 23945 author = {Steve Benson and Lois Curfman McInnes and Jorge Mor\'{e}}, 23946 title = {{TAO} Users Manual}, 23947 year = {2000}, 23948 institution = {Mathematics and Computer Science Division, Argonne National Laboratory}, 23949 number = {ANL/MCS-TM-242}, 23950 note = {See \url{http://www.mcs.anl.gov/tao}} 23951} 23952 23953% ------------------- Optimization References ---------------------- 23954@Book{ optguide93, 23955 title = {Optimization Software Guide}, 23956 author = {Jorge J. Mor\'{e} and Stephen J. Wright}, 23957 publisher = {SIAM Publications}, 23958 address = {Philadelphia}, 23959 year = {1993} 23960} 23961 23962@InProceedings{ more84, 23963 author = {Jorge J. Mor\'{e} and Danny C. Sorenson and Burton S. Garbow and Kenneth E. 23964 Hillstrom}, 23965 title = {The {MINPACK} Project}, 23966 booktitle = {Sources and Development of Mathematical Software}, 23967 editor = {Wayne R. Cowell}, 23968 year = {1984}, 23969 pages = {88--111} 23970} 23971 23972@Article{ steihaug:83, 23973 author = {Trond Steihaug}, 23974 title = {The Conjugate Gradient Method and Trust Regions in Large Scale Optimization}, 23975 journal = {SIAM J. Numer. Anal.}, 23976 volume = {20}, 23977 year = {1983}, 23978 pages = {626--637}, 23979 key = {steihaug92 ! trust_region} 23980} 23981 23982@TechReport{ minpack2test, 23983 author = {Brett M. Averick and Richard G. Carter and Jorge J. Mor\'{e}}, 23984 title = {The {MINPACK-2} Test Problem Collection}, 23985 institution = {Argonne National Laboratory}, 23986 year = {1991}, 23987 number = {ANL/MCS-TM-150}, 23988 key = {more91 ! MINPACK-2} 23989} 23990 23991@TechReport{ hohmann:94, 23992 author = {Andreas Hohmann}, 23993 title = {Object Oriented Design of Multilevel {N}ewton and Continuation Methods}, 23994 institution = {Konrad-Zuse-Zentrum fur Informationstechnik Berlin}, 23995 year = {1994}, 23996 number = {SC-94-4}, 23997 key = {Hohmann94} 23998} 23999 24000@TechReport{ meza:94, 24001 author = {Juan C. Meza}, 24002 title = {{OPT}++: An Object-Oriented Class Library for Nonlinear Optimization}, 24003 institution = {Sandia National Laboratory}, 24004 year = {1994}, 24005 number = {SAND94-8225}, 24006 key = {Meza94} 24007} 24008 24009@Book{ dennis:83, 24010 author = {J. E. {Dennis Jr.} and Robert B. Schnabel}, 24011 title = {Numerical Methods for Unconstrained Optimization and Nonlinear Equations}, 24012 publisher = {Prentice-Hall, Inc.}, 24013 address = {Englewood Cliffs, NJ}, 24014 year = {1983} 24015} 24016 24017@TechReport{ more:92, 24018 author = {Jorge J. Mor\'{e} and David Thuente}, 24019 title = {Line search algorithms with guaranteed sufficient decrease}, 24020 institution = {Mathematics and Computer Science Division, Argonne National Laboratory}, 24021 year = {1992}, 24022 number = {MCS-P330-1092} 24023} 24024 24025@Article{ more-toraldo, 24026 author = {Jorge J. Mor\'e and G. Toraldo}, 24027 journal = {SIOPT}, 24028 pages = {93--113}, 24029 title = {On the solution of large quadratic programming problems with bound constraints}, 24030 volume = {1}, 24031 year = {1991} 24032} 24033 24034@Article{ byrd:1995:lma, 24035 author = {Richard H. Byrd and Peihuang Lu and Jorge Nocedal and Ci You Zhu}, 24036 title = {A Limited Memory Algorithm for Bound Constrained Optimization}, 24037 journal = {SIAM Journal on Scientific Computing}, 24038 volume = {16}, 24039 number = {5}, 24040 pages = {1190--1208}, 24041 month = sep, 24042 year = {1995}, 24043 coden = {SJOCE3}, 24044 issn = {1064-8275 (print), 1095-7197 (electronic)}, 24045 mrclass = {90C30 (65K05)}, 24046 mrnumber = {96e:90039}, 24047 mrreviewer = {Henry Wolkowicz}, 24048 bibdate = {Fri Dec 4 16:17:35 MST 1998} 24049} 24050 24051@Article{ lin_c3, 24052 author = {C.-J. Lin and J. J. Mor\'e}, 24053 title = {Newton's method for large bound-constrained optimization problems}, 24054 year = {1999}, 24055 journal = {SIOPT}, 24056 volume = {9(4)}, 24057 pages = {1100--1127}, 24058 url = {http://www.mcs.anl.gov/home/more/papers/nb.ps.gz} 24059} 24060 24061@TechReport{ dolan2, 24062 author = {E. Dolan and J. J. Mor\'{e}}, 24063 title = {Benchmarking Optimization Software with Performance Profiles}, 24064 year = {2001}, 24065 month = jan, 24066 number = {ANL/MCS-P861-1200}, 24067 institution = {Mathematics and Computer Science Division, Argonne National Laboratory}, 24068 address = {Argonne, IL}, 24069 url = {http://www.mcs.anl.gov/~more/cops/} 24070} 24071 24072@InProceedings{ owlqn, 24073 author = {Galen Andrew and Jianfeng Gao}, 24074 title = {Scalable training of L1-regularized log-linear models}, 24075 booktitle = {Proceedings of the 24th international conference on Machine learning (ICML)}, 24076 pages = {33--40}, 24077 year = {2007} 24078} 24079 24080@Article{ bmrm, 24081 author = {Choon Hue Teo and S.V.N. Vishwanathan and Alex J. Smola and Quoc V. Le}, 24082 title = {Bundle methods for regularized risk minimization}, 24083 year = {2010}, 24084 journal = {Journal of Machine Learning Research}, 24085 volume = {11}, 24086 pages = {311--365} 24087} 24088 24089% ------------------- Component Software References ---------------------- 24090@InProceedings{ cca99, 24091 author = {R. Armstrong and D. Gannon and A. Geist and K. Keahey and S. Kohn and L. C. 24092 McInnes and S. Parker and B. Smolinski}, 24093 title = {Toward a Common Component Architecture for High-Performance Scientific 24094 Computing}, 24095 booktitle = {Proceedings of {High Performance Distributed Computing}}, 24096 pages = {115--124}, 24097 year = {1999}, 24098 note = {See \url{http://cca-forum.org}} 24099} 24100 24101@Book{ szyperski98, 24102 author = {Clemens Szyperski}, 24103 title = {Component Software: Beyond Object-Oriented Programming}, 24104 publisher = {ACM Press}, 24105 address = {New York}, 24106 year = {1998} 24107} 24108 24109@Article{ broy98, 24110 author = {Manfred Broy and Anton Deimel and Juergen Henn and Kai Koskimies and 24111 Franti\v{s}ek Pl\'{a}\v{s}il and Gustave Pomberger and Wolfgang Pree and Michael 24112 Stal and Clemens Szyperski}, 24113 title = {What Characterizes a (Software) Component?}, 24114 journal = {Software -- Concepts and Tools}, 24115 publisher = {Springer-Verlag}, 24116 year = {1998}, 24117 volume = {19}, 24118 pages = {49--56} 24119} 24120 24121@Article{ componentware:94, 24122 author = {Jon Udell}, 24123 title = {Componentware}, 24124 journal = {Byte}, 24125 volume = {may}, 24126 pages = {46--56}, 24127 year = {1994}, 24128 key = {Udell94 ! componentware} 24129} 24130 24131@Misc{ cca-web-page, 24132 author = {{Common Component Architecture Forum}}, 24133 note = {See \url{http://cca-forum.org}} 24134} 24135 24136% --------------- References for Tools Used by TAO Developers ----------------- 24137 24138% 24139% tohtml: Used to generate on-line TAO users manual and manual pages 24140% 24141@TechReport{ tohtml, 24142 author = {William Gropp}, 24143 title = {Users Manual for tohtml: Producing true hypertext documents from {LaTeX}}, 24144 institution = {Argonne National Laboratory}, 24145 number = {ANL/MCS-TM-00}, 24146 month = jan, 24147 year = {1995}, 24148 key = {tohtml} 24149} 24150 24151% 24152% doctext: Used to generate tex version of TAO manual pages 24153% 24154@TechReport{ doctext, 24155 author = {William Gropp}, 24156 title = {Users Manual for doctext: Producing documentation from {C} source code}, 24157 institution = {Argonne National Laboratory}, 24158 number = {ANL/MCS-TM-00}, 24159 month = jan, 24160 year = {1995}, 24161 key = {doctext} 24162} 24163 24164% 24165% bfort: Used to generate TAO Fortran interface 24166% 24167@TechReport{ bfort, 24168 author = {William Gropp}, 24169 title = {Users Manual for bfort: Producing {F}ortran interfaces to {C} source code}, 24170 institution = {Argonne National Laboratory}, 24171 number = {ANL/MCS-TM-208}, 24172 month = mar, 24173 year = {1995}, 24174 key = {doctext} 24175} 24176 24177% ------------------------- PETSc References ------------------------------ 24178@InProceedings{ petsc, 24179 author = {Satish Balay and William D. Gropp and Lois Curfman McInnes and Barry F. Smith}, 24180 title = {Efficient Management of Parallelism in Object Oriented Numerical Software 24181 Libraries}, 24182 booktitle = {Modern Software Tools in Scientific Computing}, 24183 editor = {E. Arge and A. M. Bruaset and H. P. Langtangen}, 24184 publisher = {Birkhauser Press}, 24185 pages = {163--202}, 24186 year = {1997} 24187} 24188 24189% ------------------------- Misc Other References ------------------------------ 24190@Misc{ indeps-web-page, 24191 title = {{InDEPS} {W}eb page}, 24192 note = {http://z.ca.sandia.gov/\~{ }indeps/}, 24193 author = {et al. Robert Armstrong}, 24194 institution = {Sandia National Laboratory}, 24195 key = {{InDEPS} {W}eb page} 24196} 24197 24198@Misc{ pooma, 24199 title = {{POOMA}: {A} FrameWork for scientific computing applications on parallel ar 24200 chitectures}, 24201 year = {1996}, 24202 author = {J. V. W. Reynders and J. C. Cummings and P. J. Hinker and M. Tholburn a nd M. S. 24203 S. Banerjee and S. Karmesin and S. Atlas and K. Keahey and W. F. Humphr ey} 24204} 24205 24206@Misc{ isis++-web-page, 24207 title = {{ISIS++} {W}eb Page}, 24208 note = {See \url{http://ca.sandia.gov/isis}}, 24209 author = {Robert L. Clay and Kyran Mish and Alan B. Williams}, 24210 institution = {Sandia National Laboratories} 24211} 24212 24213@Misc{ trilinos-web-page, 24214 title = {{Trilinos} {W}eb Page}, 24215 note = {See 24216 \url{http://www.cs.sandia.gov/\~mheroux/Trilinos/doc/TrilinosIntroduction.htm}}, 24217 author = {Mike Heroux et al.}, 24218 institution = {Sandia National Laboratories} 24219} 24220 24221@Misc{ alice-web-page, 24222 title = {{ALICE} {W}eb page}, 24223 note = {http://www.mcs.anl.gov/\-alice, Mathematics and Computer Science Division, 24224 Argonne National Laboratory}, 24225 key = {{ALICE} {W}eb page} 24226} 24227 24228@Misc{ autodiff-webpage, 24229 author = {{Computational Differentiation Project}}, 24230 note = {See \url{http://www.mcs.anl.gov/autodiff}} 24231} 24232 24233@Misc{ coool-home-page, 24234 author = {Lydia Deng and Wences Gouveia and John Scales}, 24235 title = {{The CWP Object-Oriented Optimization Library}}, 24236 note = {See \url{http://www.cwp.mines.edu/cwpcodes/coool}} 24237} 24238 24239@Misc{ rice-inversion-home-page, 24240 author = {Mark S. Gokenbach and William W. Symes}, 24241 title = {{The Hilbert Class Library}}, 24242 note = {See \url{http://www.trip.caam.rice.edu/}} 24243} 24244 24245@Misc{ opt++-home-page, 24246 author = {{OPT++: An Object-Oriented Nonlinear Optimization Library}}, 24247 note = {See \url{http://csmr.ca.sandia.gov/projects/opt/opt++.html}} 24248} 24249 24250@Article{ gockenbach:1999:ccl, 24251 author = {Mark S. Gockenbach and Matthew J. Petro and William W. Symes}, 24252 title = {C++ Classes for Linking Optimization with Complex Simulations}, 24253 journal = {{ACM} Transactions on Mathematical Software}, 24254 volume = {25}, 24255 number = {2}, 24256 month = jun, 24257 year = {1999}, 24258 pages = {191-212}, 24259 abstract = {The object-oriented programming paradigm can be used to overcome the 24260 incompatibilities between off-the-shelf optimization software and application 24261 software. The Hilbert Class Library (HCL) defines the fundamental mathematical 24262 objects arising in optimization problems, such as vectors, linear operators, and 24263 so forth, as C++ classes, making it possible to write optimization code in a 24264 natural fashion, while allowing application software such as simulators to use the 24265 most convenient data structures and programming style. In spite of the poor 24266 reputation C++ has for runtime performance, the use of mixed-language programming 24267 allows performance equal to that achieved by standard Fortran packages, as 24268 comparisons with the popular code LBFGS and ARPACK demonstrate.}, 24269 accepted = {April 1999}, 24270 url = {http://www.acm.org/pubs/citations/journals/toms/1999-25-2/p191-gockenbach/} 24271} 24272 24273@Misc{ neos-guide, 24274 author = {{The Optimization Software Guide}}, 24275 note = {See \url{http://www.mcs.anl.gov/otc/Guide/}} 24276} 24277 24278@Article{ boyd, 24279 title = {Distributed optimization and statistical learning via the alternating direction 24280 method of multipliers}, 24281 author = {Boyd, Stephen and Parikh, Neal and Chu, Eric and Peleato, Borja and Eckstein, 24282 Jonathan and others}, 24283 journal = {Foundations and Trends{\textregistered} in Machine learning}, 24284 volume = {3}, 24285 number = {1}, 24286 pages = {1-122}, 24287 year = {2011}, 24288 publisher = {Now Publishers, Inc.} 24289} 24290 24291@Misc{ :alertsys, 24292 title = {page{ALERT}}, 24293 organization = {Alert Systems, Inc}, 24294 address = {Madison, Wisconsin}, 24295 note = {http://www.alertsys.com/} 24296} 24297 24298@Manual{ :cmfortran, 24299 title = {{CM} {F}ortran Language Reference Manual}, 24300 organization = {Thinking Machines Corporation}, 24301 year = {1994}, 24302 address = {Cambridge, MA} 24303} 24304 24305@Manual{ :cmmd, 24306 title = {{CMMD} Reference Manual, Version 3.0}, 24307 organization = {Thinking Machines Corporation}, 24308 year = {1993}, 24309 address = {Cambridge, MA} 24310} 24311 24312@Manual{ :cmssl, 24313 title = {{CMSSL} for {CM} {F}ortran}, 24314 volume = {I}, 24315 organization = {Thinking Machines Corporation}, 24316 year = {1994}, 24317 address = {Cambridge, MA} 24318} 24319 24320@Misc{ :condor, 24321 author = {M. Livny}, 24322 title = {{PI}, The {Condor} Project, High Throughput Computing}, 24323 howpublished = {www.cs.wisc.edu/condor} 24324} 24325 24326@Manual{ :connection, 24327 title = {Connection Machine {CM}--5 Technical Summary}, 24328 organization = {Thinking Machines Corporation}, 24329 year = {1993}, 24330 address = {Cambridge, MA} 24331} 24332 24333@Manual{ :cplex, 24334 title = {{CPLEX} Optimizer}, 24335 organization = {ILOG CPLEX Division}, 24336 address = {889 Alder Avenue, Incline Village, Nevada}, 24337 note = {http://www.cplex.com/} 24338} 24339 24340@Manual{ :cplextm, 24341 title = {Using the {CPLEX(TM)} Linear Optimizer and {CPLEX(TM)} Mixed Integer Optimizer 24342 (Version 2.0)}, 24343 organization = {CPLEX Optimization Inc.}, 24344 year = {1992}, 24345 address = {Incline Village, Nevada} 24346} 24347 24348@Misc{ :fatcop, 24349 author = {M. C. Ferris}, 24350 title = {{PI}, {FATCOP}: {A} Fault Tolerant {Condor} {PVM} Mixed Integer Programming 24351 Solver}, 24352 howpublished = {www.cs.wisc.edu/math-prog/fatcop} 24353} 24354 24355@Misc{ :metaneos, 24356 author = {S. J. Wright}, 24357 title = {{metaNEOS}: Metacomputing Environments for Optimization}, 24358 howpublished = {www-unix.mcs.anl.gov/metaneos} 24359} 24360 24361@InCollection{ gropp.more:optimization, 24362 author = {W. Gropp and J. J. Mor\'e}, 24363 title = {Optimization environments and the {NEOS} Server}, 24364 booktitle = {Approximation Theory and Optimization}, 24365 pages = {167--182}, 24366 publisher = {Cambridge University Press}, 24367 year = {1997}, 24368 editor = {M. D. Buhmann and A. Iserles} 24369} 24370 24371@Article{ czyzyk.mesnier.ea:neos, 24372 author = {J. Czyzyk and M. P. Mesnier and J. J. Mor\'e}, 24373 title = {The {NEOS} Server}, 24374 journal = {IEEE Journal on Computational Science and Engineering}, 24375 volume = {5}, 24376 year = {1998}, 24377 pages = {68--75} 24378} 24379 24380@Book{ :osl, 24381 title = {Handbook for {IBM OSL}}, 24382 author = {M. S. Hung and W. O. Rom and A. D. Warren}, 24383 year = {1994}, 24384 publisher = {Boyd and Fraser}, 24385 address = {Danvers, Massachusetts} 24386} 24387 24388@Manual{ :pro-matlab, 24389 title = {{PRO}--{MATLAB} User's Guide}, 24390 organization = {The MathWorks, Inc.}, 24391 year = {1989}, 24392 address = {21 Eliot Street, South Natick, MA 01760} 24393} 24394 24395@Misc{ :prostate, 24396 key = {Biomedical}, 24397 title = {Biomedical Business International Newsletter}, 24398 howpublished = {pp. 72--75}, 24399 year = {1996} 24400} 24401 24402@Misc{ :sipcase, 24403 key = {Natural}, 24404 title = {Natural Gas Planning: An Application of Stochastic Linear Programming}, 24405 howpublished = {http://www-fp.mcs.anl.gov/otc/Guide/CaseStudies/slp/index.html} 24406} 24407 24408@Book{ aarts.korst:simulated, 24409 author = {E. Aarts and J. Korst}, 24410 title = {Simulated Annealing and Boltzman Machines}, 24411 year = {1990}, 24412 publisher = {John Wiley \& Sons}, 24413 address = {Chichester} 24414} 24415 24416@TechReport{ aarts.laarhoven.ea:local-search-based, 24417 author = {E. H. L. Aarts and P. J. M. van Laarhoven and N. L. J. Ulder}, 24418 title = {Local-Search-Based Algorithms for Job Shop Scheduling}, 24419 institution = {Centre for Quantitative Methods}, 24420 year = {1991}, 24421 address = {Nederlandse Philips Bedrijven B.V., P.O. Box 218, NL-5600 MD Eindhoven}, 24422 number = {106}, 24423 type = {CQM-Not} 24424} 24425 24426@Article{ aashtiani.magnanti:equilibria, 24427 author = {H. Z. Aashtiani and T. L. Magnanti}, 24428 title = {Equilibria on a congested transportation network}, 24429 journal = {SIAM Journal on Algebraic and Discrete Methods}, 24430 volume = {2}, 24431 year = {1981}, 24432 pages = {213--226} 24433} 24434 24435@Article{ ablow.brigham:analog, 24436 author = {C. M. Ablow and G. Brigham}, 24437 title = {An Analog Solution of Programming Problems}, 24438 journal = {Operations Research}, 24439 year = {1955}, 24440 volume = {3}, 24441 pages = {388--394} 24442} 24443 24444@Article{ achuthan.grabowski.ea:optimal, 24445 author = {N. R. Achuthan and J. Grabowski and J. B. Sidney}, 24446 title = {Optimal Flow--Shop Scheduling with Earliness and Tardiness Penalties}, 24447 journal = {Opsearch}, 24448 year = {1981}, 24449 volume = {18}, 24450 pages = {117--138} 24451} 24452 24453@Book{ adelman.robinson:income, 24454 author = {I. Adelman and S. Robinson}, 24455 title = {Income Distribution Policy in Developing Countries}, 24456 publisher = {Stanford University Press}, 24457 year = {1978}, 24458 address = {Stanford, California} 24459} 24460 24461@Article{ adler.resende.ea:implementation, 24462 author = {I. Adler and M. G. C. Resende and G. Veiga and N. K. Karmarkar}, 24463 title = {An Implementation of {K}armarkar's Algorithm for Linear Programming}, 24464 journal = {Mathematical Programming}, 24465 year = {1989}, 24466 volume = {44}, 24467 pages = {297--336} 24468} 24469 24470@TechReport{ aeberhard.coomans.ea:comparison, 24471 author = {S. Aeberhard and D. Coomans and O. de Vel}, 24472 title = {Comparison of Classifiers in High Dimensional Settings}, 24473 institution = {Departments of Computer Science and of Mathematics and Statistics, James Cook 24474 University of North Queensland}, 24475 year = {1992}, 24476 number = {92-02}, 24477 type = {Technical Report} 24478} 24479 24480@Article{ aganagic.cottle:constructive, 24481 author = {M. Aganagi\'{c} and R. W. Cottle}, 24482 title = {A Constructive Characterization of ${Q}_0$ Matrices with Nonnegative Principal 24483 Minors}, 24484 journal = {Mathematical Programming}, 24485 year = {1987}, 24486 volume = {37}, 24487 pages = {223--231} 24488} 24489 24490@TechReport{ aganagic:iterative, 24491 author = {M. Aganagi\'{c}}, 24492 title = {Iterative Methods for the Linear Complementarity Problem}, 24493 institution = {Systems Optimization Laboratory, Department of Operations Research, Stanford 24494 University}, 24495 year = {1978}, 24496 type = {SOL}, 24497 number = {78-10}, 24498 address = {Stanford, California} 24499} 24500 24501@Book{ ahlfors:complex, 24502 author = {L. V. Ahlfors}, 24503 title = {Complex Analysis}, 24504 publisher = {McGraw--Hill Book Company}, 24505 address = {New York}, 24506 series = {International Series in Pure and Applied Mathematics}, 24507 edition = {Second}, 24508 year = {1966} 24509} 24510 24511@Article{ ahn:solution, 24512 author = {B--H. Ahn}, 24513 title = {Solution of Non--Symmetric Linear Complementarity Problems by Iterative Methods}, 24514 journal = {Journal of Optimization Theory and Applications}, 24515 year = {1981}, 24516 volume = {33}, 24517 pages = {175--185} 24518} 24519 24520@Article{ al-fahed.stavroulakis.ea:hard, 24521 author = {A. M. Al-Fahed and G. E. Stavroulakis and P. D. Panagiotopoulos}, 24522 title = {Hard and soft fingered robot grippers. The linear complementarity approach}, 24523 journal = {Zeitschrift f{\"{u}}r Angewandte Mathematik und Mechanik}, 24524 volume = {71}, 24525 year = {1991}, 24526 pages = {257--265} 24527} 24528 24529@Article{ al-fahed.stavroulakis.ea:linear, 24530 author = {A. M. Al-Fahed and G. E. Stavroulakis and P. D. Panagiotopoulos}, 24531 title = {A linear complementarity approach to the frictionless gripper}, 24532 journal = {International Journal of Robotic Research}, 24533 volume = {11}, 24534 year = {1992}, 24535 pages = {112--122} 24536} 24537 24538@Article{ al-khayyal.falk:jointly, 24539 author = {F. A. Al--Khayyal and J. E. Falk}, 24540 title = {Jointly Constrained Biconvex Programming}, 24541 journal = {Mathematics of Operations Research}, 24542 year = {1983}, 24543 volume = {8}, 24544 pages = {273--286} 24545} 24546 24547@Article{ al-khayyal.kyparisis:finite, 24548 author = {F. A. Al--Khayyal and J. Kyparisis}, 24549 title = {Finite Convergence of Algorithms for Nonlinear Programs and Variational 24550 Inequalities}, 24551 journal = {Journal of Optimization Theory and Applications}, 24552 year = {1991}, 24553 volume = {70}, 24554 pages = {319--332} 24555} 24556 24557@PhDThesis{ al-khayyal:biconvex, 24558 author = {F. A. Al--Khayyal}, 24559 title = {Biconvex Programming and Biconcave Minimization}, 24560 year = {1977}, 24561 school = {The George Washington University} 24562} 24563 24564@Article{ alart.curnier:mixed, 24565 author = {P. Alart and A. Curnier}, 24566 title = {A mixed formulation for frictional contact problems prone to {N}ewton like 24567 solution methods}, 24568 journal = {Computer Methods in Applied Mechanics and Engineering}, 24569 volume = {92}, 24570 year = {1991}, 24571 pages = {353--375} 24572} 24573 24574@Misc{ alexander.kellog.ea:piecewise, 24575 author = {J.~C. Alexander and R.~B. Kellog and T.-Y. Li and J~.A. Yorke}, 24576 title = {Piecewise smooth continuation}, 24577 howpublished = {Manuscript}, 24578 year = {1979} 24579} 24580 24581@InCollection{ alexander.li.ea:piecewise, 24582 author = {J.~C. Alexander and T.-Y. Li and J~.A. Yorke}, 24583 title = {Piecewise smooth homotopies}, 24584 booktitle = {Homotopy Methods and Global Convergence}, 24585 pages = {1--14}, 24586 publisher = {Plenum Press}, 24587 year = {1983}, 24588 editor = {B.~C. Eaves and F.~J. Gould and H.-O. Peitgen and M.~J. Todd}, 24589 address = {New York} 24590} 24591 24592@InCollection{ alexander:topological, 24593 author = {J.~C. Alexander}, 24594 title = {The topological theory of an embedding method}, 24595 booktitle = {Continuation Methods}, 24596 pages = {37--68}, 24597 publisher = {Academic Press}, 24598 year = {1978}, 24599 editor = {H. Wacker}, 24600 address = {New York} 24601} 24602 24603@Book{ allen:probability, 24604 author = {A. O. Allen}, 24605 title = {Probability, Statistics and Queueing Theory}, 24606 publisher = {Academic Press}, 24607 year = {1990}, 24608 address = {London}, 24609 edition = {Second} 24610} 24611 24612@Book{ allgower.georg:numerical, 24613 author = {E. L. Allgower and K. Georg}, 24614 title = {Numerical Continuation Methods, An Introduction}, 24615 publisher = {Springer-Verlag}, 24616 year = {1990}, 24617 address = {Berlin} 24618} 24619 24620@InProceedings{ allgower.georg:predictor-corrector, 24621 crossref = {bachem.grotschel.ea:mathematical}, 24622 author = {E. L. Allgower and K. Georg}, 24623 title = {Predictor--Corrector and Simplicial Methods for Approximating Fixed Points and 24624 Zero Points of Nonlinear Mappings}, 24625 pages = {15--56} 24626} 24627 24628@Article{ aluffi-pentini.parisi.ea:algorithm, 24629 author = {F. Aluffi-Pentini and V. Parisi and F. Zirilli}, 24630 title = {Algorithm 667: {SIGMA}- {A} Stochastic-Integration Global Minimization 24631 Algorithm}, 24632 journal = {ACM Transactions on Mathematical Software}, 24633 year = {1988}, 24634 volume = {14}, 24635 pages = {366--380} 24636} 24637 24638@Article{ anandalingam.friesz:hierarchical, 24639 author = {G. Anandalingam and T. L. Friesz}, 24640 title = {Hierarchical Optimization: An Introduction}, 24641 journal = {Annals of Operations Research}, 24642 year = {1992}, 24643 volume = {34}, 24644 pages = {1--11} 24645} 24646 24647@Article{ anandalingam.white:solution, 24648 author = {G. Anandalingam and D. J. White}, 24649 title = {A Solution Method for the Linear Static Stackelberg Problem Using Penalty 24650 Functions}, 24651 journal = {IEEE Transactions on Automatic Control}, 24652 year = {1990}, 24653 volume = {35}, 24654 number = {10}, 24655 pages = {1170--1173} 24656} 24657 24658@Article{ andersen.andersen:presolving, 24659 author = {E. Andersen and K. Andersen}, 24660 title = {Presolving in Linear Programming}, 24661 year = {1995}, 24662 journal = {Mathematical Programming}, 24663 volume = {71}, 24664 pages = {221--245} 24665} 24666 24667@InProceedings{ andersen.ye:homogeneous, 24668 author = {E. Andersen and Y. Ye}, 24669 title = {On a Homogeneous Algorithm for a Monotone Complementarity Problem with Nonlinear 24670 Equality Constraints}, 24671 crossref = {ferris.pang:complementarity}, 24672 pages = {1--11} 24673} 24674 24675@Book{ anderson.bai.ea:lapack, 24676 author = {E. Anderson and Z. Bai and C. Bischof and J. Demmel and J. Dongarra and J. Du 24677 Cros and A. Greenbaum and S. Hammarling and A. McKenney and S. Ostrouchov and D. 24678 Sorensen}, 24679 title = {{LAPACK} User's Guide}, 24680 publisher = {SIAM}, 24681 year = {1995}, 24682 address = {Philadelphia, Pennsylvania}, 24683 edition = {Second} 24684} 24685 24686@Article{ anderson.ferris:direct, 24687 author = {E. J. Anderson and M. C. Ferris}, 24688 title = {A Direct Search Algorithm for Optimization with Noisy Function Evaluations}, 24689 year = {2001}, 24690 journal = {SIAM Journal on Optimization, forthcoming}, 24691 url = {ftp://ftp.cs.wisc.edu/math-prog/tech-reports/96-11.ps}, 24692 key = {55} 24693} 24694 24695@InProceedings{ anderson.ferris:genetic, 24696 author = {E. J. Anderson and M. C. Ferris}, 24697 title = {A Genetic Algorithm for the Assembly Line Balancing Problem}, 24698 booktitle = {Proceedings of the Integer Programming / Combinatorial Optimization Conference, 24699 Waterloo, Ontario, Canada, May 28--30}, 24700 publisher = {University of Waterloo Press}, 24701 key = {14}, 24702 year = {1990} 24703} 24704 24705@Article{ anderson.ferris:genetic*1, 24706 author = {E. J. Anderson and M. C. Ferris}, 24707 title = {Genetic Algorithms for Combinatorial Optimization: The Assembly Line Balancing 24708 Problem}, 24709 journal = {ORSA Journal on Computing}, 24710 year = {1994}, 24711 url = {ftp: //ftp.cs.wisc.edu/math-prog/tech-reports/93-ga.ps}, 24712 volume = {6}, 24713 pages = {161--173}, 24714 key = {22} 24715} 24716 24717@InProceedings{ anderson.ferris:parallel, 24718 author = {E. J. Anderson and M. C. Ferris}, 24719 title = {Parallel Genetic Algorithms in Optimization}, 24720 booktitle = {Proceedings of the Fourth SIAM conference on Parallel Processing for Scientific 24721 Computing, Chicago, Illinois, December 11-13}, 24722 year = {1989}, 24723 key = {12} 24724} 24725 24726@Unpublished{ anderson.lewis:primal, 24727 author = {E. J. Anderson and A. S. Lewis}, 24728 title = {A New Primal Algorithm for Semi-Infinite Linear Programming}, 24729 note = {In preparation} 24730} 24731 24732@Book{ anderson.nash:linear, 24733 author = {E. J. Anderson and P. Nash}, 24734 title = {Linear Programming in Infinite--Dimensional Spaces}, 24735 year = {1987}, 24736 publisher = {John Wiley \& Sons}, 24737 address = {Chichester} 24738} 24739 24740@InProceedings{ anderson:primal, 24741 author = {E. J. Anderson}, 24742 title = {A New Primal Algorithm for Semi-Infinite Linear Programming}, 24743 booktitle = {Proceedings of an International Symposium on Infinite Dimensional Linear 24744 Programming, Cambridge, September 1984}, 24745 year = {1985}, 24746 editor = {E. J. Anderson and A. B. Philpott}, 24747 publisher = {Springer-Verlag}, 24748 address = {Berlin} 24749} 24750 24751@Article{ andradottir:method, 24752 author = {S. Andrad\'{o}ttir}, 24753 title = {A Method of Discrete Stochastic Optimization}, 24754 journal = {Management Science}, 24755 year = {1995}, 24756 volume = {41}, 24757 pages = {1946--1961} 24758} 24759 24760@Article{ andradottir:global, 24761 author = {S. Andrad\'{o}ttir}, 24762 title = {A Global Search Method for Discrete Stochastic Optimization}, 24763 journal = {SIAM Journal on Optimization}, 24764 year = {1996}, 24765 volume = {6}, 24766 pages = {513--530} 24767} 24768 24769@TechReport{ anitescu.lesaja.ea:infeasible-interior-point, 24770 author = {M. Anitescu and G. Lesaja and F. A. Potra}, 24771 title = {An infeasible--interior--point predictor--corrector algorithm for the 24772 {P}$_x$--geometric {LCP}}, 24773 institution = {Department of Mathematics, The University of Iowa}, 24774 address = {Iowa City, Iowa}, 24775 year = {1994}, 24776 number = {62}, 24777 type = {Reports on Computational Mathematics} 24778} 24779 24780@TechReport{ anitescu.potra:formulating, 24781 author = {M. Anitescu and F. A. Potra}, 24782 title = {Formulating Dynamic Multi-Rigid-Body Contact Problems with Friction as Solvable 24783 Linear Complementarity Problems}, 24784 institution = {Department of Mathematics, The University of Iowa}, 24785 year = {1996}, 24786 type = {Report}, 24787 number = {93}, 24788 address = {Iowa City, Iowa} 24789} 24790 24791@Article{ anstreicher.lee.ea:crashing, 24792 author = {K. M. Anstreicher and J. Lee and T. F. Rutherford}, 24793 title = {Crashing a Maximum-Weight Complementarity Basis}, 24794 journal = {Mathematical Programming}, 24795 year = {1992}, 24796 volume = {54}, 24797 pages = {281--294} 24798} 24799 24800@Article{ anstreicher:combined, 24801 author = {K. M. Anstreicher}, 24802 title = {A combined phase {I}--phase {II} scaled potential algorithm for linear 24803 programming}, 24804 journal = {Mathematical Programming}, 24805 year = {1991}, 24806 volume = {52}, 24807 pages = {429--440} 24808} 24809 24810@Article{ anstreicher:combined*1, 24811 author = {K. M. Anstreicher}, 24812 title = {A combined phase {I}--phase {II} projective algorithm for linear programming}, 24813 journal = {Mathematical Programming}, 24814 year = {1989}, 24815 volume = {43}, 24816 pages = {209--223} 24817} 24818 24819@InCollection{ arbenz.gander.ea:remote, 24820 author = {P. Arbenz and W. Gander and M. Oettli}, 24821 title = {The Remote Computational System}, 24822 booktitle = {High-Performance Computation and Networks}, 24823 publisher = {Springer-Verlag}, 24824 year = {1996}, 24825 volume = {1067}, 24826 series = {Lecture Notes in Computer Science}, 24827 pages = {662--667} 24828} 24829 24830@InCollection{ arcus:comsoal, 24831 author = {A. L. Arcus}, 24832 title = {{COMSOAL}: {A} Computer Method of Sequencing Operations for Assembly Lines}, 24833 booktitle = {Readings in Production and Operations Management}, 24834 year = {1966}, 24835 editor = {E. S. Buffa}, 24836 publisher = {John Wiley \& Sons}, 24837 address = {New York} 24838} 24839 24840@TechReport{ arioli.chan.ea:computing, 24841 author = {M. Arioli and T. F. Chan and I. S. Duff and N. I. M. Gould and J. K. Reid}, 24842 title = {Computing a Search Direction for Large-Scale Linearly-Constrained Nonlinear 24843 Optimization Calculations}, 24844 institution = {CERFACS}, 24845 year = {1993}, 24846 number = {TR/PA/93/34} 24847} 24848 24849@Article{ armijo:minimization, 24850 author = {L. Armijo}, 24851 title = {Minimization of Functions having {L}ipschitz-continuous First Partial 24852 Derivatives}, 24853 journal = {Pacific Journal of Mathematics}, 24854 year = {1966}, 24855 volume = {16}, 24856 pages = {1--3} 24857} 24858 24859@Article{ arrow.debreu:existence, 24860 author = {K. Arrow and G. Debreu}, 24861 title = {Existence of Equilibrium for a Competitive Economy}, 24862 journal = {Econometrica}, 24863 year = {1954}, 24864 volume = {22}, 24865 pages = {265--290} 24866} 24867 24868@InCollection{ arrow.solow:gradient, 24869 author = {K. J. Arrow and R. M. Solow}, 24870 title = {Gradient Methods for Constrained Maxima with Weakened Assumptions}, 24871 booktitle = {Studies in Linear and Nonlinear Programming}, 24872 year = {1958}, 24873 editor = {K. J. Arrow and L. Hurwicz and H. Uzawa}, 24874 publisher = {Stanford University Press}, 24875 address = {Stanford, California}, 24876 pages = {166--176} 24877} 24878 24879@Book{ aubin.ekeland:nonlinear, 24880 author = {J.-P. Aubin and I. Ekeland}, 24881 title = {Applied nonlinear analysis}, 24882 publisher = {John Wiley \& Sons}, 24883 address = {New York}, 24884 year = {1984} 24885} 24886 24887@Article{ auchmuty:variational, 24888 author = {G. Auchmuty}, 24889 title = {Variational Principles for Variational Inequalities}, 24890 journal = {Numerical Functional Analysis and Optimization}, 24891 year = {1989}, 24892 volume = {10}, 24893 pages = {863--874} 24894} 24895 24896@Book{ auerbach.kotlikoff:dynamic, 24897 author = {A. J. Auerbach and L. J. Kotlikoff}, 24898 title = {Dynamic Fiscal Policy}, 24899 publisher = {Cambridge University Press}, 24900 address = {Cambridge, England}, 24901 year = {1987} 24902} 24903 24904@InProceedings{ ault.deutsch.ea:interpolating, 24905 author = {D. A. Ault and F. R. Deutsch and P. D. Morris and J. E. Olson}, 24906 title = {Interpolating Subspaces in Approximation Theory}, 24907 booktitle = {Approximation Theory}, 24908 year = {1970}, 24909 editor = {A. Talbot}, 24910 publisher = {Academic Press}, 24911 address = {London} 24912} 24913 24914@Article{ auslender.crouzeix:global, 24915 author = {A. A. Auslender and J.--P. Crouzeix}, 24916 title = {Global Regularity Theorems}, 24917 journal = {Mathematics of Operations Research}, 24918 year = {1988}, 24919 volume = {13}, 24920 pages = {243--253} 24921} 24922 24923@Article{ auslender.haddou:interior-proximal, 24924 author = {A. Auslender and M. Haddou}, 24925 title = {An interior-proximal method for convex linearly constrained problems and its 24926 extension to variational inequalities}, 24927 year = {1995}, 24928 journal = {Mathematical Programming}, 24929 pages = {77--100}, 24930 volume = {71} 24931} 24932 24933@Article{ auslender:convergence, 24934 author = {A. Auslender}, 24935 title = {Convergence of stationary sequences for variational inequalities with maximal 24936 monotone operators}, 24937 journal = {Applied Mathematics and Optimization}, 24938 volume = {28}, 24939 year = {1993}, 24940 pages = {161--172} 24941} 24942 24943@Book{ auslender:optimization, 24944 author = {A. Auslender}, 24945 title = {Optimization {M}\'{e}thodes Num\'{e}riques}, 24946 year = {1976}, 24947 publisher = {Masson}, 24948 address = {Paris} 24949} 24950 24951@TechReport{ averick.carter.ea:minpack-2, 24952 author = {B. M. Averick and R. G. Carter and J. J. Mor\'e and G. -L. Xue}, 24953 title = {The {MINPACK-2} Test Problem Collection}, 24954 institution = {Argonne National Laboratory}, 24955 year = {1992}, 24956 address = {Argonne, Illinois}, 24957 number = {MCS-P153-0692} 24958} 24959 24960@TechReport{ axline.billups.ea:guidelines, 24961 author = {R. A. Axline and S. C. Billups and M. F. Grady}, 24962 title = {Guidelines for Software Security ({U})}, 24963 institution = {SNL}, 24964 year = {1989}, 24965 month = oct, 24966 address = {Albuquerque, New Mexico}, 24967 number = {SAND88-2955} 24968} 24969 24970@Article{ ayres.walter:greenhouse, 24971 author = {R. U. Ayres and J. Walter}, 24972 title = {The Greenhouse Effect: Damages, Costs and Abatement}, 24973 journal = {Environmental and Resource Economics}, 24974 year = {1991}, 24975 volume = {1}, 24976 pages = {237--270} 24977} 24978 24979@PhDThesis{ bagley:behaviour, 24980 author = {J. D. Bagley}, 24981 title = {The Behaviour of Adaptive Systems which employ Genetic and Correlation 24982 Algorithms}, 24983 year = {1967}, 24984 school = {University of Michigan} 24985} 24986 24987@Article{ bain.stewart:application, 24988 author = {R. S. Bain and W. E. Stewart}, 24989 title = {Application of Robust Nonmonotonic Descent Criteria to the Solution of Nonlinear 24990 Algebraic Equation Systems}, 24991 journal = {Computers in Chemical Engineering}, 24992 year = {1991}, 24993 volume = {15}, 24994 pages = {203--208} 24995} 24996 24997@Article{ baker.lasdon:successive, 24998 author = {T. E. Baker and L. S. Lasdon}, 24999 title = {Successive Linear Programming at {E}xxon}, 25000 journal = {Management Science}, 25001 year = {1985}, 25002 volume = {31}, 25003 pages = {264--274} 25004} 25005 25006@InProceedings{ baker:reducing, 25007 crossref = {grefenstette:genetic}, 25008 author = {J. E. Baker}, 25009 title = {Reducing Bias and Inefficiency in the Selection Algorithm}, 25010 pages = {14--21} 25011} 25012 25013@Article{ balas.zemel:algorithm, 25014 author = {E. Balas and E. Zemel}, 25015 title = {An Algorithm for Large Zero--One Knapsack Problems}, 25016 journal = {Operations Research}, 25017 year = {1980}, 25018 volume = {28}, 25019 pages = {1132--1154} 25020} 25021 25022@Book{ ballard.fullerton.ea:general, 25023 author = {C. Ballard and D. Fullerton and J. B. Shoven and J. Whalley}, 25024 title = {A General Equilibrium Model for Tax Policy Evaluation}, 25025 publisher = {The University of Chicago Press}, 25026 year = {1985}, 25027 series = {National Bureau of Economic Research Monograph} 25028} 25029 25030@InProceedings{ balog.angelos.ea:dose, 25031 author = {J. Balog and L. Angelos and T. R. Mackie and P. Reckwerdt}, 25032 title = {Dose Computation for a One-Dimensional Multileaf Collimator}, 25033 booktitle = {Proceedings of the XII International Conference on the Use of Computers in 25034 Radiation Therapy, Salt Lake City}, 25035 year = {1997}, 25036 editor = {D. D. Leavitt and G. Starkshall}, 25037 publisher = {Medical Physics Publishing}, 25038 address = {St. Louis, Missouri}, 25039 pages = {323--326} 25040} 25041 25042@Article{ baraff:fast, 25043 author = {D. Baraff}, 25044 title = {Fast contact force computation for nonpenetrating rigid bodies}, 25045 journal = {Computer Graphics (Proceedings SIGRAPH)}, 25046 year = {1994}, 25047 pages = {23--34}, 25048 volume = {28} 25049} 25050 25051@Article{ baraff:issues, 25052 author = {D. Baraff}, 25053 title = {Issues in computing contact forces for nonpenetrating rigid bodies}, 25054 journal = {Algorithmica}, 25055 volume = {10}, 25056 year = {1993}, 25057 pages = {292--352} 25058} 25059 25060@Book{ barrett.berry.ea:templates, 25061 title = {Templates for the Solution of Linear Systems: Building Blocks for Iterative 25062 Methods}, 25063 author = {R. Barrett and M. Berry and T. F. Chan and J. Demmel and J. Donato and J. 25064 Dongarra and V. Eijkhout and R. Pozo and C. Romine and H. van der Vorst}, 25065 year = {1994}, 25066 publisher = {SIAM}, 25067 address = {Philadelphia, Pennsylvania} 25068} 25069 25070@Article{ bard:algorithm, 25071 author = {J. F. Bard}, 25072 title = {An Algorithm for Solving the General Bi--Level Programming Problem}, 25073 journal = {Mathematics of Operations Research}, 25074 year = {1983}, 25075 volume = {8}, 25076 pages = {260--272} 25077} 25078 25079@Article{ bard:convex, 25080 author = {J. F. Bard}, 25081 title = {Convex Two-Level Optimization}, 25082 journal = {Mathematical Programming}, 25083 year = {1988}, 25084 volume = {40}, 25085 pages = {15--27} 25086} 25087 25088@InCollection{ bard:eclectic, 25089 author = {Y. Bard}, 25090 title = {An Eclectic Approach to Nonlinear Programming}, 25091 booktitle = {Optimization}, 25092 publisher = {University of Queensland Press}, 25093 editor = {R. S. Anderson and L. S. Jennings and D. M. Ryan}, 25094 year = {1972}, 25095 address = {St. Lucia, Queensland, Australia}, 25096 pages = {116--128} 25097} 25098 25099@Article{ barnes:variation, 25100 author = {E. R. Barnes}, 25101 title = {A Variation on {K}armarkar's Algorithm for Solving Linear Programming Problems}, 25102 journal = {Mathematical Programming}, 25103 year = {1986}, 25104 volume = {36}, 25105 pages = {174--182} 25106} 25107 25108@Article{ bartels.golub:simplex, 25109 author = {R. H. Bartels and G. H. Golub}, 25110 title = {The Simplex Method of Linear Programming using {LU} Decomposition}, 25111 journal = {Communications of the Asociation for Computing Machinery}, 25112 year = {1969}, 25113 volume = {12}, 25114 pages = {266--268} 25115} 25116 25117@Article{ barton.ivey:nelder, 25118 author = {R. Barton and J. S. Ivey}, 25119 title = {{N}elder {M}ead Simplex Modifications for Simulation Optimization}, 25120 journal = {Management Science}, 25121 year = {1996}, 25122 volume = {42}, 25123 number = {7}, 25124 pages = {954--973} 25125} 25126 25127@Article{ battiti:first-, 25128 author = {R. Battiti}, 25129 title = {First- and Second-Order Methods for Learning: Between Steepest Descent and 25130 {N}ewton's Method}, 25131 journal = {Neural Computation}, 25132 year = {1992}, 25133 volume = {4}, 25134 pages = {141--166} 25135} 25136 25137@Article{ baudet:asynchronous, 25138 author = {G. M. Baudet}, 25139 title = {Asynchronous iterative methods for multiprocesors}, 25140 journal = {Journal of the Association for Computing Machinery}, 25141 year = {1978}, 25142 volume = {25}, 25143 pages = {226--244} 25144} 25145 25146@InProceedings{ baum.haussler:what, 25147 author = {E. B. Baum and D. Haussler}, 25148 title = {What Size Net Gives Valid Generalization}, 25149 booktitle = {Advances in Neural Information Processing Systems I}, 25150 year = {1989}, 25151 editor = {D. S. Touretzky}, 25152 publisher = {Morgan Kaufmann}, 25153 address = {San Mateo, California}, 25154 pages = {81--90} 25155} 25156 25157@Misc{ baum:private, 25158 author = {E. B. Baum}, 25159 title = {Private Communication}, 25160 year = {1992}, 25161 address = {NEC Research Institute, Princeton, New Jersey} 25162} 25163 25164@Book{ bazaraa.sherali.ea:nonlinear, 25165 author = {M. S. Bazaraa and H. D. Sherali and C. M. Shetty}, 25166 title = {Nonlinear Programming}, 25167 edition = {Second}, 25168 publisher = {John Wiley and Sons}, 25169 address = {New York}, 25170 year = {1993} 25171} 25172 25173@Book{ bazaraa.shetty:nonlinear, 25174 author = {M. S. Bazaraa and C. M. Shetty}, 25175 title = {Nonlinear Programming: Theory and Algorithms}, 25176 publisher = {John Wiley \& Sons}, 25177 year = {1979}, 25178 address = {New York, New York} 25179} 25180 25181@Article{ beale:cycling, 25182 author = {E. M. L. Beale}, 25183 title = {Cycling in the Dual Simplex Method}, 25184 journal = {Naval Research Logistics Quarterly}, 25185 year = {1955}, 25186 volume = {2}, 25187 pages = {103--107} 25188} 25189 25190@InProceedings{ becker.cun:improving, 25191 author = {S. Becker and Y. le Cun}, 25192 title = {Improving the Convergence of Backpropagation Learning with Second Order Methods}, 25193 booktitle = {Proceedings of 1988 Connectionist Models Summer School}, 25194 year = {1988}, 25195 editor = {D. S. Touretzky}, 25196 publisher = {Morgan Kaufmann}, 25197 address = {San Mateo, California}, 25198 pages = {29--37} 25199} 25200 25201@Book{ ben-israel.ben-tal.ea:optimality, 25202 author = {A. Ben--Israel and A. Ben--Tal and S. Zlobec}, 25203 title = {Optimality in Nonlinear Programming: {A} Feasible Directions Approach}, 25204 year = {1981}, 25205 publisher = {John Wiley \& Sons}, 25206 address = {New York} 25207} 25208 25209@Article{ ben-israel:newton-raphson, 25210 author = {A. Ben--Israel}, 25211 title = {A {N}ewton--{R}aphson Method for the Solution of Systems of Equations}, 25212 journal = {Journal of Mathematical Analysis and its Applications}, 25213 year = {1966}, 25214 volume = {15}, 25215 pages = {243--252} 25216} 25217 25218@Article{ ben-tal.melman.ea:curved, 25219 author = {A. Ben--Tal and A. Melman and J. Zowe}, 25220 title = {Curved Search Methods for Unconstrained Optimization}, 25221 journal = {Optimization}, 25222 year = {1990}, 25223 volume = {21}, 25224 pages = {669--695}, 25225 publisher = {John Wiley \& Sons}, 25226 address = {New York} 25227} 25228 25229@InProceedings{ bennett.ferris.ea:genetic, 25230 crossref = {belew.booker:fourth}, 25231 author = {K. Bennett and M. C. Ferris and Y. E. Ioannidis}, 25232 title = {A Genetic Algorithm for Database Query Optimization}, 25233 pages = {400--407}, 25234 url = {ftp: //ftp.cs.wisc.edu/tech-reports/reports/1991/tr1004.ps}, 25235 key = {19} 25236} 25237 25238@Article{ bennett.mangasarian:bilinear, 25239 author = {K. P. Bennett and O. L. Mangasarian}, 25240 title = {Bilinear Separation of Two Sets in n-Space}, 25241 journal = {Computational Optimization and Applications}, 25242 year = {1993}, 25243 volume = {2}, 25244 pages = {207--227} 25245} 25246 25247@Article{ bennett.mangasarian:multicategory, 25248 author = {K. P. Bennett and O. L. Mangasarian}, 25249 title = {Multicategory Separation via Linear Programming}, 25250 journal = {Optimization Methods and Software}, 25251 year = {1993}, 25252 volume = {3}, 25253 pages = {27--39} 25254} 25255 25256@InProceedings{ bennett.mangasarian:neural, 25257 author = {K. P. Bennett and O. L. Mangasarian}, 25258 title = {Neural Network Training via Linear Programming}, 25259 booktitle = {Advances in Optimization and Parallel Computing}, 25260 year = {1992}, 25261 editor = {P. M. Pardalos}, 25262 publisher = {North Holland}, 25263 address = {Amsterdam}, 25264 pages = {56--67} 25265} 25266 25267@Article{ bennett.mangasarian:robust, 25268 author = {K. P. Bennett and O. L. Mangasarian}, 25269 title = {Robust Linear Programming Discrimination of Two Linearly Inseparable Sets}, 25270 journal = {Optimization Methods and Software}, 25271 year = {1992}, 25272 volume = {1}, 25273 pages = {23--34} 25274} 25275 25276@Article{ bennett.mangasarian:serial, 25277 author = {K. P. Bennett and O. L. Mangasarian}, 25278 title = {Serial and Parallel Multicategory Separation}, 25279 journal = {SIAM Journal on Optimization}, 25280 year = {1994}, 25281 volume = {4}, 25282 pages = {722--734} 25283} 25284 25285@TechReport{ bennett.wu.ea:support, 25286 author = {K. P. Bennett and D. Wu and L. Auslender}, 25287 title = {On Support Vector Decision Trees for Database Marketing}, 25288 institution = {Department of Mathematical Sciences, Rensselaer Polytechnic Institute}, 25289 year = {1998}, 25290 optkey = {}, 25291 opttype = {RPI Math Report}, 25292 optnumber = {98-100}, 25293 optaddress = {Troy, New York}, 25294 optmonth = {}, 25295 optnote = {}, 25296 optannote = {} 25297} 25298 25299@InProceedings{ bennett:decision, 25300 author = {K. P. Bennett}, 25301 title = {Decision Tree Construction Via Linear Programming}, 25302 booktitle = {Proceedings of the 4th Midwest Artificial Intelligence and Cognitive Science 25303 Society Conference}, 25304 year = {1992}, 25305 editor = {M. Evans}, 25306 address = {Utica, Illinois}, 25307 pages = {97--101} 25308} 25309 25310@Book{ berge.ghouila-houri:programming, 25311 author = {C. Berge and A. Ghouila-Houri}, 25312 title = {Programming, Games and Transportation Networks}, 25313 year = {1965}, 25314 publisher = {John Wiley \& Sons}, 25315 address = {New York} 25316} 25317 25318@Book{ berge:topological, 25319 author = {C. Berge}, 25320 title = {Topological Spaces}, 25321 year = {1963}, 25322 publisher = {McMillan}, 25323 address = {New York} 25324} 25325 25326@TechReport{ berkelaar.jansen.ea:basis, 25327 author = {A. B. Berkelaar and B. Jansen and C. Roos and T. Terlaky}, 25328 title = {Basis and Tripartition Identification for Quadratic Programming and Linear 25329 Complementarity Problems}, 25330 institution = {Department of Econometrics and Operations Research}, 25331 year = {1996}, 25332 address = {Erasmus University, Rotterdam, The Netherlands} 25333} 25334 25335@Article{ bertsekas.baz:distributed, 25336 author = {D. P. Bertsekas and D. El Baz}, 25337 title = {Distributed Asynchronous Relaxation Methods for the Convex Network Flow Problem}, 25338 journal = {SIAM Journal on Control and Optimization}, 25339 year = {1987}, 25340 volume = {25}, 25341 pages = {74--85} 25342} 25343 25344@Article{ bertsekas.gafni:projection, 25345 author = {D. P. Bertsekas and E. M. Gafni}, 25346 title = {Projection Methods for Variational Inequalities with Application to the Traffic 25347 Assignment Problem}, 25348 journal = {Mathematical Programming Study}, 25349 year = {1982}, 25350 volume = {17}, 25351 pages = {139--159} 25352} 25353 25354@Article{ bertsekas.hossein.ea:relaxation, 25355 author = {D. P. Bertsekas and P. Hossein and P. Tseng}, 25356 title = {Relaxation Methods for Network Flow Problems with Convex Arc Costs}, 25357 journal = {SIAM Journal on Control and Optimization}, 25358 year = {1987}, 25359 volume = {25}, 25360 pages = {1219--1243} 25361} 25362 25363@Unpublished{ bertsekas.tseng:partial, 25364 author = {D. P. Bertsekas and P. Tseng}, 25365 title = {Partial Proximal Minimization for Convex Programming}, 25366 year = {1991}, 25367 note = {Manuscript} 25368} 25369 25370@Article{ bertsekas.tsitsiklis:analysis, 25371 author = {D. P. Bertsekas and J. N. Tsitsiklis}, 25372 title = {An Analysis of Stochastic Shortest Path Problems}, 25373 journal = {Mathematics of Operations Research}, 25374 year = {1991}, 25375 volume = {16}, 25376 pages = {580--595} 25377} 25378 25379@Book{ bertsekas.tsitsiklis:parallel, 25380 author = {D. P. Bertsekas and J. N. Tsitsiklis}, 25381 title = {Parallel and Distributed Computation: Numerical Methods}, 25382 publisher = {Prentice-Hall, Inc}, 25383 year = {1989}, 25384 address = {Englewood Cliffs, New Jersey} 25385} 25386 25387@Book{ bertsekas:constrained, 25388 author = {D. P. Bertsekas}, 25389 title = {Constrained Optimization and Lagrange Multiplier Methods}, 25390 year = {1982}, 25391 publisher = {Academic Press}, 25392 address = {New York} 25393} 25394 25395@Book{ bertsekas:dynamic, 25396 author = {D. P. Bertsekas}, 25397 title = {Dynamic Programming and Optimal Control}, 25398 publisher = {Athena Scientific}, 25399 year = {1995}, 25400 address = {Belmont MA} 25401} 25402 25403@Article{ bertsekas:enlarging, 25404 author = {D. P. Bertsekas}, 25405 title = {Enlarging the Region of Convergence of {N}ewton's Method for Constrained 25406 Optimization}, 25407 journal = {Journal of Optimization Theory and Applications}, 25408 year = {1982}, 25409 volume = {36}, 25410 pages = {221--252} 25411} 25412 25413@Article{ bertsekas:goldstein-levitin-poljak, 25414 author = {D. P. Bertsekas}, 25415 title = {On the {G}oldstein-{L}evitin-{P}oljak Gradient Projection Algorithm}, 25416 journal = {IEEE Transactions on Automatic Control}, 25417 year = {1976}, 25418 volume = {AC-21}, 25419 pages = {174--184} 25420} 25421 25422@Article{ bertsekas:multiplier, 25423 author = {D. P. Bertsekas}, 25424 title = {Multiplier Methods: {A} Survey}, 25425 journal = {Automatica}, 25426 year = {1976}, 25427 volume = {12}, 25428 pages = {133--145} 25429} 25430 25431@Article{ bertsekas:necessary, 25432 author = {D. P. Bertsekas}, 25433 title = {Necessary and Sufficient Conditions for a Penalty Method to be Exact}, 25434 journal = {Mathematical Programming}, 25435 year = {1975}, 25436 volume = {9}, 25437 pages = {87--99} 25438} 25439 25440@Book{ bertsekas:nonlinear, 25441 author = {D. P. Bertsekas}, 25442 title = {Nonlinear Programming}, 25443 publisher = {Athena Scientific}, 25444 year = {1995}, 25445 address = {Belmont, Massachusetts} 25446} 25447 25448@Article{ bertsekas:projected, 25449 author = {Dimitri P. Bertsekas}, 25450 title = {Projected {N}ewton Methods for Optimization Problems with Simple Constraints}, 25451 journal = {SIAM Journal on Control and Optimization}, 25452 year = {1982}, 25453 volume = {20}, 25454 pages = {221--246} 25455} 25456 25457@Article{ billups.dirkse.ea:comparison, 25458 author = {S. C. Billups and S. P. Dirkse and M. C. Ferris}, 25459 title = {A Comparison of Large Scale Mixed Complementarity Problem Solvers}, 25460 journal = {Computational Optimization and Applications}, 25461 year = {1997}, 25462 pages = {3--25}, 25463 volume = {7}, 25464 url = {ftp: //ftp.cs.wisc.edu/math-prog/tech-reports/95-16.ps}, 25465 key = {51} 25466} 25467 25468@Article{ billups.ferris:convergence, 25469 author = {S. C. Billups and M. C. Ferris}, 25470 title = {Convergence of an Infeasible Interior--Point Algorithm from Arbitrary Positive 25471 Starting Points}, 25472 journal = {SIAM Journal on Optimization}, 25473 year = {1996}, 25474 volume = {6}, 25475 pages = {316--325}, 25476 url = {ftp: //ftp.cs.wisc.edu/tech-reports/reports/1993/tr1180.ps}, 25477 key = {34} 25478} 25479 25480@TechReport{ billups.ferris:convergence*1, 25481 author = {S. C. Billups and M. C. Ferris}, 25482 title = {Convergence of Infeasible Interior--Point Algorithms from Arbitrary Starting 25483 Points}, 25484 institution = {Computer Sciences Department, University of Wisconsin}, 25485 year = {1993}, 25486 address = {Madison, Wisconsin}, 25487 number = {1180}, 25488 note = {Revised version in SIAM Journal on Optimization.} 25489} 25490 25491@Article{ billups.ferris:qpcomp, 25492 author = {S. C. Billups and M. C. Ferris}, 25493 title = {{QPCOMP}: {A} Quadratic Program Based Solver for Mixed Complementarity Problems}, 25494 year = {1997}, 25495 journal = {Mathematical Programming}, 25496 pages = {533--562}, 25497 volume = {76}, 25498 url = {ftp: //ftp.cs.wisc.edu/math-prog/tech-reports/95-09.ps}, 25499 key = {47} 25500} 25501 25502@Article{ billups.ferris:solutions, 25503 author = {S. C. Billups and M. C. Ferris}, 25504 title = {Solutions to Affine Generalized Equations Using Proximal Mappings}, 25505 journal = {Mathematics of Operations Research}, 25506 volume = {24}, 25507 pages = {219--236}, 25508 year = {1999}, 25509 url = {ftp://ftp.cs.wisc.edu/math-prog/tech-reports/94-15.ps}, 25510 key = {42}, 25511 institution = {Computer Sciences Department, University of Wisconsin}, 25512 address = {Madison, Wisconsin}, 25513 type = {Mathematical Programming Technical Report}, 25514 number = {94--15} 25515} 25516 25517@TechReport{ billups.murata.ea:users, 25518 author = {S. C. Billups and K. K. Murata and K. E. Washington and D. L. Y. Louie}, 25519 title = {User's manual for {CONTAIN--HWR/0}, Rev. 1: {A} Computer Code for the Analysis of 25520 Heavy Water Nuclear Reactor Containments Under Accident Conditions}, 25521 institution = {SNL}, 25522 year = {1994}, 25523 month = jan, 25524 address = {Albuquerque, New Mexico}, 25525 number = {SAND91--1482} 25526} 25527 25528@TechReport{ billups.speight.ea:nonmonotone, 25529 author = {S. C. Billups and A. L. Speight and L. T. Watson}, 25530 title = {Nonmonotone Path Following Methods for Nonsmooth Equations and Complementarity 25531 Problems}, 25532 institution = {Department of Mathematics, University of Colorado}, 25533 year = {1999}, 25534 address = {Denver, Colorado} 25535} 25536 25537@PhDThesis{ billups:algorithms, 25538 author = {S. C. Billups}, 25539 title = {Algorithms for Complementarity Problems and Generalized Equations}, 25540 school = {University of Wisconsin--Madison}, 25541 year = {1995}, 25542 address = {Madison, Wisconsin}, 25543 month = aug 25544} 25545 25546@MastersThesis{ billups:augmented, 25547 author = {S. C. Billups}, 25548 title = {An Augmented Jacobian Matrix Algorithm for Tracking Homotopy Zero Curves}, 25549 school = {Virginia Tech}, 25550 year = {1985}, 25551 address = {Blacksburg, Virginia} 25552} 25553 25554@TechReport{ billups:homotopy, 25555 author = {S. C. Billups}, 25556 title = {A Homotopy Based Algorithm for Mixed Complementarity Problems}, 25557 institution = {Department of Mathematics, University of Colorado}, 25558 year = {1998}, 25559 address = {Denver, Colorado} 25560} 25561 25562@Article{ billups:improving, 25563 author = {S. C. Billups}, 25564 title = {Improving the Robustness of Descent-Based Methods for Semi-Smooth Equations Using 25565 Proximal Perturbations}, 25566 year = {2000}, 25567 journal = {Mathematical Programming}, 25568 volume = {87}, 25569 pages = {153--176} 25570} 25571 25572@Book{ birge.louveaux:introduction, 25573 author = {J. R. Birge and R. Louveaux}, 25574 title = {Introduction to Stochastic Programming}, 25575 publisher = {Springer}, 25576 address = {New York}, 25577 year = {1997} 25578} 25579 25580@TechReport{ bischof.carle.ea:adifor, 25581 author = {C. Bischof and A. Carle and P. Khademi and A. Mauer and P. Hovland}, 25582 title = {{ADIFOR} 2.0 User's Guide}, 25583 institution = {Argonne National Laboratory}, 25584 year = {1995}, 25585 address = {Argonne, Illinois}, 25586 number = {ANL/MCS--TM--192}, 25587 type = {Mathematics and Computer Science Division Report} 25588} 25589 25590@Book{ bisschop.entriken:aimms, 25591 author = {J. Bisschop and R. Entriken}, 25592 title = {{AIMMS} -- The Modeling System}, 25593 year = {1993}, 25594 publisher = {Paragon Decision Technology}, 25595 address = {Haarlem, The Netherlands} 25596} 25597 25598@Article{ bisschop.meeraus:development, 25599 author = {J. Bisschop and A. Meeraus}, 25600 title = {On the Development of a General Algebraic Modeling System in a Strategic Planning 25601 Environment}, 25602 journal = {Mathematical Programming Study}, 25603 year = {1982}, 25604 volume = {20}, 25605 pages = {1--29} 25606} 25607 25608@Misc{ bixby.ceria.ea:miplib, 25609 author = {R. E. Bixby and S. Ceria and C. M. McZeal and M. W. P. Savelsbergh}, 25610 title = {{MIPLIB} 3.0}, 25611 howpublished = {http://www.caam.rice.edu/\~bixby/miplib/miplib.html} 25612} 25613 25614@InProceedings{ bjorkman.klarbring.ea:sequential, 25615 author = {G. Bj{\"{o}}rkman and A. Klarbring and T. Larsson and M. R{\"{o}}nnqvist and B. 25616 Sj{\"{o}}din}, 25617 title = {Sequential quadratic programming for non-linear elastic contact problems}, 25618 editor = {J. Herskovits}, 25619 booktitle = {Structural Optimization 93, The World Congress on Optimal Design of Structural 25620 Systems}, 25621 volume = {2}, 25622 year = {1993}, 25623 pages = {301--308} 25624} 25625 25626@Article{ bjorkman:path, 25627 author = {G. Bj{\"o}rkman}, 25628 title = {Path Following and Critical Points for Contact Problems}, 25629 journal = {Computational Mechanics}, 25630 volume = {10}, 25631 pages = {231--246}, 25632 year = {1992} 25633} 25634 25635@Article{ bjorkman:solution, 25636 author = {G. Bj{\"o}rkman}, 25637 title = {The Solution of Large Displacement Frictionless Contact Problems using a Sequence 25638 of Linear Complementarity Problems}, 25639 journal = {International Journal for Numerical Methods in Engineering}, 25640 volume = {31}, 25641 pages = {1553--1566}, 25642 year = {1991} 25643} 25644 25645@Article{ bland:pivot, 25646 author = {R. G. Bland}, 25647 title = {New Pivot Rules for the Simplex Method}, 25648 journal = {Mathematics of Operations Research}, 25649 year = {1977}, 25650 volume = {2}, 25651 pages = {103--107} 25652} 25653 25654@Article{ block.levin:boundedness, 25655 author = {H. D. Block and S. A. Levin}, 25656 title = {On the Boundedness of an Iterative Procedure for Solving a System of Linear 25657 Inequalities}, 25658 journal = {Proceedings of the American Mathematical Society}, 25659 year = {1970}, 25660 volume = {26}, 25661 pages = {229--235} 25662} 25663 25664@Book{ bloomer:power, 25665 author = {J. Bloomer}, 25666 title = {Power Programming with {RPC}}, 25667 publisher = {O'Reilly and Associates, Inc.}, 25668 address = {Sebastopol, CA}, 25669 year = {1992} 25670} 25671 25672@InProceedings{ blum.rivest:training, 25673 author = {A. Blum and R. L. Rivest}, 25674 title = {Training a 3-Node Neural Network is {NP}-Complete}, 25675 booktitle = {Advances in Neural Information Processing Systems I}, 25676 year = {1989}, 25677 editor = {D. S. Touretzky}, 25678 publisher = {Morgan Kaufmann}, 25679 address = {San Mateo, California}, 25680 pages = {494--501} 25681} 25682 25683@InProceedings{ boehringer.ferris.ea:exemptions, 25684 author = {C. B{\"{o}}ehringer and M. C. Ferris and T. F. Rutherford}, 25685 title = {Exemptions, Grandfathered Permits and the Costs of Emission Restrictions: Results 25686 from a General Equilibrium Model for Six {EU} Countries}, 25687 key = {49}, 25688 booktitle = {Economic Aspects of Environmental Policy Making in a Federal System}, 25689 year = {1995} 25690} 25691 25692@Article{ boender.kan:bayesian, 25693 author = {C. G. E. Boender and A. H. G. Rinooy Kan}, 25694 title = {Bayesian Stopping Rules for Global Optimization}, 25695 journal = {Mathematical Programming}, 25696 year = {1987}, 25697 volume = {37}, 25698 pages = {59--80} 25699} 25700 25701@Article{ boggs:convergence, 25702 author = {P. T. Boggs}, 25703 title = {The Convergence of the {B}en--{I}srael Iteration for Nonlinear Least Squares 25704 Problems}, 25705 journal = {Mathematics of Computation}, 25706 year = {1976}, 25707 volume = {30}, 25708 pages = {512--522} 25709} 25710 25711@InProceedings{ bolzon.cochetti.ea:computing, 25712 author = {G. Bolzon and G. Cochetti and G. Maier and F. Tin-Loi}, 25713 title = {On computing all solutions in decohesion}, 25714 booktitle = {IUTAM (International Union of Theoretical and Applied Mechanics), 19th 25715 International Congress of Theoretical and Applied Mechanics}, 25716 year = {1996}, 25717 address = {Kyoto} 25718} 25719 25720@InProceedings{ bolzon.maier.ea:holonomic, 25721 author = {G. Bolzon and G. Maier and F. Tin-Loi}, 25722 title = {Holonomic and nonholonomic simulations of quasi-brittle fracture: a comparative 25723 study of mathematical programming approaches}, 25724 booktitle = {Fracture Mechanics of Concrete Structures}, 25725 editor = {F. H. Wittmann}, 25726 series = {Second International Conference on Fracture Mechanics of Concrete Structures 25727 (FRAMCOS 2)}, 25728 year = {1995}, 25729 publisher = {Aedificatio Publishers}, 25730 pages = {885--898} 25731} 25732 25733@InProceedings{ bolzon.maier.ea:holonomic*1, 25734 author = {G. Bolzon and G. Maier and F. Tin-Loi}, 25735 title = {On holonomic structural analysis as a complementarity problem}, 25736 booktitle = {APCOM96, Seoul}, 25737 year = {1996} 25738} 25739 25740@Article{ bolzon.maier.ea:multiplicity, 25741 author = {G. Bolzon and G. Maier and F. Tin-Loi}, 25742 title = {On the Multiplicity of Solutions in Quasi-Brittle Fracture Computations}, 25743 journal = {Computational Mechanics}, 25744 year = {1997}, 25745 volume = {19}, 25746 pages = {511--516} 25747} 25748 25749@Article{ bongartz.conn.ea:cute, 25750 author = {I. Bongartz and A. R. Conn and N. Gould and Ph. L. Toint}, 25751 title = {{CUTE}: Constrained and Unconstrained Testing Environment}, 25752 year = {1995}, 25753 journal = {{ACM} Transactions on Mathematical Software}, 25754 volume = {21}, 25755 pages = {123--160} 25756} 25757 25758@Article{ boppana:eigenvalues, 25759 author = {R. Boppana}, 25760 title = {Eigenvalues and Graph Bisection: An Average Case Analysis}, 25761 journal = {Proc. 28th Annual Symposium on Foundations of Computer Science}, 25762 pages = {280--285}, 25763 year = {1987} 25764} 25765 25766@Article{ bortfeld.kahler.ea:x-ray, 25767 author = {T. R. Bortfeld and D. L. Kahler and T. J. Waldron and A. L. Boyer}, 25768 title = {{X}-ray field compensation with multileaf collimators}, 25769 journal = {International Journal of Radiation Oncology, Biology and Physics}, 25770 year = {1994}, 25771 volume = {28}, 25772 number = {3}, 25773 pages = {723--730} 25774} 25775 25776@Article{ bortfeld.schlegel:optimization, 25777 author = {T. Bortfeld and W. Schlegel}, 25778 title = {Optimization of beam orientations in radiation therapy: some theoretical 25779 considerations}, 25780 journal = {Physics in Medicine and Biology}, 25781 year = {1993}, 25782 volume = {38}, 25783 number = {2}, 25784 pages = {291--304} 25785} 25786 25787@Article{ borwein:stability, 25788 author = {J. M. Borwein}, 25789 title = {Stability and regular points of inequality systems}, 25790 journal = {Journal of Optimization Theory and Applications}, 25791 year = {1986}, 25792 volume = {48}, 25793 pages = {9--52} 25794} 25795 25796@Article{ boyer:present, 25797 author = {A. L. Boyer}, 25798 title = {Present and Future Developments in Radiotherapy Treatment Units}, 25799 journal = {Seminars in Radiation Oncology}, 25800 year = {1995}, 25801 volume = {5}, 25802 number = {2}, 25803 pages = {146--155} 25804} 25805 25806@Article{ bracken.mcgill:mathematical, 25807 author = {J. Bracken and J. T. McGill}, 25808 title = {Mathematical programs with optimization problems in the constraints}, 25809 journal = {Operations Research}, 25810 volume = {21}, 25811 year = {1973}, 25812 pages = {37--44} 25813} 25814 25815@Article{ bradley.fayyad.ea:mathematical, 25816 author = {P. S. Bradley and U. M. Fayyad and O. L. Mangasarian}, 25817 title = {Mathematical Programming for Data Mining: Formulations and Challenges}, 25818 journal = {INFORMS Journal on Computing}, 25819 year = {1999}, 25820 volume = {11}, 25821 pages = {217--238} 25822} 25823 25824@TechReport{ bradley.mangasarian.ea:clustering, 25825 author = {P. S. Bradley and O. L. Mangasarian and W. N. Street}, 25826 title = {Clustering via Concave Minimization}, 25827 institution = {Computer Sciences Department, University of Wisconsin}, 25828 year = {1996}, 25829 type = {Mathematical Programming Technical Report}, 25830 number = {96-03}, 25831 address = {Madison, Wisconsin} 25832} 25833 25834@TechReport{ bradley.mangasarian.ea:feature, 25835 author = {P. S. Bradley and O. L. Mangasarian and W. N. Street}, 25836 title = {Feature Selection via Mathematical Programming}, 25837 institution = {Computer Sciences Department, University of Wisconsin}, 25838 year = {1995}, 25839 type = {Mathematical Programming Technical Report}, 25840 number = {95-21}, 25841 address = {Madison, Wisconsin} 25842} 25843 25844@Article{ bradley.mangasarian:massive, 25845 author = {P. S. Bradley and O. L. Mangasarian}, 25846 title = {Massive Data Discrimination via Linear Support Vector Machines}, 25847 year = {2000}, 25848 journal = {Optimization Methods and Software}, 25849 volume = {13}, 25850 pages = {1-10} 25851} 25852 25853@PhDThesis{ brady:condition, 25854 author = {L. Brady}, 25855 title = {Condition Constants for Solutions of Convex Inequalities}, 25856 year = {1988}, 25857 address = {Madison, Wisconsin}, 25858 school = {Computer Sciences Department, University of Wisconsin} 25859} 25860 25861@Article{ braess:uber, 25862 author = {D. Braess}, 25863 title = {{\"{U}}ber ein {P}aradoxon aus der {V}erkehrsplanung}, 25864 journal = {Unternehmensforschung}, 25865 year = {1968}, 25866 volume = {12}, 25867 pages = {258--268} 25868} 25869 25870@Article{ brahme:optimization, 25871 author = {A. Brahme}, 25872 title = {Optimization of Radiation Therapy and the Development of Multileaf Collimation}, 25873 journal = {International Journal of Radiation Oncology, Biology and Physics}, 25874 year = {1993}, 25875 volume = {25}, 25876 pages = {373--375} 25877} 25878 25879@Article{ brahme:stationary, 25880 author = {A. Brahme}, 25881 title = {Optimization of stationary and moving beam radiation therapy techniques}, 25882 journal = {Radiother. Oncol.}, 25883 year = {1988}, 25884 volume = {12}, 25885 pages = {129--140} 25886} 25887 25888@InCollection{ brahme:treatment, 25889 author = {A. Brahme}, 25890 title = {Treatment Optimization: Using Physical and Radiobiological Objective Functions}, 25891 booktitle = {Radiation Therapy Physics}, 25892 publisher = {Springer-Verlag}, 25893 year = {1995}, 25894 editor = {A. R. Smith}, 25895 address = {Berlin}, 25896 pages = {209--246} 25897} 25898 25899@TechReport{ branch:getting, 25900 author = {M. A. Branch}, 25901 title = {Getting {CUTE} with {M}atlab}, 25902 institution = {Cornell University}, 25903 year = {1994}, 25904 type = {Cornell Theory Center Report}, 25905 number = {CTC94TR194}, 25906 address = {Ithaca, New York} 25907} 25908 25909@Article{ brearley.mitra.ea:analysis, 25910 author = {A. Brearley and G. Mitra and H. Williams}, 25911 title = {Analysis of Mathematical Programming Problems Prior to Applying the Simplex 25912 Algorithm}, 25913 journal = {Mathematical Programming}, 25914 year = {1975}, 25915 volume = {8}, 25916 pages = {54--83} 25917} 25918 25919@Article{ bredensteiner.bennett:feature, 25920 author = {E. Bredensteiner and K. Bennett}, 25921 title = {Feature Minimization within Decision Trees}, 25922 journal = {Computational Optimization and Applications}, 25923 year = {1998}, 25924 volume = {10}, 25925 pages = {111--126} 25926} 25927 25928@Article{ bregman:relaxation, 25929 author = {L. M. Bregman}, 25930 title = {The Relaxation Method of Finding the Common Point of Convex Sets and its 25931 Application to the Solution of Problems in Convex Programming}, 25932 journal = {USSR Computational Mathematics and Mathematical Physics}, 25933 year = {1967}, 25934 volume = {7}, 25935 pages = {200--217} 25936} 25937 25938@Book{ brenner.hall:making, 25939 author = {D. J. Brenner and E. J. Hall}, 25940 title = {Making the Radiation Therapy Decision}, 25941 publisher = {Contemporary Books}, 25942 year = {1996}, 25943 address = {Chicago, IL} 25944} 25945 25946@Book{ brent:algorithms, 25947 author = {R. P. Brent}, 25948 title = {Algorithms for Minimization without Derivatives}, 25949 publisher = {Prentice-Hall, Inc}, 25950 year = {1973}, 25951 address = {Englewood Cliffs, New Jersey} 25952} 25953 25954@Article{ brewster.mohan.ea:three, 25955 author = {L. Brewster and R. Mohan and G. Mageras and C. Burman and S. Leibel and Z. Fuks}, 25956 title = {Three dimensional conformal treatment planning with multileaf collimators}, 25957 journal = {International Journal of Radiation Oncology, Biology and Physics}, 25958 year = {1995}, 25959 volume = {33}, 25960 number = {5}, 25961 pages = {1081--1089} 25962} 25963 25964@Article{ brezis.lions:produits, 25965 author = {H. Br\'{e}zis and P.--L. Lions}, 25966 title = {Produits Infinis de Resolvantes}, 25967 journal = {Israel Journal of Mathematics}, 25968 year = {1978}, 25969 volume = {29}, 25970 pages = {329--345} 25971} 25972 25973@Book{ brezis:operateurs, 25974 author = {H. Br\'{e}zis}, 25975 title = {Op\'{e}rateurs Maximaux Monotones et Semi-Groupes de Contractions dans les 25976 Espaces de Hilbert}, 25977 publisher = {North-Holland}, 25978 address = {Amsterdam}, 25979 year = {1973} 25980} 25981 25982@Book{ brooke.kendrick.ea:gams, 25983 author = {A. Brooke and D. Kendrick and A. Meeraus}, 25984 title = {{GAMS}: {A} User's Guide}, 25985 year = {1988}, 25986 publisher = {The Scientific Press}, 25987 address = {South San Francisco, CA} 25988} 25989 25990@Article{ brown.demarzo.ea:computing, 25991 author = {D. J. Brown and P. M. DeMarzo and B. C. Eaves}, 25992 title = {Computing Equilibria when Asset Markets Are Incomplete}, 25993 journal = {Econometrica}, 25994 year = {1996}, 25995 volume = {64}, 25996 pages = {1--28} 25997} 25998 25999@Article{ bruck:iterative, 26000 author = {R. E. Bruck}, 26001 title = {An Iterative Solution of a Variational Inequality for Certain Monotone Operators 26002 in {H}ilbert Space}, 26003 journal = {Bulletin of the American Mathematical Society}, 26004 year = {1975}, 26005 volume = {81}, 26006 pages = {890--892} 26007} 26008 26009@Article{ bunch.parlett:direct, 26010 author = {J. R. Bunch and B. N. Parlett}, 26011 title = {Direct Methods for Solving Symmetric Indefinite Systems of Linear Equations}, 26012 journal = {SIAM Journal on Numerical Analysis}, 26013 year = {1971}, 26014 volume = {8}, 26015 pages = {639--655} 26016} 26017 26018@Article{ burachik.iusem.ea:enlargement, 26019 author = {R. S. Burachik and A. N. Iusem and B. F. Svaiter}, 26020 title = {Enlargement of Monotone Operators with Applications to Variational Inequalities}, 26021 year = {1997}, 26022 journal = {Set-Valued Analysis, forthcoming} 26023} 26024 26025@TechReport{ burachik.iusem:generalized, 26026 author = {R. S. Burachik and A. N. Iusem}, 26027 title = {A Generalized Proximal Point Algorithm for the Nonlinear Complementarity 26028 Problem}, 26029 institution = {Instituto de Matem\'{a}tica Pura e Aplicada}, 26030 year = {1995}, 26031 type = {Working Paper}, 26032 address = {Rio de Janeiro} 26033} 26034 26035@Article{ burachik.iusem:generalized*1, 26036 author = {R. S. Burachik and A. N. Iusem}, 26037 title = {A Generalized Proximal Point Algorithm for the Variational Inequality Problem in 26038 {A} {H}ilbert Space}, 26039 year = {1998}, 26040 journal = {SIAM Journal on Optimization}, 26041 volume = {8}, 26042 pages = {197--216} 26043} 26044 26045@Article{ burdakov:globally, 26046 author = {O. P. Burdakov}, 26047 title = {Some Globally Convergent Modifications of {N}ewton's Method for Solving Systems 26048 of Nonlinear Equations}, 26049 journal = {Soviet Mathematics Doklady}, 26050 year = {1980}, 26051 volume = {22}, 26052 pages = {376--379} 26053} 26054 26055@Article{ burges:tutorial, 26056 author = {C. J. C. Burges}, 26057 title = {A Tutorial on Support Vector Machines for Pattern Recognition}, 26058 journal = {Data Mining and Knowledge Discovery}, 26059 volume = {2}, 26060 number = {2}, 26061 pages = {121-167}, 26062 year = {1998} 26063} 26064 26065@Article{ burke.ferris.ea:clarke, 26066 author = {J. V. Burke and M. C. Ferris and M. Qian}, 26067 title = {On the {C}larke Subdifferential of the Distance Function to a Closed Set}, 26068 journal = {Journal of Mathematical Analysis and its Applications}, 26069 year = {1992}, 26070 volume = {166}, 26071 pages = {199--213}, 26072 key = {16} 26073} 26074 26075@Unpublished{ burke.ferris.ea:least, 26076 author = {J. V. Burke and M. C. Ferris and L. Qi}, 26077 title = {A Least Squares Algorithm for Nonlinear Complementarity Problems}, 26078 year = {1994}, 26079 month = mar, 26080 note = {Manuscript}, 26081 key = {999} 26082} 26083 26084@Article{ burke.ferris:characterization, 26085 author = {J. V. Burke and M. C. Ferris}, 26086 title = {Characterization of Solution Sets of Convex Programs}, 26087 journal = {Operations Research Letters}, 26088 year = {1991}, 26089 volume = {10}, 26090 pages = {57--60}, 26091 key = {10} 26092} 26093 26094@Article{ burke.ferris:gauss-newton, 26095 author = {J. V. Burke and M. C. Ferris}, 26096 title = {A {G}auss--{N}ewton Method for Convex Composite Optimization}, 26097 journal = {Mathematical Programming}, 26098 year = {1995}, 26099 volume = {71}, 26100 pages = {179--194}, 26101 url = {ftp: //ftp.cs.wisc.edu/tech-reports/reports/1993/tr1176.ps}, 26102 key = {32} 26103} 26104 26105@Article{ burke.ferris:weak, 26106 author = {J. V. Burke and M. C. Ferris}, 26107 title = {Weak Sharp Minima in Mathematical Programming}, 26108 journal = {SIAM Journal on Control and Optimization}, 26109 year = {1993}, 26110 volume = {31}, 26111 pages = {1340--1359}, 26112 url = {ftp: //ftp.cs.wisc.edu/tech-reports/reports/1991/tr1050a.ps}, 26113 key = {23} 26114} 26115 26116@Article{ burke.more.ea:convergence, 26117 author = {J. V. Burke and J. J. Mor\'{e} and G. Toraldo}, 26118 title = {Convergence Properties of Trust Region Methods for Linear and Convex 26119 Constraints}, 26120 journal = {Mathematical Programming}, 26121 year = {1990}, 26122 volume = {47}, 26123 pages = {305--336} 26124} 26125 26126@Article{ burke.more:exposing, 26127 author = {J. V. Burke and J. J. Mor\'{e}}, 26128 title = {Exposing Constraints}, 26129 journal = {SIAM Journal on Optimization}, 26130 year = {1994}, 26131 volume = {4}, 26132 pages = {573--595} 26133} 26134 26135@Article{ burke.more:identification, 26136 author = {J. V. Burke and J. J. Mor\'{e}}, 26137 title = {On the Identification of Active Constraints}, 26138 journal = {SIAM Journal on Numerical Analysis}, 26139 year = {1988}, 26140 volume = {25}, 26141 pages = {1197--1211} 26142} 26143 26144@Article{ burke.poliquin:optimality, 26145 author = {J. V. Burke and R. A. Poliquin}, 26146 title = {Optimality Conditions for Non Finite--Valued Convex Composite Functions}, 26147 journal = {Mathematical Programming}, 26148 year = {1992}, 26149 volume = {57}, 26150 pages = {103--120} 26151} 26152 26153@Article{ burke.tseng:unified, 26154 author = {J. V. Burke and P. Tseng}, 26155 title = {A Unified Analysis of {H}offman's Bound via {F}enchel Duality}, 26156 journal = {SIAM Journal on Optimization}, 26157 year = {1996}, 26158 volume = {6}, 26159 pages = {265--282} 26160} 26161 26162@Article{ burke.xu:global, 26163 author = {J. V. Burke and S. Xu}, 26164 title = {The Global Linear Convergence of a Non-Interior Path-Following Algorithm for 26165 Linear Complementarity Problems}, 26166 year = {1998}, 26167 journal = {Mathematics of Operations Research}, 26168 volume = {23}, 26169 pages = {719--735} 26170} 26171 26172@TechReport{ burke:algorithms, 26173 author = {J. V. Burke}, 26174 title = {Algorithms for Solving Finite Dimensional Systems of Nonlinear Equations and 26175 Inequalities that have both Global and Quadratic Convergence Properties}, 26176 institution = {Argonne National Laboratory}, 26177 year = {1985}, 26178 address = {Argonne, Illinois}, 26179 number = {ANL/MCS--TM--54}, 26180 type = {Mathematics and Computer Science Division Report} 26181} 26182 26183@Article{ burke:descent, 26184 author = {J. V. Burke}, 26185 title = {Descent Methods for Composite Nondifferentiable Optimization Problems}, 26186 journal = {Mathematical Programming}, 26187 year = {1985}, 26188 volume = {33}, 26189 pages = {260--279} 26190} 26191 26192@Article{ burke:exact, 26193 author = {J. V. Burke}, 26194 title = {An Exact Penalization Viewpoint of Constrained Optimization}, 26195 journal = {SIAM Journal on Control and Optimization}, 26196 year = {1991}, 26197 volume = {29}, 26198 pages = {968--998} 26199} 26200 26201@Article{ burke:identification, 26202 author = {J. V. Burke}, 26203 title = {On the Identification of Active Constraints {II}: The Nonconvex Case}, 26204 journal = {SIAM Journal on Numerical Analysis}, 26205 year = {1990}, 26206 volume = {27}, 26207 pages = {1081--1102} 26208} 26209 26210@Article{ burke:robust, 26211 author = {J. V. Burke}, 26212 title = {A Robust Trust Region Method for Constrained Nonlinear Programming Problem}, 26213 journal = {SIAM Journal on Optimization}, 26214 year = {1992}, 26215 volume = {2}, 26216 pages = {325--347} 26217} 26218 26219@Article{ burke:second, 26220 author = {J. V. Burke}, 26221 title = {Second Order Necessary and Sufficient Conditions for Convex Composite {NDO}}, 26222 journal = {Mathematical Programming}, 26223 year = {1987}, 26224 volume = {38}, 26225 pages = {287--302} 26226} 26227 26228@Article{ burke:sequential, 26229 author = {J. V. Burke}, 26230 title = {A Sequential Quadratic Programming Method for Potentially Infeasible Mathematical 26231 Programs}, 26232 journal = {Journal of Mathematical Analysis and its Applications}, 26233 year = {1989}, 26234 volume = {139}, 26235 pages = {319--351} 26236} 26237 26238@Article{ burman.kutcher.ea:fitting, 26239 author = {C. Burman and G. J. Kutcher and B. Emami and M. Goitein}, 26240 title = {Fitting of Normal Tissue Tolerance Data to an Analytical Function}, 26241 journal = {International Journal of Radiation Oncology, Biology and Physics}, 26242 year = {1991}, 26243 optvolume = {21}, 26244 optpages = {123-135} 26245} 26246 26247@TechReport{ busovaca:handling, 26248 author = {S. Busovaca}, 26249 title = {Handling Degeneracy in a Nonlinear $\ell_1$ algorithm}, 26250 institution = {University of Waterloo}, 26251 year = {1985}, 26252 address = {Ontario}, 26253 number = {CS85 34}, 26254 type = {Technical Report} 26255} 26256 26257@Article{ butler.martin:method, 26258 author = {T. Butler and A. V. Martin}, 26259 title = {On a Method of {C}ourant for Minimizing Functionals}, 26260 journal = {Journal of Mathematical Physics}, 26261 year = {1962}, 26262 volume = {41}, 26263 pages = {291--299} 26264} 26265 26266@Article{ calamai.more:projected, 26267 author = {P. H. Calamai and J. J. Mor\'{e}}, 26268 title = {Projected Gradient Methods for Linearly Constrained Problems}, 26269 journal = {Mathematical Programming}, 26270 year = {1987}, 26271 volume = {39}, 26272 pages = {93--116} 26273} 26274 26275@Article{ cao.ferris:genetic, 26276 author = {M. Cao and M. C. Ferris}, 26277 title = {Genetic Algorithms in Optimization}, 26278 journal = {Journal of Undergraduate Mathematics and its Applications}, 26279 year = {1991}, 26280 volume = {12}, 26281 pages = {81--90}, 26282 key = {17} 26283} 26284 26285@Article{ cao.ferris:interior, 26286 author = {M. Cao and M. C. Ferris}, 26287 title = {An Interior Point Algorithm for Monotone Affine Variational Inequalities}, 26288 journal = {Journal of Optimization Theory and Applications}, 26289 year = {1994}, 26290 volume = {83}, 26291 pages = {269--283}, 26292 url = {ftp: //ftp.cs.wisc.edu/tech-reports/reports/1992/tr1101.ps}, 26293 key = {28} 26294} 26295 26296@Article{ cao.ferris:lineality, 26297 author = {M. Cao and M. C. Ferris}, 26298 title = {Lineality Removal for Copositive--Plus Normal Maps}, 26299 year = {1995}, 26300 volume = {2}, 26301 pages = {1--10}, 26302 journal = {Communications on Applied Nonlinear Analysis}, 26303 url = {ftp: //ftp.cs.wisc.edu/math-prog/tech-reports/94-02.ps}, 26304 key = {38} 26305} 26306 26307@Article{ cao.ferris:pc, 26308 author = {M. Cao and M. C. Ferris}, 26309 title = {{$P_C$} Matrices and the Linear Complementarity Problem}, 26310 journal = {Linear Algebra and Its Applications}, 26311 year = {1996}, 26312 volume = {246}, 26313 pages = {299--312}, 26314 url = {ftp: //ftp.cs.wisc.edu/math-prog/tech-reports/94-01.ps}, 26315 key = {37} 26316} 26317 26318@Article{ cao.ferris:pivotal, 26319 author = {M. Cao and M. C. Ferris}, 26320 title = {A Pivotal Method for Affine Variational Inequalities}, 26321 journal = {Mathematics of Operations Research}, 26322 year = {1996}, 26323 volume = {21}, 26324 pages = {44--64}, 26325 url = {ftp: //ftp.cs.wisc.edu/tech-reports/reports/1992/tr1114.ps}, 26326 key = {29} 26327} 26328 26329@PhDThesis{ cao:piecewise, 26330 author = {M. Cao}, 26331 title = {Piecewise Linear Homotopies and Affine Variational Inequalities}, 26332 school = {Computer Sciences Department, University of Wisconsin}, 26333 year = {1994}, 26334 address = {Madison, Wisconsin}, 26335 note = {Technical Report 1210} 26336} 26337 26338@Article{ caroe.schultz:dual, 26339 author = {C. C. Car{\o}e and R. Schultz}, 26340 title = {Dual Decomposition in Stochastic Integer Programming}, 26341 journal = {Operations Research Letters}, 26342 volume = {24}, 26343 pages = {37-45}, 26344 year = {1999} 26345} 26346 26347@Article{ carol.targovnik.ea:initial, 26348 author = {M. Carol and W. H. Grant and D. Pavord and P. Eddy and H. S. Targovnik and B. 26349 Butler and S. Woo and J. Figura and V. Onufrey and R. Grossman and R. Selkar}, 26350 title = {Initial clinical experience with the Peacock intensity modulation of a 3-{D} 26351 conformal radiation therapy system}, 26352 journal = {Stereotactic and Functional Neurosurgery}, 26353 year = {1996}, 26354 volume = {66}, 26355 pages = {30--34} 26356} 26357 26358@Article{ carolan.hill.ea:empirical, 26359 author = {W. J. Carolan and J. E. Hill and J. L. Kennington and S. Niemi and S. J. 26360 Wichmann}, 26361 title = {An Empirical Evaluation of the {KORBX} Algorithms for Military Airlift 26362 Applications}, 26363 journal = {Operations Research}, 26364 year = {1990}, 26365 volume = {38}, 26366 pages = {240--248} 26367} 26368 26369@Article{ carroll:created, 26370 author = {C. W. Carroll}, 26371 title = {The Created Response Surface Technique for Optimizing Nonlinear Restrained 26372 Systems}, 26373 journal = {Operations Research}, 26374 year = {1961}, 26375 volume = {9}, 26376 pages = {169--184} 26377} 26378 26379@PhDThesis{ carroll:operations, 26380 author = {C. W. Carroll}, 26381 title = {An Operations Research Approach to the Economic Optimization of a Kraft Pulping 26382 Process}, 26383 year = {1959}, 26384 address = {Appleton, Wisconsin}, 26385 school = {Institute of Paper Chemistry} 26386} 26387 26388@TechReport{ casanova.dongarra:netsolve, 26389 author = {H. Casanova and J. Dongarra}, 26390 title = {{N}et{S}olve: {A} Network Server for Solving Computational Science Problems}, 26391 institution = {University of Tennessee}, 26392 year = {1996}, 26393 type = {Technical Report} 26394} 26395 26396@TechReport{ cavalier.soyster:computational, 26397 author = {T. M. Cavalier and A. L. Soyster}, 26398 title = {Some Computational Experience and a Modification of the {K}armarkar Algorithm}, 26399 institution = {Pennsylvania State University}, 26400 year = {1985}, 26401 address = {Pennsylvania}, 26402 number = {85-105}, 26403 type = {ISME Working Paper} 26404} 26405 26406@TechReport{ censor.iusem.ea:interior-point, 26407 author = {Y. Censor and A. N. Iusem and S. A. Zenios}, 26408 title = {An Interior-Point Method with {B}regman Functions for the Variational Inequality 26409 Problem with Paramonotone Operators}, 26410 institution = {University of Haifa}, 26411 year = {1994}, 26412 type = {Working Paper} 26413} 26414 26415@Article{ censor.lent:iterative, 26416 author = {Y. Censor and A. Lent}, 26417 title = {An Iterative Row-Action Method for Interval Convex Programming}, 26418 journal = {Journal of Optimization Theory and Applications}, 26419 year = {1981}, 26420 volume = {34}, 26421 pages = {275--291} 26422} 26423 26424@InCollection{ censor.pierro.ea:iterative, 26425 author = {Y. Censor and A. R. {De~Pierro} and T. Elfving and G. T. Herman and A. N. Iusem}, 26426 title = {On Iterative Methods for Linearly Constrained Entropy Maximization}, 26427 booktitle = {Numerical Analysis and Mathematical Modeling, Banach Center Publication Volume 26428 XXIV}, 26429 publisher = {Banach Center}, 26430 year = {1987}, 26431 editor = {A. J. Wakulicz}, 26432 address = {Warsaw, Poland} 26433} 26434 26435@Article{ censor.segman:block-iterative, 26436 author = {Y. Censor and J. Segman}, 26437 title = {On Block-Iterative Entropy Maximization}, 26438 journal = {Journal of Information and Optimization Science}, 26439 year = {1987}, 26440 volume = {8}, 26441 pages = {275--291} 26442} 26443 26444@Article{ censor.zenios:proximal, 26445 author = {Y. Censor and S. A. Zenios}, 26446 title = {The Proximal Minimization Algorithm with ${D}$-functions}, 26447 journal = {Journal of Optimization Theory and Applications}, 26448 year = {1992}, 26449 volume = {73}, 26450 pages = {451--464} 26451} 26452 26453@Article{ censor:parallel, 26454 author = {Yair Censor}, 26455 title = {Parallel Application of Block-Iterative Methods in Medical Imaging and Radiation 26456 Therapy}, 26457 journal = {Mathematical Programming}, 26458 year = {1988}, 26459 volume = {42}, 26460 pages = {307--325} 26461} 26462 26463@Article{ censor:row-action, 26464 author = {Yair Censor}, 26465 title = {Row-action Methods for Huge and Sparse Systems and their Applications}, 26466 journal = {SIAM Review}, 26467 year = {1981}, 26468 volume = {23}, 26469 pages = {444--466} 26470} 26471 26472@Article{ chajakis.zenios:synchronous, 26473 author = {E. D. Chajakis and S. A. Zenios}, 26474 title = {Synchronous and Asynchronous Implementations of Relaxation Algorithms for 26475 Nonlinear Network Optimization}, 26476 journal = {Parallel Computing}, 26477 year = {1990}, 26478 note = {To appear} 26479} 26480 26481@Article{ chamberlain.powell.ea:watchdog, 26482 author = {R. M. Chamberlain and M. J. D. Powell and C. Lemar\'{e}chal}, 26483 title = {The Watchdog Technique for Forcing Convergence in Algorithms for Constrained 26484 Optimization}, 26485 journal = {Mathematical Programming Study}, 26486 year = {1982}, 26487 volume = {16}, 26488 pages = {1--17} 26489} 26490 26491@Article{ chan.pang:generalized, 26492 author = {D. Chan and J. S. Pang}, 26493 title = {The Generalized Quasi-Variational Inequality Problem}, 26494 journal = {Mathematics of Operations Research}, 26495 volume = {7}, 26496 pages = {211--222}, 26497 year = {1982} 26498} 26499 26500@Article{ charalambous:nonlinear, 26501 author = {C. Charalambous}, 26502 title = {Nonlinear Least p--th Optimization and Nonlinear Programming}, 26503 journal = {Mathematical Programming}, 26504 year = {1977}, 26505 volume = {12}, 26506 pages = {195--225} 26507} 26508 26509@Article{ charnes.cooper.ea:duality, 26510 author = {A. Charnes and W. W. Cooper and K. O. Kortanek}, 26511 title = {Duality, {H}aar Programs and Finite Sequence Spaces}, 26512 journal = {Proceedings of the National Academy of Sciences of the United States}, 26513 year = {1962}, 26514 pages = {783--786} 26515} 26516 26517@Book{ charnes.cooper.ea:introduction, 26518 author = {A. Charnes and W. W. Cooper and A. Henderson}, 26519 title = {An Introduction to Linear Programming}, 26520 year = {1953}, 26521 publisher = {John Wiley \& Sons}, 26522 address = {New York} 26523} 26524 26525@TechReport{ charnes.semple:practical, 26526 author = {A. Charnes and J. Semple}, 26527 title = {Practical Error Bounds for a Class of Quadratic Programming Problems}, 26528 institution = {CCS}, 26529 year = {1991}, 26530 address = {Austin, Texas}, 26531 number = {663}, 26532 type = {Research Report} 26533} 26534 26535@InProceedings{ charnes:fundamental, 26536 author = {A. Charnes}, 26537 title = {Some Fundamental Theorems of Perceptron Theory and Their Geometry}, 26538 booktitle = {Computer and Information Sciences}, 26539 year = {1964}, 26540 editor = {J. T. Lou and R. H. Wilcox}, 26541 publisher = {Spartan Books}, 26542 address = {Washington, D.C.}, 26543 pages = {67--74} 26544} 26545 26546@TechReport{ chen.chen.ea:penalized, 26547 author = {B. Chen and X. Chen and C. Kanzow}, 26548 title = {A Penalized {F}ischer-{B}urmeister {NCP}-Function: Theoretical Investigation and 26549 Numerical Results}, 26550 institution = {Institute of Applied Mathematics, University of Hamburg}, 26551 year = {1997}, 26552 type = {Preprint}, 26553 number = {126}, 26554 address = {Hamburg, Germany} 26555} 26556 26557@Article{ chen.chen:global, 26558 author = {B. Chen and X. Chen}, 26559 title = {A Global and Local Superlinear Continuation-Smoothing Method for ${P}_0$ + 26560 ${R}_0$ {NCP} or Monotone {NCP}}, 26561 journal = {SIAM Journal on Optimization}, 26562 year = {1999}, 26563 volume = {9}, 26564 pages = {624--645} 26565} 26566 26567@Article{ chen.ferris.ea:fatcop, 26568 author = {Q. Chen and M. C. Ferris and J. T. Linderoth}, 26569 title = {{FATCOP} 2.0: Advanced Features in an Opportunistic Mixed Integer Programming 26570 Solver}, 26571 journal = {Annals of Operations Research, forthcoming}, 26572 year = {2000}, 26573 url = {ftp://ftp.cs.wisc.edu/pub/dmi/tech-reports/99-11.ps}, 26574 key = {89}, 26575 type = {Data Mining Institute Technical Report}, 26576 institution = {Computer Sciences Department, University of Wisconsin}, 26577 address = {Madison, Wisconsin}, 26578 number = {99-11} 26579} 26580 26581@TechReport{ chen.ferris:fatcop, 26582 author = {Q. Chen and M. C. Ferris}, 26583 title = {{FATCOP}: {A} Fault Tolerant {C}ondor-{PVM} Mixed Integer Program Solver}, 26584 type = {Mathematical Programming Technical Report}, 26585 institution = {Computer Sciences Department, University of Wisconsin}, 26586 address = {Madison, Wisconsin}, 26587 year = {1999}, 26588 url = {ftp: //ftp.cs.wisc.edu/math-prog/tech-reports/99-05.ps}, 26589 number = {99-05}, 26590 key = {81}, 26591 annote = {Submitted to {\em SIOPT}} 26592} 26593 26594@Article{ chen.florian:nonlinear, 26595 author = {Y. Chen and M. Florian}, 26596 title = {The Nonlinear Bilevel Programming Problem: Formulations, Regularity, and 26597 Optimality Conditions}, 26598 journal = {Optimization}, 26599 year = {1995}, 26600 volume = {32}, 26601 pages = {193--209} 26602} 26603 26604@TechReport{ chen.florian:o-d, 26605 author = {Y. Chen and M. Florian}, 26606 title = {{O}-{D} demand adjustment problem with congestion: Part {I}. Model analysis and 26607 optimality conditions}, 26608 type = {Publication}, 26609 number = {CRT-94-56}, 26610 institution = {Centre de Recherche sur les Transports, Universit\'e de Montr\'eal}, 26611 address = {Montr\'eal, Canada}, 26612 year = {1994} 26613} 26614 26615@Article{ chen.harker:continuation, 26616 author = {B. Chen and P. T. Harker}, 26617 title = {A Continuation Method for Monotone Variational Inequalities}, 26618 journal = {Mathematical Programming}, 26619 volume = {69}, 26620 pages = {237--253}, 26621 year = {1995} 26622} 26623 26624@Article{ chen.harker:non-interior, 26625 author = {B. Chen and P. T. Harker}, 26626 title = {A Non-Interior-Point Continuation Method for Linear Complementarity Problems}, 26627 journal = {SIAM Journal on Matrix Analysis and Applications}, 26628 year = {1993}, 26629 volume = {14}, 26630 pages = {1168--1190} 26631} 26632 26633@Article{ chen.harker:smooth, 26634 author = {B. Chen and P. T. Harker}, 26635 title = {Smooth Approximations to Nonlinear Complementarity Problems}, 26636 journal = {SIAM Journal on Optimization}, 26637 year = {1997}, 26638 volume = {7}, 26639 pages = {403--420} 26640} 26641 26642@Article{ chen.mangasarian:class, 26643 author = {Chunhui Chen and O. L. Mangasarian}, 26644 title = {A Class of Smoothing Functions for Nonlinear and Mixed Complementarity Problems}, 26645 journal = {Computational Optimization and Applications}, 26646 year = {1996}, 26647 volume = {5}, 26648 pages = {97--138} 26649} 26650 26651@Article{ chen.mangasarian:smoothing, 26652 author = {Chunhui Chen and O. L. Mangasarian}, 26653 title = {Smoothing Methods for Convex Inequalities and Linear Complementarity Problems}, 26654 journal = {Mathematical Programming}, 26655 year = {1995}, 26656 volume = {78}, 26657 pages = {51--70} 26658} 26659 26660@Article{ chen.nashed.ea:convergence, 26661 author = {X. Chen and Z. Nashed and L. Qi}, 26662 title = {Convergence of {N}ewton's Method for Singular Smooth and Nonsmooth Equations 26663 using Adaptive Outer Inverses}, 26664 year = {1997}, 26665 journal = {SIAM Journal on Optimization}, 26666 volume = {7}, 26667 pages = {445--462} 26668} 26669 26670@Article{ chen.qi.ea:global, 26671 author = {X. Chen and L. Qi and D. Sun}, 26672 title = {Global and Superlinear Convergence of the Smoothing {N}ewton Method and its 26673 Application to General Box Constrained Variational Inequalities}, 26674 year = {1998}, 26675 journal = {Mathematics of Computation}, 26676 volume = {67}, 26677 pages = {519--540} 26678} 26679 26680@Article{ chen.teboulle:convergence, 26681 author = {G. Chen and M. Teboulle}, 26682 title = {A Convergence Analysis of Proximal-Like Minimization Algorithms Using {B}regman 26683 Functions}, 26684 journal = {SIAM Journal on Optimization}, 26685 year = {1993}, 26686 volume = {3}, 26687 pages = {538--543} 26688} 26689 26690@Article{ chen.ye:homotopy-smoothing, 26691 author = {X.~Chen and Y.~Ye}, 26692 title = {On Homotopy-Smoothing Methods for Variational Inequalities}, 26693 year = {1999}, 26694 journal = {SIAM Journal on Control and Optimization}, 26695 volume = {37}, 26696 pages = {589--616} 26697} 26698 26699@PhDThesis{ chen:forward-backward, 26700 author = {G. H.--G. Chen}, 26701 title = {Forward--Backward Splitting Techniques: Theory and Applications}, 26702 school = {University of Washington}, 26703 year = {1994} 26704} 26705 26706@PhDThesis{ chen:smoothing, 26707 author = {Chunhui Chen}, 26708 title = {Smoothing Methods in Mathematical Programming}, 26709 school = {Computer Sciences Department, University of Wisconsin}, 26710 year = {1995}, 26711 address = {Madison, Wisconsin}, 26712 note = {Available from ftp://ftp.cs.wisc.edu/math-prog/tech-reports/}, 26713 annote = {Mathematical Programming Technical Report 95-12} 26714} 26715 26716@Book{ cheney:introduction, 26717 author = {E. W. Cheney}, 26718 title = {Introduction to Approximation Theory}, 26719 year = {1966}, 26720 publisher = {McGraw--Hill}, 26721 address = {New York} 26722} 26723 26724@Article{ cho.kuterdem.ea:spherical, 26725 author = {P. S. Cho and H. G. Kuterdem and R. J. Marks}, 26726 title = {A spherical dose model for radiosurgery treatment planning}, 26727 journal = {Physics in Medicine and Biology}, 26728 year = {1998}, 26729 volume = {43}, 26730 pages = {3145--3148} 26731} 26732 26733@Article{ cho.lee.ea:optimization, 26734 author = {P. S. Cho and S. Lee and R. J. Marks and S. Oh and S. Sutlief and H. Phillips}, 26735 title = {Optimization of intensity modulated beams with volume constraints using two 26736 methods: cost function minimization and projection onto convex sets}, 26737 journal = {Medical Physics}, 26738 year = {1998}, 26739 volume = {25}, 26740 number = {4}, 26741 pages = {435--443} 26742} 26743 26744@Article{ choi.desarbo.ea:product, 26745 author = {S. C. Choi and W. S. DeSarbo and P. T. Harker}, 26746 title = {Product Positioning Under Price Competition}, 26747 journal = {Management Science}, 26748 year = {1990}, 26749 volume = {36}, 26750 pages = {175--199} 26751} 26752 26753@Article{ chow.mallet-parret.ea:finding, 26754 author = {S. N. Chow and J. Mallet--Parret and J. A. Yorke}, 26755 title = {Finding Zeroes of Maps: Homotopy Methods that are Constructive with Probability 26756 One}, 26757 journal = {Mathematics of Computing}, 26758 year = {1978}, 26759 volume = {32}, 26760 pages = {887--899} 26761} 26762 26763@Article{ christopherson:mathematical, 26764 author = {D. G. Christopherson}, 26765 title = {A new mathematical method for the solution of film lubrication problems}, 26766 journal = {Proceedings of the Institute of Mechanical Engineers}, 26767 volume = {146}, 26768 year = {1941}, 26769 pages = {126--135} 26770} 26771 26772@TechReport{ chun.lee.ea:implementation, 26773 author = {B. J. Chun and S. J. Lee and S. M. Robinson}, 26774 title = {An Implementation of the Bundle Decomposition Algorithm}, 26775 institution = {Department of Industrial Engineering, University of Wisconsin}, 26776 year = {1991}, 26777 address = {Madison, Wisconsin}, 26778 number = {91-6} 26779} 26780 26781@Article{ chung:np-completeness, 26782 author = {S.--J. Chung}, 26783 title = {{NP}-Completeness of the Linear Complementarity Problem}, 26784 journal = {Journal of Optimization Theory and Applications}, 26785 volume = {60}, 26786 year = {1989}, 26787 pages = {393--399} 26788} 26789 26790@Book{ chvatal:linear, 26791 author = {V. Chv\'atal}, 26792 title = {Linear Programming}, 26793 year = {1983}, 26794 publisher = {W. H. Freeman and Company}, 26795 address = {New York} 26796} 26797 26798@Book{ ciarlet:finite, 26799 author = {P. G. Ciarlet}, 26800 title = {The Finite Element Method for Elliptic Problems}, 26801 year = {1978}, 26802 publisher = {North-Holland}, 26803 address = {New York} 26804} 26805 26806@Article{ cinquini.contro:optimal, 26807 author = {C. Cinquini and R. Contro}, 26808 title = {Optimal design of beams discretized by elastic plastic finite element}, 26809 journal = {Computers \& Structures}, 26810 volume = {20}, 26811 year = {1985}, 26812 pages = {475--585} 26813} 26814 26815@Book{ clarke:optimization, 26816 author = {F. H. Clarke}, 26817 title = {Optimization and Nonsmooth Analysis}, 26818 year = {1983}, 26819 publisher = {John Wiley \& Sons}, 26820 address = {New York} 26821} 26822 26823@InProceedings{ cleveland.smith:genetic, 26824 crossref = {schaeffer:third}, 26825 author = {G. A. Cleveland and S. F. Smith}, 26826 title = {Using Genetic Algorithms to Schedule Flow Shop Releases}, 26827 pages = {160--169} 26828} 26829 26830@Book{ cochran:sampling, 26831 author = {W. Cochran}, 26832 title = {Sampling Techniques}, 26833 publisher = {Wiley}, 26834 year = {1977}, 26835 address = {New York}, 26836 edition = {Third} 26837} 26838 26839@Article{ coleman.conn:nonlinear, 26840 author = {T. F. Coleman and A. R. Conn}, 26841 title = {Nonlinear Programming via an Exact Penalty Function Method: Asymptotic Analysis}, 26842 journal = {Mathematical Programming}, 26843 year = {1982}, 26844 volume = {24}, 26845 pages = {123--136} 26846} 26847 26848@Article{ coleman.conn:nonlinear*1, 26849 author = {T. F. Coleman and A. R. Conn}, 26850 title = {Nonlinear Programming via an Exact Penalty Function Method: Global Analysis}, 26851 journal = {Mathematical Programming}, 26852 year = {1982}, 26853 volume = {24}, 26854 pages = {137--161} 26855} 26856 26857@TechReport{ coleman.liu:interior, 26858 author = {T. F. Coleman and J. Liu}, 26859 title = {An interior newton method for quadratic programming}, 26860 institution = {Dept. of Computer Science, Cornell University}, 26861 year = {1993}, 26862 number = {TR 93-1388}, 26863 address = {Ithaca, NY}, 26864 month = oct 26865} 26866 26867@Article{ coleman.more:estimation, 26868 author = {T. F. Coleman and J. J. Mor\'{e}}, 26869 title = {Estimation of Sparse {J}acobian Matrices and Graph Coloring Problems}, 26870 journal = {SIAM Journal on Numerical Analysis}, 26871 year = {1983}, 26872 volume = {20}, 26873 pages = {187--209} 26874} 26875 26876@Manual{ coleman.verma:admat, 26877 author = {T. F. Coleman and A. Verma}, 26878 title = {{ADMAT} User Guide}, 26879 year = {2000} 26880} 26881 26882@TechReport{ colville:comparative, 26883 author = {A. R. Colville}, 26884 title = {A Comparative Study on Nonlinear Programming Codes}, 26885 institution = {IBM New York Scientific Center}, 26886 year = {1968}, 26887 month = jun, 26888 number = {320--2949}, 26889 type = {Technical Report} 26890} 26891 26892@Article{ comi.maier:extremum, 26893 author = {C. Comi and G. Maier}, 26894 title = {Extremum Theorem and Convergence Criterion for an Iterative Solution to the 26895 Finite-Step Problem in Elastoplasticity with Mixed Nonlinear Hardening}, 26896 journal = {European Journal Mechanics A/Solids}, 26897 volume = {9}, 26898 year = {1990}, 26899 pages = {563--585} 26900} 26901 26902@Misc{ condon.dahl.ea:implementing, 26903 author = {T. Condon and H. Dahl and S. Devarajan}, 26904 title = {Implementing a Computable General Equilibrium Model on {GAMS} -- The {C}ameroon 26905 Model}, 26906 year = {1987}, 26907 howpublished = {{DRD} Discussion Paper 290}, 26908 note = {The World Bank, Washington DC} 26909} 26910 26911@Book{ conn.gould.ea:lancelot, 26912 author = {A. R. Conn and N. I. M. Gould and Ph. L. Toint}, 26913 title = {{LANCELOT}: {A} {F}ortran package for Large--Scale Nonlinear Optimization 26914 (Release {A})}, 26915 year = {1992}, 26916 publisher = {Springer Verlag}, 26917 address = {Heidelberg, Berlin}, 26918 series = {Springer Series in Computational Mathematics}, 26919 number = {17} 26920} 26921 26922@Article{ conn.gould.ea:numerical, 26923 author = {A. R. Conn and N. I. M. Gould and Ph. L. Toint}, 26924 title = {Numerical Experiments with the {LANCELOT} Package (Release {A}) for Large-Scale 26925 Nonlinear Optimization}, 26926 journal = {Mathematical Programming}, 26927 year = {1996}, 26928 volume = {75}, 26929 pages = {73--110} 26930} 26931 26932@Book{ cgt, 26933 author = {A. R. Conn and N. I. M. Gould and Ph. L. Toint}, 26934 title = {Trust-Region Methods}, 26935 year = {2000}, 26936 publisher = {SIAM}, 26937 address = {Philadelphia, Pennsylvania} 26938} 26939 26940@InCollection{ conn.toint:algorithm, 26941 author = {A. R. Conn and Ph. L. Toint}, 26942 title = {An Algorithm using Quadratic Interpolation for Unconstrained Derivative Free 26943 Optimization}, 26944 booktitle = {Nonlinear Optimization and Applications}, 26945 editor = {G. Di Pillo and F. Giannessi}, 26946 year = {1996}, 26947 publisher = {Plenum Press}, 26948 address = {New York} 26949} 26950 26951@Article{ conry.seireg:mathematical, 26952 author = {T. F. Conry and A. Seireg}, 26953 title = {A Mathematical Programming Method for Design for Elastic Bodies in Contact}, 26954 journal = {{ASME} Transactions Journal of Applied Mechanics}, 26955 volume = {93}, 26956 year = {1971}, 26957 pages = {387--392} 26958} 26959 26960@Article{ cook.gerards.ea:sensitivity, 26961 author = {W. Cook and A. M. H. Gerards and A. Schrijver and \'{E}. Tardos}, 26962 title = {Sensitivity Results in Integer Linear Programming}, 26963 journal = {Mathematical Programming}, 26964 year = {1986}, 26965 volume = {34}, 26966 pages = {251--264} 26967} 26968 26969@Article{ cook:taxonomy, 26970 author = {S. A. Cook}, 26971 title = {A Taxonomy of Problems with Fast Parallel Algorithms}, 26972 journal = {Information and Control}, 26973 year = {1985}, 26974 volume = {64}, 26975 pages = {2--22} 26976} 26977 26978@Article{ cooper:gradient, 26979 author = {R. E. M. Cooper}, 26980 title = {A gradient method of optimizing external-beam radiotherapy treatment plans}, 26981 journal = {Radiology}, 26982 year = {1978}, 26983 volume = {128}, 26984 pages = {235--243} 26985} 26986 26987@Article{ cormack:problem, 26988 author = {A. M. Cormack}, 26989 title = {A problem in roatation therapy with x-rays}, 26990 journal = {International Journal of Radiation Oncology, Biology and Physics}, 26991 year = {1987}, 26992 volume = {13}, 26993 pages = {623--630} 26994} 26995 26996@Article{ cormack:problem*1, 26997 author = {A. M. Cormack}, 26998 title = {A problem in roatation therapy with x-rays2: dose distributions with an axis of 26999 symmetry}, 27000 journal = {International Journal of Radiation Oncology, Biology and Physics}, 27001 year = {1987}, 27002 volume = {13}, 27003 pages = {1921--1925} 27004} 27005 27006@Article{ cottle.dantzig:complementary, 27007 author = {R. W. Cottle and G. B. Dantzig}, 27008 title = {Complementary Pivot Theory of Mathematical Programming}, 27009 journal = {Linear Algebra and Its Applications}, 27010 year = {1968}, 27011 volume = {1}, 27012 pages = {103--125} 27013} 27014 27015@Article{ cottle.dantzig:generalization, 27016 author = {R. W. Cottle and G. B. Dantzig}, 27017 title = {A Generalization of the Linear Complementarity Problem}, 27018 journal = {Journal of Combinatorial Theory}, 27019 year = {1970}, 27020 volume = {8}, 27021 pages = {79--90} 27022} 27023 27024@Book{ cottle.giannessi.ea:variational, 27025 author = {R. W. Cottle and F. Giannessi and J.--L. Lions}, 27026 title = {Variational Inequalities and Complementarity Problems: Theory and Applications}, 27027 year = {1980}, 27028 publisher = {John Wiley \& Sons}, 27029 address = {New York} 27030} 27031 27032@InCollection{ cottle.goheen:special, 27033 author = {R. W. Cottle and M. S. Goheen}, 27034 title = {A Special Class of Large Quadratic Programs}, 27035 pages = {361--390}, 27036 crossref = {mangasarian.meyer.ea:nonlinear*3} 27037} 27038 27039@Article{ cottle.golub.ea:solution, 27040 author = {R. W. Cottle and G. H. Golub and R. S. Sacher}, 27041 title = {On the Solution of Large Structured Complementarity Problems: The Block 27042 Partitioned Case}, 27043 journal = {Applied Mathematics and Optimization}, 27044 year = {1978}, 27045 volume = {4}, 27046 pages = {347--363} 27047} 27048 27049@Book{ cottle.pang.ea:linear, 27050 author = {R. W. Cottle and J. S. Pang and R. E. Stone}, 27051 title = {The Linear Complementarity Problem}, 27052 year = {1992}, 27053 publisher = {Academic Press}, 27054 address = {Boston} 27055} 27056 27057@Article{ cottle.pang.ea:sufficient, 27058 author = {R. W. Cottle and J. S. Pang and V. Venkateswaran}, 27059 title = {Sufficient Matrices and the Linear Complementarity Problem}, 27060 journal = {Linear Algebra and Its Applications}, 27061 year = {1989}, 27062 volume = {114/115}, 27063 pages = {231--249} 27064} 27065 27066@PhDThesis{ cottle:nonlinear, 27067 author = {R. W. Cottle}, 27068 title = {Nonlinear programs with positively bounded {J}acobians}, 27069 school = {Department of Mathematics, University of California}, 27070 year = {1964}, 27071 address = {Berkeley, California} 27072} 27073 27074@Article{ cottle:nonlinear*1, 27075 author = {R. W. Cottle}, 27076 title = {Nonlinear programs with positively bounded {J}acobians}, 27077 journal = {Journal of the Society for Industrial and Applied Mathematics}, 27078 volume = {14}, 27079 year = {1966}, 27080 pages = {147--158} 27081} 27082 27083@InCollection{ cottle:principal, 27084 author = {R. W. Cottle}, 27085 title = {The principal pivoting method of quadratic programming}, 27086 booktitle = {Mathematics of the Decision Sciences, Part 1}, 27087 publisher = {American Mathematical Society}, 27088 editor = {G. B. Dantzig and Jr. A. F. Veinott}, 27089 address = {Providence, Rhode Island}, 27090 year = {1968}, 27091 pages = {144--162} 27092} 27093 27094@Unpublished{ courant:calculus, 27095 author = {R. Courant}, 27096 title = {Calculus of Variations and Supplementary Notes and Exercises}, 27097 year = {1956}, 27098 note = {Supplementary notes by M. Kruskal and H. Rubin, revised and amended by J. Moser, 27099 New York University} 27100} 27101 27102@Article{ courant:variational, 27103 author = {R. Courant}, 27104 title = {Variational Methods for the Solution of Problems of Equilibrium and Vibration}, 27105 journal = {Bulletin of the American Mathematical Society}, 27106 year = {1943}, 27107 volume = {49}, 27108 pages = {1--23} 27109} 27110 27111@Book{ cristianini.shawe-taylor:introduction, 27112 author = {N. Cristianini and J. Shawe-Taylor}, 27113 title = {An Introduction to Support Vector Machines}, 27114 publisher = {Cambridge University Press}, 27115 address = {Cambridge}, 27116 year = {2000} 27117} 27118 27119@Article{ cromme:strong, 27120 author = {L. Cromme}, 27121 title = {Strong Uniqueness}, 27122 journal = {Numerische Mathematik}, 27123 year = {1978}, 27124 volume = {29}, 27125 pages = {179--193} 27126} 27127 27128@Article{ crowder.johnson.ea:solving, 27129 author = {H. Crowder and E. L. Johnson and M. W. Padberg}, 27130 title = {Solving Large Scale Zero-One Linear Programming Problems}, 27131 journal = {Operations Research}, 27132 year = {1983}, 27133 volume = {31}, 27134 pages = {803--834} 27135} 27136 27137@Article{ cryer.dempster:equivalence, 27138 author = {C. W. Cryer and M. A. H. Dempster}, 27139 title = {Equivalence of Linear Complementarity Problems and Linear Programs in Vector 27140 Lattice {H}ilbert Spaces}, 27141 journal = {SIAM Journal on Control and Optimization}, 27142 year = {1980}, 27143 volume = {18}, 27144 pages = {76--89} 27145} 27146 27147@Article{ cryer:method, 27148 author = {C. W. Cryer}, 27149 title = {The method of {C}hristopherson for solving free boundary problems for infinite 27150 journal bearings by means of finite differences}, 27151 journal = {Mathematics of Computation}, 27152 volume = {25}, 27153 year = {1971}, 27154 pages = {435--553} 27155} 27156 27157@Article{ cryer:solution, 27158 author = {C. W. Cryer}, 27159 title = {The Solution of a Quadratic Programming Problem Using Systematic Overrelaxation}, 27160 journal = {SIAM Journal on Control and Optimization}, 27161 year = {1971}, 27162 volume = {9}, 27163 pages = {385--392} 27164} 27165 27166@Article{ cryer:solution*1, 27167 author = {C. W. Cryer}, 27168 title = {The Solution of a Quadratic Programming Using Systematic Overrelaxation}, 27169 journal = {SIAM Journal on Control}, 27170 year = {1971}, 27171 volume = {9}, 27172 pages = {385--392} 27173} 27174 27175@Manual{ culler:split-c, 27176 author = {D. Culler}, 27177 title = {The Split--{C} Programming Language}, 27178 organization = {Computer Science Department, University of California, Berkeley} 27179} 27180 27181@InProceedings{ cun.denker.ea:optimal, 27182 author = {Y. le Cun and J. S. Denker and S. A. Solla}, 27183 title = {Optimal Brain Damage}, 27184 booktitle = {Advances in Neural Information Processing Systems II {(Denver 1989)}}, 27185 year = {1990}, 27186 editor = {D. S. Touretzky}, 27187 publisher = {Morgan Kaufmann}, 27188 address = {San Mateo, California}, 27189 pages = {598--605} 27190} 27191 27192@TechReport{ czyzyk.mehrotra.ea:pcx, 27193 author = {J. Czyzyk and S. Mehrotra and S. J. Wright}, 27194 title = {{PCx} Users Guide}, 27195 institution = {Optimization Technology Center, Argonne National Laboratory and Northwestern 27196 University}, 27197 year = {1996}, 27198 type = {Technical Report}, 27199 number = {OTC 96/01} 27200} 27201 27202@TechReport{ czyzyk.mesnier.ea:network-enabled, 27203 address = {Argonne, Illinois}, 27204 author = {J. Czyzyk and M. P. Mesnier and J. J. Mor\'e}, 27205 institution = {Argonne National Laboratory}, 27206 number = {MCS-P615-0996}, 27207 title = {The {N}etwork-{E}nabled {O}ptimization {S}erver}, 27208 type = {Preprint}, 27209 year = {1996} 27210} 27211 27212@Article{ czyzyk.wisniewski.ea:optimization, 27213 title = {Optimization Case Studies in the {NEOS} Guide}, 27214 author = {J. Czyzyk and T. Wisniewski and S. J. Wright}, 27215 journal = {SIAM Review}, 27216 volume = {41}, 27217 pages = {148--163}, 27218 year = {1999} 27219} 27220 27221@Article{ dai.laan.ea:simplicial, 27222 author = {Y. Dai and G. van der Laan and A. J. J. Talman and Y. Yamamoto}, 27223 title = {A Simplicial Algorithm for the Nonlinear Stationary Problem on an Unbounded 27224 Polyhedron}, 27225 journal = {SIAM Journal on Optimization}, 27226 year = {1991}, 27227 volume = {1}, 27228 pages = {151--165} 27229} 27230 27231@Article{ dai.talman:linear, 27232 author = {Y. Dai and D. Talman}, 27233 title = {Linear Stationary Point Problems on Unbounded Polyhedra}, 27234 journal = {Mathematics of Operations Research}, 27235 year = {1993}, 27236 pages = {635--644} 27237} 27238 27239@Book{ daniel:approximate, 27240 author = {J. W. Daniel}, 27241 title = {The approximate minimization of functionals}, 27242 year = {1971}, 27243 publisher = {Prentice-Hall, Inc}, 27244 address = {Englewood Cliffs, New Jersey} 27245} 27246 27247@Article{ danskin:theory, 27248 author = {J. M. Danskin}, 27249 title = {The Theory of Min--Max, with Applications}, 27250 journal = {SIAM Journal on Applied Mathematics}, 27251 year = {1964}, 27252 volume = {14}, 27253 pages = {641--664} 27254} 27255 27256@Book{ danskin:theory*1, 27257 author = {J. M. Danskin}, 27258 title = {The Theory of Min--Max}, 27259 year = {1967}, 27260 publisher = {Springer-Verlag}, 27261 address = {New York} 27262} 27263 27264@InCollection{ dantzig.cottle:positive, 27265 author = {G. B. Dantzig and R. W. Cottle}, 27266 title = {Positive (semi-)definite programming}, 27267 booktitle = {Nonlinear Programming}, 27268 publisher = {North-Holland}, 27269 editor = {J. Abadie}, 27270 address = {Amsterdam}, 27271 year = {1967}, 27272 pages = {55--73} 27273} 27274 27275@Article{ dantzig.manne:complementarity, 27276 author = {G. B. Dantzig and A. S. Manne}, 27277 title = {A Complementarity Algorithm for an Optimal Captial Path with Invariant 27278 Proportions}, 27279 journal = {Journal of Economic Theory}, 27280 year = {1974}, 27281 volume = {9}, 27282 pages = {312--323} 27283} 27284 27285@Article{ dantzig.wolfe:decomposition, 27286 author = {G. B. Dantzig and P. Wolfe}, 27287 title = {Decomposition Principle for Linear Programs}, 27288 journal = {Operations Research}, 27289 year = {1960}, 27290 volume = {8}, 27291 pages = {101--111} 27292} 27293 27294@Book{ dantzig:linear, 27295 author = {G. B. Dantzig}, 27296 title = {Linear Programming and Extensions}, 27297 year = {1963}, 27298 publisher = {Princeton University Press}, 27299 address = {Princeton, New Jersey} 27300} 27301 27302@Manual{ dash:xpress-mp, 27303 title = {{XPRESS-MP} User Guide}, 27304 organization = {Dash Associates}, 27305 address = {Blisworth House, Blisworth, Northants, UK}, 27306 note = {http://www.dashopt.com/} 27307} 27308 27309@Book{ davis:handbook, 27310 author = {L. D. Davis}, 27311 title = {The Handbook of Genetic Algorithms}, 27312 year = {1990}, 27313 publisher = {Van Nostrand Reinhold} 27314} 27315 27316@TechReport{ davis:users, 27317 author = {T. A. Davis}, 27318 title = {Users' guide for the unsymmetric-pattern multifrontal Package ({UMFPACK})}, 27319 type = {{Technical Report}}, 27320 year = {1993}, 27321 institution = {Computer and Information Sciences Department, University of Florida}, 27322 address = {Gainesville, Florida} 27323} 27324 27325@TechReport{ dax:computation, 27326 author = {A. Dax}, 27327 title = {The Computation of Descent Directions at Degenerate Points}, 27328 institution = {Hydrological Service of Israel}, 27329 year = {1985}, 27330 type = {Technical Report} 27331} 27332 27333@Article{ dax:note, 27334 author = {A. Dax}, 27335 title = {A Note on Optimality Conditions for the Euclidean Multifacility Location 27336 Problem}, 27337 journal = {Mathematical Programming}, 27338 year = {1986}, 27339 volume = {36}, 27340 pages = {72--80} 27341} 27342 27343@Article{ deasy:multiple, 27344 author = {J. O. Deasy}, 27345 title = {Multiple local minima in radiotherapy optimization problems with dose volume 27346 constraints}, 27347 journal = {Medical Physics}, 27348 year = {1997}, 27349 optvolume = {24}, 27350 optnumber = {7}, 27351 optpages = {1157-1161} 27352} 27353 27354@Article{ deboor.ron:computational, 27355 author = {C. {deBoor} and A. Ron}, 27356 title = {Computational Aspects of Polynomial Interpolation in Several Variables}, 27357 journal = {Mathematics of Computation}, 27358 year = {1992}, 27359 volume = {58}, 27360 pages = {705--727} 27361} 27362 27363@Article{ debremaecker.ferris.ea:compressional, 27364 author = {J.--C. {De~Bremaecker} and M. C. Ferris and D. Ralph}, 27365 title = {Compressional Fractures considered as Contact Problems and Mixed Complementarity 27366 Problems}, 27367 year = {2000}, 27368 key = {82}, 27369 journal = {Engineering Fracture Mechanics}, 27370 volume = {66}, 27371 pages = {287--303} 27372} 27373 27374@Article{ debremaecker.ferris:comparison, 27375 author = {J.--C. {De~Bremaecker} and M. C. Ferris}, 27376 title = {A Comparison of Two Algorithms for Solving Closed Crack Problems}, 27377 year = {2000}, 27378 key = {90}, 27379 url = {ftp://ftp.cs.wisc.edu/math-prog/tech-reports/00-01.ps}, 27380 journal = {Engineering Fracture Mechanics}, 27381 volume = {66}, 27382 pages = {601--605}, 27383 institution = {Computer Sciences Department, University of Wisconsin}, 27384 address = {Madison, Wisconsin}, 27385 number = {00-01} 27386} 27387 27388@Article{ dedonato.maier:mathematical, 27389 author = {O. {De~Donato} and G. Maier}, 27390 title = {Mathematical programming methods for the inelastic analysis of reinforced 27391 concrete frames allowing for limited rotation capacity}, 27392 journal = {International Journal for Numerical Methods in Engineering}, 27393 volume = {4}, 27394 year = {1972}, 27395 pages = {307--329} 27396} 27397 27398@Book{ deimling:nonlinear, 27399 author = {K. Deimling}, 27400 title = {Nonlinear Functional Analysis}, 27401 publisher = {Springer-Verlag}, 27402 year = {1985} 27403} 27404 27405@PhDThesis{ dejong:analysis, 27406 author = {K. A. De~Jong}, 27407 title = {An Analysis of the Behavior of a Class of Genetic Adaptive Systems}, 27408 year = {1975}, 27409 school = {University of Michigan}, 27410 note = {Dissertation Abstracts International 36(10), 5140B} 27411} 27412 27413@Article{ deleone.mangasarian.ea:multi-sweep, 27414 author = {R. {De~Leone} and O. L. Mangasarian and T.-H. Shiau}, 27415 title = {Multi-Sweep Asynchronous Parallel Successive Overelaxation for the Nonsymmetric 27416 Linear Complementarity Problem}, 27417 journal = {Annals of Operations Research}, 27418 year = {1990}, 27419 volume = {22}, 27420 pages = {43--54} 27421} 27422 27423@InCollection{ deleone.mangasarian:serial, 27424 author = {R. {De~Leone} and O. L. Mangasarian}, 27425 title = {Serial and Parallel Solution of Large Scale Linear Programs by Augmented 27426 {L}agrangian Successive Overrelaxation}, 27427 booktitle = {Optimization, Parallel Processing and Applications}, 27428 publisher = {Springer-Verlag}, 27429 year = {1988}, 27430 editor = {A. Kurzhanski and K. Neumann and D. Pallaschke}, 27431 volume = {304}, 27432 series = {Lecture Notes in Economics and Mathematical Systems}, 27433 pages = {103--124}, 27434 address = {Berlin} 27435} 27436 27437@TechReport{ deluca.facchinei.ea:combining, 27438 author = {T. {De~Luca} and F. Facchinei and C. Kanzow}, 27439 title = {Combining Equation-Based Methods for the Solution of Large-Scale Nonlinear 27440 Complementarity Problems: Theory and Numerical Results}, 27441 type = {Preprint}, 27442 institution = {Institute of Applied Mathematics, University of Hamburg}, 27443 year = {1996} 27444} 27445 27446@TechReport{ deluca.facchinei.ea:general, 27447 author = {T. {De~Luca} and F. Facchinei and C. Kanzow}, 27448 title = {A General Framework for Solving Nonlinear Complementarity Problems: Theory and 27449 Numerical Results}, 27450 type = {Preprint}, 27451 institution = {Institute of Applied Mathematics, University of Hamburg}, 27452 year = {1997} 27453} 27454 27455@Article{ deluca.facchinei.ea:semismooth, 27456 author = {T. {De~Luca} and F. Facchinei and C. Kanzow}, 27457 title = {A Semismooth Equation Approach to the Solution of Nonlinear Complementarity 27458 Problems}, 27459 journal = {Mathematical Programming}, 27460 volume = {75}, 27461 pages = {407--439}, 27462 year = {1996} 27463} 27464 27465@Article{ deluca.facchinei.ea:theoretical, 27466 author = {T. {De~Luca} and F. Facchinei and C. Kanzow}, 27467 title = {A Theoretical and Numerical Comparison of some Semismooth Algorithms for 27468 Complementarity Problems}, 27469 year = {1999}, 27470 journal = {Computational Optimization and Applications, forthcoming} 27471} 27472 27473@Article{ demarzo.eaves:computing, 27474 author = {P. M. DeMarzo and B. C. Eaves}, 27475 title = {Computing Equilibria of {GEI} by Relocalization on a Grassmann Manifold}, 27476 journal = {Journal of Mathematical Economics}, 27477 year = {1996}, 27478 volume = {26}, 27479 pages = {479--497} 27480} 27481 27482@Article{ dembo.steihaug:truncated, 27483 author = {R. S. Dembo and T. Steihaug}, 27484 title = {Truncated {N}ewton Method Algorithms for Large--Scale Unconstrained 27485 Optimization}, 27486 journal = {Mathematical Programming}, 27487 year = {1983}, 27488 volume = {26}, 27489 pages = {190--212} 27490} 27491 27492@Article{ dembo:performance, 27493 author = {R. S. Dembo}, 27494 title = {The Performance of {NLPNET}, {A} Large--Scale Nonlinear Network Optimizer}, 27495 journal = {Mathematical Programming Study}, 27496 year = {1986}, 27497 volume = {26}, 27498 pages = {245--248} 27499} 27500 27501@Article{ demoor.vandenberghe.ea:generalized, 27502 author = {B. {De~Moor} and L. Vandenberghe and J. Vandewalle}, 27503 title = {The generalized linear complementarity problem and an algorithm to find all its 27504 solutions}, 27505 journal = {Mathematical Programming}, 27506 volume = {57}, 27507 year = {1992}, 27508 pages = {415--426} 27509} 27510 27511@Book{ demyanov.vasilev:nondifferentiable, 27512 author = {V. F. Dem\'{y}anov and L. V. Vasil\'{e}v}, 27513 title = {Nondifferentiable Optimization}, 27514 publisher = {Optimization Software, Inc.}, 27515 year = {1985}, 27516 address = {New York} 27517} 27518 27519@Article{ dennis.torczon:direct, 27520 author = {J. E. Dennis and V. Torczon}, 27521 title = {Direct Search Methods on Parallel Machines}, 27522 journal = {SIAM Journal on Optimization}, 27523 year = {1991}, 27524 volume = {1}, 27525 pages = {448--474} 27526} 27527 27528@TechReport{ depierro.iusem:convergence, 27529 author = {A. R. {De~Pierro} and A. N. Iusem}, 27530 title = {Convergence Properties of Iterative Methods for Symmetric Positive Semidefinite 27531 Linear Complementarity Problems}, 27532 institution = {Instituto de Matematica, Elasticita e Ciencia da Computacao}, 27533 year = {1990}, 27534 address = {Universidade Estadual de Campinas, CP 6065, Campinas, 13081, SP, Brazil} 27535} 27536 27537@Article{ depierro.iusem:relaxed, 27538 author = {A. R. {De~Pierro} and A. N. Iusem}, 27539 title = {A Relaxed Version of {B}regman's Method for Convex Programming}, 27540 journal = {Journal of Optimization Theory and Applications}, 27541 year = {1986}, 27542 volume = {51}, 27543 pages = {421--440} 27544} 27545 27546@Book{ dervis.melo.ea:general, 27547 author = {K. Dervis and J. de Melo and S. Robinson}, 27548 title = {General Equilibrium Models of Development Policy}, 27549 publisher = {Cambridge University Press}, 27550 year = {1982}, 27551 address = {Cambridge, England} 27552} 27553 27554@Article{ deschutter.demoor:minimal, 27555 author = {B. {De~Schutter} and B. {De~Moor}}, 27556 title = {Minimal Realization in the Max Algebra is an Extended Linear Complementarity 27557 Problem}, 27558 journal = {Systems \& Control Letters}, 27559 year = {1995}, 27560 pages = {103--111} 27561} 27562 27563@Article{ desilets.golden.ea:predicting, 27564 author = {L. DeSilets and B. Golden and Q. Wang and R. Kumar}, 27565 title = {Predicting Salinity in the {C}hesapeake {B}ay Using Backpropagation}, 27566 journal = {Computers \& Operations Research}, 27567 year = {1992}, 27568 volume = {19}, 27569 pages = {277--285} 27570} 27571 27572@PhDThesis{ desilva:sensitivity, 27573 author = {A. H. DeSilva}, 27574 title = {Sensitivity Formulas for Nonlinear Factorable Programming and their Application 27575 to the Solution of an Implicitly Defined Optimization Model of {US} Crude Oil 27576 Production}, 27577 school = {George Washington University}, 27578 address = {Washington, D.C.}, 27579 year = {1978} 27580} 27581 27582@TechReport{ dijkstra:cooperating, 27583 author = {E. W. Dijkstra}, 27584 title = {Cooperating Sequential Processes}, 27585 institution = {Technological University}, 27586 year = {1965}, 27587 address = {Eindhoven, The Netherlands}, 27588 number = {EWD--123}, 27589 type = {Technical Report} 27590} 27591 27592@Article{ dikin:iterative, 27593 author = {I. I. Dikin}, 27594 title = {Iterative Solution of Problems of Linear and Quadratic Programming}, 27595 journal = {Soviet Mathematics Doklady}, 27596 year = {1967}, 27597 volume = {8}, 27598 pages = {674--675} 27599} 27600 27601@InCollection{ dipillo.grippo.ea:class, 27602 author = {G. Di~Pillo and L. Grippo and F. Lampariello}, 27603 title = {A Class of Methods for the Solution of Optimization Problems with Inequalities}, 27604 booktitle = {System Modelling and Optimization}, 27605 year = {1981}, 27606 editor = {R. F. Drenick and F. Kozin}, 27607 publisher = {Springer-Verlag}, 27608 address = {Berlin} 27609} 27610 27611@Article{ dipillo.grippo:augmented, 27612 author = {G. Di~Pillo and L. Grippo}, 27613 title = {An Augmented {L}agrangian for Inequality Constraints in Nonlinear Programming 27614 Problems}, 27615 journal = {Journal of Optimization Theory and Applications}, 27616 year = {1982}, 27617 volume = {36}, 27618 pages = {495--519} 27619} 27620 27621@Article{ dipillo.grippo:class, 27622 author = {G. Di~Pillo and L. Grippo}, 27623 title = {A New Class of Augmented {L}agrangians in Nonlinear Programming}, 27624 journal = {SIAM Journal on Control and Optimization}, 27625 year = {1979}, 27626 volume = {17}, 27627 pages = {618--628} 27628} 27629 27630@Article{ dipillo.grippo:continuously, 27631 author = {G. Di~Pillo and L. Grippo}, 27632 title = {A Continuously Differentiable Exact Penalty Function for Nonlinear Programming 27633 Problems with Inequality Constraints}, 27634 journal = {SIAM Journal on Control and Optimization}, 27635 year = {1985}, 27636 volume = {23}, 27637 pages = {72--84} 27638} 27639 27640@Article{ dipillo.grippo:exact, 27641 author = {G. Di~Pillo and L. Grippo}, 27642 title = {An Exact Penalty Method with Global Convergence Properties for Nonlinear 27643 Programming Problems}, 27644 journal = {Mathematical Programming}, 27645 year = {1986}, 27646 volume = {36}, 27647 pages = {1--18} 27648} 27649 27650@TechReport{ dirkse.ferris.ea:gams, 27651 author = {S. P. Dirkse and M. C. Ferris and P. V. Preckel and T. Rutherford}, 27652 title = {The {GAMS} Callable Program Library for Variational and Complementarity Solvers}, 27653 institution = {Computer Sciences Department, University of Wisconsin}, 27654 year = {1994}, 27655 address = {Madison, Wisconsin}, 27656 number = {94-07}, 27657 type = {Mathematical Programming Technical Report}, 27658 url = {ftp: //ftp.cs.wisc.edu/math-prog/tech-reports/94-07.ps}, 27659 key = {25} 27660} 27661 27662@InProceedings{ dirkse.ferris:crash, 27663 crossref = {ferris.pang:complementarity}, 27664 author = {S. P. Dirkse and M. C. Ferris}, 27665 title = {Crash Techniques for Large-Scale Complementarity Problems}, 27666 pages = {40--61}, 27667 url = {ftp: //ftp.cs.wisc.edu/math-prog/tech-reports/95-22.ps}, 27668 key = {52} 27669} 27670 27671@Article{ dirkse.ferris:mcplib, 27672 author = {S. P. Dirkse and M. C. Ferris}, 27673 title = {{MCPLIB}: {A} Collection of Nonlinear Mixed Complementarity Problems}, 27674 journal = {Optimization Methods and Software}, 27675 pages = {319--345}, 27676 volume = {5}, 27677 year = {1995}, 27678 url = {ftp: //ftp.cs.wisc.edu/tech-reports/reports/1994/tr1215.ps}, 27679 key = {36} 27680} 27681 27682@InCollection{ dirkse.ferris:modeling, 27683 author = {S. P. Dirkse and M. C. Ferris}, 27684 title = {Modeling and Solution Environments for {MPEC}: {GAMS} \& {MATLAB}}, 27685 year = {1999}, 27686 pages = {127--148}, 27687 editor = {M. Fukushima and L. Qi}, 27688 booktitle = {Reformulation: Nonsmooth, Piecewise Smooth, Semismooth and Smoothing Methods}, 27689 publisher = {Kluwer Academic Publishers}, 27690 url = {ftp: //ftp.cs.wisc.edu/math-prog/tech-reports/97-09.ps}, 27691 key = {62} 27692} 27693 27694@Article{ dirkse.ferris:path, 27695 author = {S. P. Dirkse and M. C. Ferris}, 27696 title = {The {PATH} Solver: {A} Non-Monotone Stabilization Scheme for Mixed 27697 Complementarity Problems}, 27698 journal = {Optimization Methods and Software}, 27699 pages = {123--156}, 27700 volume = {5}, 27701 year = {1995}, 27702 url = {ftp: //ftp.cs.wisc.edu/tech-reports/reports/1993/tr1179.ps}, 27703 key = {33} 27704} 27705 27706@Article{ dirkse.ferris:pathsearch, 27707 author = {S. P. Dirkse and M. C. Ferris}, 27708 title = {A Pathsearch Damped {N}ewton Method for Computing General Equilibria}, 27709 journal = {Annals of Operations Research}, 27710 vol = {68}, 27711 year = {1996}, 27712 pages = {211--232}, 27713 url = {ftp: //ftp.cs.wisc.edu/math-prog/tech-reports/94-03.ps}, 27714 key = {39} 27715} 27716 27717@InCollection{ dirkse.ferris:traffic, 27718 author = {S. P. Dirkse and M. C. Ferris}, 27719 title = {Traffic Modeling and Variational Inequalities using {GAMS}}, 27720 booktitle = {Operations Research and Decision Aid Methodologies in Traffic and Transportation 27721 Management}, 27722 publisher = {Springer-Verlag}, 27723 year = {1998}, 27724 editor = {Ph. L. Toint and M. Labbe and K. Tanczos and G. Laporte}, 27725 series = {NATO ASI Series F}, 27726 volume = {166}, 27727 pages = {136--163}, 27728 key = {61}, 27729 url = {ftp: //ftp.cs.wisc.edu/math-prog/tech-reports/97-06.ps} 27730} 27731 27732@PhDThesis{ dirkse:robust, 27733 author = {S. P. Dirkse}, 27734 title = {Robust Solution of Mixed Complementarity Problems}, 27735 school = {Computer Sciences Department, University of Wisconsin}, 27736 year = {1994}, 27737 address = {Madison, Wisconsin}, 27738 note = {Available from ftp://ftp.cs.wisc.edu/math-prog/tech-reports/}, 27739 annote = {Mathematical Programming Technical Report 94-12} 27740} 27741 27742@TechReport{ dixon.mills:neural, 27743 author = {L. C. Dixon and D. J. Mills}, 27744 title = {Neural Nets for Massively Parallel Optimisation}, 27745 institution = {Hatfield Polytechnic}, 27746 year = {1992}, 27747 address = {Hatfield, Hertforshire, England}, 27748 number = {Numerical Optimisation Centre Technical Report No. 259} 27749} 27750 27751@Article{ dontchev:local, 27752 author = {A. L. Dontchev}, 27753 title = {Local Convergence of the {N}ewton method for Generalized Equations}, 27754 journal = {C.R. Acad. Sci. Paris Series I}, 27755 year = {1996}, 27756 volume = {332}, 27757 pages = {327--331} 27758} 27759 27760@Article{ douglas.rachford:numerical, 27761 author = {J. Douglas and H. H. Rachford}, 27762 title = {On the Numerical Solution of Heat Conduction Problems in Two and Three Space 27763 Variables}, 27764 journal = {Transactions of the American Mathematical Society}, 27765 year = {1956}, 27766 volume = {82}, 27767 pages = {421--439} 27768} 27769 27770@Article{ drud:conopt, 27771 author = {A. Drud}, 27772 title = {{CONOPT}: {A} {GRG} Code for Large Sparse Dynamic Nonlinear Optimization 27773 Problems}, 27774 journal = {Mathematical Programming}, 27775 year = {1985}, 27776 volume = {31}, 27777 pages = {153--191} 27778} 27779 27780@Article{ dsouza.meyer.ea:mixed, 27781 author = {W. D. D'Souza and R. R. Meyer and M. C. Ferris and B. R. Thomadsen}, 27782 title = {Mixed Integer Programming Models for Prostate Brachytherapy Treatment 27783 Optimization}, 27784 journal = {Medical Physics}, 27785 year = {1999}, 27786 key = {85}, 27787 volume = {26}, 27788 number = {6}, 27789 pages = {1099} 27790} 27791 27792@TechReport{ dsouza.meyer.ea:mixed*1, 27793 author = {W. D. D'Souza and R. R. Meyer and M. C. Ferris and B. R. Thomadsen}, 27794 title = {Mixed Integer Programming Models for Prostate Brachytherapy Treatment 27795 Optimization}, 27796 year = {1999}, 27797 key = {87}, 27798 url = {ftp: //ftp.cs.wisc.edu/math-prog/tech-reports/99-08.ps}, 27799 institution = {Computer Sciences Department, University of Wisconsin}, 27800 address = {Madison, Wisconsin}, 27801 number = {99-08}, 27802 type = {Mathematical Programming Technical Report}, 27803 annote = {Submitted to } 27804} 27805 27806@Article{ dsouza.meyer.ea:iterative, 27807 author = {W. D. D'Souza and R. R. Meyer and B. R. Thomadsen and M. C. Ferris}, 27808 title = {An Iterative Sequential Mixed-Integer Approach to Automated Prostate 27809 Brachytherapy Treatment Optimization}, 27810 year = {2000}, 27811 key = {96}, 27812 journal = {Physics and Medicine in Biology, forthcoming} 27813} 27814 27815@Article{ du.yu.ea:multileaf, 27816 author = {M. N. Du and C. X. Yu and M. Symons and D. Yan and R. Taylor and R. C. Matter and 27817 G. Gustafson and A. Martinez and J. W. Wong}, 27818 title = {A multileaf collimator field prescription preparation system for conventional 27819 radiotherapy}, 27820 journal = {International Journal of Radiation Oncology, Biology and Physics}, 27821 year = {1994}, 27822 volume = {30}, 27823 number = {3}, 27824 pages = {707--714} 27825} 27826 27827@Article{ duda.fossum:pattern, 27828 author = {R. O. Duda and H. Fossum}, 27829 title = {Pattern Classification by Iteratively Determined Linear and Piecewise Linear 27830 Discriminant Functions}, 27831 journal = {IEEE Transactions on Electronic Computers}, 27832 year = {1966}, 27833 volume = {15}, 27834 pages = {220--232} 27835} 27836 27837@Book{ duda.hart:pattern, 27838 author = {R. O. Duda and P. E. Hart}, 27839 title = {Pattern Classification and Scene Analysis}, 27840 year = {1973}, 27841 publisher = {John Wiley \& Sons}, 27842 address = {New York} 27843} 27844 27845@Book{ duff.erisman.ea:direct, 27846 author = {I. S. Duff and A. M. Erisman and J. K. Reid}, 27847 title = {Direct Methods for Sparse Matrices}, 27848 publisher = {Oxford University Press}, 27849 year = {1986}, 27850 address = {Oxford, England} 27851} 27852 27853@InCollection{ duffin:infinite, 27854 author = {R. J. Duffin}, 27855 title = {Infinite Programs}, 27856 booktitle = {Linear Inequalities and Related Systems}, 27857 year = {1975}, 27858 editor = {H. W. Kuhn and A. W. Tucker}, 27859 publisher = {Princeton University Press}, 27860 address = {Princeton, New Jersey}, 27861 pages = {157--170} 27862} 27863 27864@Article{ dunn.sachs:effect, 27865 author = {J. C. Dunn and E. Sachs}, 27866 title = {The Effect of Perturbations on the Convergence Rates of Optimization Algorithms}, 27867 journal = {Applied Mathematics and Optimization}, 27868 year = {1983}, 27869 volume = {10}, 27870 pages = {143--157} 27871} 27872 27873@Article{ dunn:convergence, 27874 author = {J. C. Dunn}, 27875 title = {On the Convergence of Projected Gradient Processes to Singular Critical Points}, 27876 journal = {Journal of Optimization Theory and Applications}, 27877 year = {1987}, 27878 volume = {55}, 27879 pages = {203--216} 27880} 27881 27882@Article{ dunn:global, 27883 author = {J. C. Dunn}, 27884 title = {Global and Asymptotic Convergence Rate Estimates for a Class of Projected 27885 Gradient Processes}, 27886 journal = {SIAM Journal on Control and Optimization}, 27887 year = {1981}, 27888 volume = {19}, 27889 pages = {368--400} 27890} 27891 27892@Article{ dunn:rates, 27893 author = {J. C. Dunn}, 27894 title = {Rates of Convergence for Conditional Gradient Algorithms Near Singular and 27895 Nonsingular Extremals}, 27896 journal = {SIAM Journal on Control and Optimization}, 27897 year = {1979}, 27898 volume = {17}, 27899 pages = {187--211} 27900} 27901 27902@Article{ dupuis.simha:sampling, 27903 author = {P. Dupuis and R. Simha}, 27904 title = {On Sampling-Controlled Stochastic Approximation}, 27905 journal = {{IEEE} Transactions on Automatic Control}, 27906 year = {1991}, 27907 volume = {36}, 27908 pages = {915--924} 27909} 27910 27911@TechReport{ eager.ferris.ea:models, 27912 author = {D. L. Eager and M. C. Ferris and M. K. Vernon}, 27913 title = {Models for Optimized Regional Caching in Heterogeneous Video-On-Demand Systems}, 27914 institution = {Computer Sciences Department, University of Wisconsin}, 27915 year = {1999}, 27916 type = {Technical Report}, 27917 number = {1402}, 27918 address = {Madison, Wisconsin}, 27919 url = {http: //www.cs.wisc.edu/tech-reports/reports/1999/tr1402.ps.Z}, 27920 key = {84} 27921} 27922 27923@InProceedings{ eager.ferris.ea:optimized, 27924 author = {D. L. Eager and M. C. Ferris and M. K. Vernon}, 27925 title = {Optimized Regional Caching for On-Demand Data Delivery}, 27926 year = {1999}, 27927 booktitle = {Multimedia Computing and Networking, Proceedings of {SPIE}}, 27928 volume = {3654}, 27929 address = {Bellingham, Washington}, 27930 url = {ftp://ftp.cs.wisc.edu/math-prog/tech-reports/98-10.ps}, 27931 key = {69}, 27932 pages = {301--316}, 27933 annote = {18 percent acceptance rate} 27934} 27935 27936@Article{ eager.ferris.ea:optimized*1, 27937 author = {D. L. Eager and M. C. Ferris and M. K. Vernon}, 27938 title = {Optimized Caching in Systems with Heterogeneous Client Populations}, 27939 journal = {Performance Evaluation}, 27940 year = {2000}, 27941 key = {72}, 27942 url = {ftp://ftp.cs.wisc.edu/math-prog/tech-reports/98-15.ps}, 27943 volume = {42}, 27944 pages = {163--185} 27945} 27946 27947@InProceedings{ eager.vernon:dynamic, 27948 author = {D. L. Eager and M. K. Vernon}, 27949 title = {Dynamic Skyscraper Broadcasts for Video-On-Demand}, 27950 year = {1998}, 27951 booktitle = {Proceedings of the 4th International Workshop on Multimedia Information Systems 27952 ({MIS '98})}, 27953 pages = {18--32}, 27954 address = {Istanbul, Turkey} 27955} 27956 27957@Article{ eaves.lemke:equivalence, 27958 author = {B. C. Eaves and C. E. Lemke}, 27959 title = {Equivalence of {LCP} and {PLS}}, 27960 journal = {Mathematics of Operations Research}, 27961 year = {1981}, 27962 volume = {6}, 27963 pages = {475--484} 27964} 27965 27966@Article{ eaves.rothblum:relationships, 27967 author = {B. C. Eaves and U. G. Rothblum}, 27968 title = {Relationships of Properties of Piecewise Affine Maps over Ordered Fields}, 27969 journal = {Linear Algebra and Its Applications}, 27970 year = {1990}, 27971 volume = {132}, 27972 pages = {1--63} 27973} 27974 27975@Article{ eaves:basic, 27976 author = {B. C. Eaves}, 27977 title = {On the Basic Theorem of Complementarity}, 27978 journal = {Mathematical Programming}, 27979 year = {1971}, 27980 volume = {1}, 27981 pages = {68--87} 27982} 27983 27984@Article{ eaves:computing, 27985 author = {B. C. Eaves}, 27986 title = {Computing Stationary Points}, 27987 journal = {Mathematical Programming Study}, 27988 year = {1978}, 27989 volume = {7}, 27990 pages = {1--14} 27991} 27992 27993@InCollection{ eaves:computing*1, 27994 author = {B. C. Eaves}, 27995 title = {Computing Stationary Points, Again}, 27996 pages = {391--405}, 27997 crossref = {mangasarian.meyer.ea:nonlinear*3} 27998} 27999 28000@Article{ eaves:homotopies, 28001 author = {B. C. Eaves}, 28002 title = {Homotopies for Computation of Fixed Points}, 28003 journal = {Mathematical Programming}, 28004 year = {1972}, 28005 volume = {3}, 28006 pages = {1--22} 28007} 28008 28009@Article{ eaves:linear, 28010 author = {B. C. Eaves}, 28011 title = {The Linear Complementarity Problem}, 28012 journal = {Management Science}, 28013 year = {1971}, 28014 volume = {17}, 28015 pages = {612--634} 28016} 28017 28018@Article{ eaves:quadratic, 28019 author = {B. C. Eaves}, 28020 title = {On Quadratic Programming}, 28021 journal = {Management Science}, 28022 year = {1971}, 28023 volume = {17}, 28024 pages = {698--711} 28025} 28026 28027@InProceedings{ eaves:short, 28028 author = {B. C. Eaves}, 28029 title = {A Short Course in Solving Equations with {PL} Homotopies}, 28030 booktitle = {Nonlinear Programming}, 28031 organization = {American Mathematical Society}, 28032 year = {1976}, 28033 editor = {R. W. Cottle and C. E. Lemke}, 28034 publisher = {SIAM--AMS Proceedings}, 28035 address = {Providence, RI}, 28036 pages = {73--143} 28037} 28038 28039@InCollection{ ebiefung.kostreva:global, 28040 author = {A. A. Ebiefung and M. M. Kostreva}, 28041 title = {Global Solvability of Generalized Linear Complementarity Problems and a Related 28042 Class of Polynomial Complementarity Problems}, 28043 editors = {C. Floudas and P. Pardalos}, 28044 booktitle = {Recent Advances in Global Optimization}, 28045 publisher = {Princeton University Press}, 28046 pages = {102--124}, 28047 year = {1991} 28048} 28049 28050@TechReport{ ebiefung.kostreva:z-matrices, 28051 author = {A. A. Ebiefung and M. M. Kostreva}, 28052 title = {{Z}--Matrices annd the Generalized Linear Complementarity Problem}, 28053 institution = {Department of Mathematical Sciences, Clemson University}, 28054 year = {1991}, 28055 number = {608}, 28056 address = {Clemson, South Carolina} 28057} 28058 28059@TechReport{ eckstein.bertsekas:alternating, 28060 author = {J. Eckstein and D. P. Bertsekas}, 28061 title = {An Alternating Direction Method for Linear Programming}, 28062 institution = {Harvard Business School}, 28063 year = {1990}, 28064 type = {Working Paper}, 28065 number = {90-063}, 28066 address = {Boston, MA} 28067} 28068 28069@Article{ eckstein.bertsekas:douglas-rachford, 28070 author = {J. Eckstein and D. P. Bertsekas}, 28071 title = {On the {D}ouglas-{R}achford Splitting Method and the Proximal Point Algorithm for 28072 Maximal Monotone Operators}, 28073 journal = {Mathematical Programming}, 28074 year = {1992}, 28075 pages = {293--318}, 28076 volume = {55} 28077} 28078 28079@Article{ eckstein.bertsekas:douglas-rachford*1, 28080 author = {J. Eckstein and D. P. Bertsekas}, 28081 title = {On the {D}ouglas--{R}achford Splitting Method and the Proximal Point Algorithm 28082 for Maximal Monotone Operators}, 28083 journal = {Mathematical Programming}, 28084 year = {1991}, 28085 note = {To appear} 28086} 28087 28088@TechReport{ eckstein.ferris:operator, 28089 author = {J. Eckstein and M. C. Ferris}, 28090 title = {Operator Splitting Methods for Monotone Linear Complementarity Problems}, 28091 institution = {Thinking Machines Corporation}, 28092 year = {1992}, 28093 address = {Cambridge, MA 02142}, 28094 number = {239}, 28095 type = {TMC}, 28096 key = {26} 28097} 28098 28099@Article{ eckstein.ferris:operator*1, 28100 author = {J. Eckstein and M. C. Ferris}, 28101 title = {Operator Splitting Methods for Monotone Affine Variational Inequalities, with a 28102 Parallel Application to Optimal Control}, 28103 volume = {10}, 28104 pages = {218--235}, 28105 year = {1998}, 28106 journal = {INFORMS Journal on Computing}, 28107 url = {ftp: //ftp.cs.wisc.edu/math-prog/tech-reports/94-17.ps}, 28108 key = {44} 28109} 28110 28111@Article{ eckstein.ferris:smooth, 28112 author = {J. Eckstein and M. C. Ferris}, 28113 title = {Smooth Methods of Multipliers for Complementarity Problems}, 28114 key = {58}, 28115 url = {ftp: //ftp.cs.wisc.edu/math-prog/tech-reports/97-01.ps}, 28116 year = {1999}, 28117 journal = {Mathematical Programming}, 28118 volume = {86}, 28119 pages = {65--90} 28120} 28121 28122@InProceedings{ eckstein.hart.ea:resource, 28123 author = {J. Eckstein and W. E. Hart and C. A. Phillips}, 28124 title = {Resource Management in a Parallel Mixed Integer Programming Package}, 28125 booktitle = {Intel Supercomputer Users Group Thirteenth Annual Conference}, 28126 year = {1997}, 28127 note = {www.cs.sandia.gov/ISUG97} 28128} 28129 28130@Article{ eckstein:alternating, 28131 author = {J. Eckstein}, 28132 title = {The Alternating Step Method for Monotropic Programming on the {Connection Machine 28133 CM-2}}, 28134 journal = {ORSA Journal on Computing}, 28135 year = {to appear} 28136} 28137 28138@Article{ eckstein:approximate, 28139 author = {J. Eckstein}, 28140 title = {Approximate Iterations in {B}regman-Function-Based Proximal Algorithms}, 28141 year = {1998}, 28142 journal = {Mathematical Programming}, 28143 volume = {83}, 28144 pages = {113--124} 28145} 28146 28147@Article{ eckstein:communication, 28148 author = {J. Eckstein}, 28149 title = {How Much Communication Does Parallel Branch and Bound Need}, 28150 journal = {{INFORMS} Journal on Computing}, 28151 volume = {9}, 28152 year = {1997}, 28153 pages = {15--29} 28154} 28155 28156@Article{ eckstein:distributed, 28157 author = {J. Eckstein}, 28158 title = {Distributed Versus Centralized Control for Parallel Branch and Bound: {M}ixed 28159 Integer Programming on the {CM}-5}, 28160 journal = {Computational Optimization and Applications}, 28161 volume = {7}, 28162 pages = {199--220}, 28163 year = {1997} 28164} 28165 28166@TechReport{ eckstein:lions-mercier, 28167 author = {J. Eckstein}, 28168 title = {The {L}ions--{M}ercier Splitting Algorithm and the Alternating Direction Method 28169 as instances of the Proximal Point Algorithm}, 28170 institution = {MIT}, 28171 year = {1988}, 28172 address = {Cambridge, Massachusetts}, 28173 number = {LIDS-P-1769} 28174} 28175 28176@Article{ eckstein:nonlinear, 28177 author = {J. Eckstein}, 28178 title = {Nonlinear Proximal Point Algorithms Using {B}regman Functions, with Applications 28179 to Convex Programming}, 28180 journal = {Mathematics of Operations Research}, 28181 year = {1993}, 28182 pages = {202--226}, 28183 volume = {18} 28184} 28185 28186@Article{ eckstein:parallel, 28187 author = {J. Eckstein}, 28188 title = {Parallel Branch-and-Bound Algorithms for General Mixed Integer Programming on the 28189 {CM}-5}, 28190 journal = {SIAM Journal on Optimization}, 28191 volume = {4}, 28192 pages = {794--814}, 28193 year = {1994} 28194} 28195 28196@TechReport{ eckstein:smooth, 28197 author = {J. Eckstein}, 28198 title = {Smooth Methods of Multipliers for Monotone Complementarity Problems}, 28199 institution = {Rutgers Center for Operations Research, Rutgers University}, 28200 address = {New Brunswick, New Jersey}, 28201 year = {1996}, 28202 type = {Research Report}, 28203 number = {27-96} 28204} 28205 28206@PhDThesis{ eckstein:splitting, 28207 author = {J. Eckstein}, 28208 title = {Splitting Methods for Monotone Operators, with Applications to Parallel 28209 Optimization}, 28210 school = {Massachusetts Institute of Technology}, 28211 year = {1989}, 28212 address = {Cambridge, MA}, 28213 note = {Report LIDS-TH-1877, Laboratory for Information and Decision Systems, M.I.T.} 28214} 28215 28216@Article{ eglese:simulated, 28217 author = {R. W. Eglese}, 28218 title = {Simulated Annealing: {A} Tool for Operational Research}, 28219 journal = {European Journal of Operations Research}, 28220 year = {1990}, 28221 volume = {46}, 28222 pages = {271--281} 28223} 28224 28225@Book{ ekeland.temam:convex, 28226 author = {I. Ekeland and R. Temam}, 28227 title = {Convex Analysis and Variational Problems}, 28228 year = {1976}, 28229 publisher = {North--Holland}, 28230 address = {Amsterdam} 28231} 28232 28233@Article{ ekeland:variational, 28234 author = {I. Ekeland}, 28235 title = {On the Variational Principle}, 28236 journal = {Journal of Mathematical Analysis and Applications}, 28237 year = {1974}, 28238 volume = {47}, 28239 pages = {324--353} 28240} 28241 28242@TechReport{ el-bakry.tapia.ea:formulation, 28243 author = {A. S. El-Bakry and R. A. Tapia and T. Tsuchiya and Y. Zhang}, 28244 title = {On the formulation and theory of the primal-dual {N}ewton interior-point method 28245 for nonlinear programming}, 28246 type = {{Technical Report TR92-40}}, 28247 institution = {{Department of Computational and Applied Mathematics, Rice University}}, 28248 year = {1992} 28249} 28250 28251@Article{ eldersveld.saunders:block, 28252 author = {S. K. Eldersveld and M. A. Saunders}, 28253 title = {A Block-{LU} Update for Large--Scale Linear Programming}, 28254 journal = {SIAM Journal on Matrix Analysis and Applications}, 28255 year = {1992}, 28256 volume = {13}, 28257 pages = {191--201} 28258} 28259 28260@Article{ elster.neumaier:grid, 28261 author = {C. Elster and A. Neumaier}, 28262 title = {A Grid Algorithm for Bound Constrained Optimization of Noisy Functions}, 28263 journal = {{IMA} Journal of Numerical Analysis}, 28264 year = {1995}, 28265 volume = {15}, 28266 pages = {585--608} 28267} 28268 28269@Article{ epema.livny.ea:worldwide, 28270 author = {D. H. J. Epema and M. Livny and R. van Dantzig and X. Evers and J. Pruyne}, 28271 title = {A Worldwide Flock of Condors: Load Sharing among Workstation Clusters}, 28272 journal = {Journal on Future Generations of Computer Systems}, 28273 year = {1996}, 28274 volume = {12}, 28275 pages = {53--65} 28276} 28277 28278@Book{ ermoliev.editors:numerical, 28279 author = {Y. Ermoliev and R. J.-B. Wets {(editors)}}, 28280 title = {Numerical Techniques for Stochastic Optimization Problems}, 28281 year = {1988}, 28282 publisher = {Springer-Verlag}, 28283 address = {Berlin} 28284} 28285 28286@TechReport{ evett.spiehler:rule, 28287 author = {I. W. Evett and E. J. Spiehler}, 28288 title = {Rule Induction in Forensic Science}, 28289 institution = {Central Research Establishment, Home Office Forensic Science Service}, 28290 year = {1987}, 28291 address = {Aldermaston, Reading, Berkshire RG7 4PN}, 28292 type = {Technical Report} 28293} 28294 28295@Article{ evtushenko.purtov:sufficient, 28296 author = {Y. G. Evtushenko and V. A. Purtov}, 28297 title = {Sufficient Conditions for a Minimum for Nonlinear Programming Problems}, 28298 journal = {Soviet Mathematics Doklady}, 28299 year = {1984}, 28300 volume = {30}, 28301 pages = {313--316} 28302} 28303 28304@Article{ facchinei.fischer.ea:regularity, 28305 author = {F. Facchinei and A. Fischer and C. Kanzow}, 28306 title = {Regularity Properties of a Semismooth Reformulation of Variational Inequalities}, 28307 journal = {SIAM Journal on Optimization}, 28308 year = {1998}, 28309 volume = {8}, 28310 pages = {850--869} 28311} 28312 28313@Article{ facchinei.fischer.ea:semismooth, 28314 title = {A Semismooth {N}ewton Method for Variational Inequalities: {T}he Case of Box 28315 Constraints}, 28316 author = {Facchinei, Francisco and Fischer, Andreas and Kanzow, Christian}, 28317 journal = {Complementarity and Variational Problems: State of the Art}, 28318 volume = {92}, 28319 pages = {76}, 28320 year = {1997} 28321} 28322 28323@TechReport{ facchinei.fischer.ea:simply, 28324 author = {F. Facchinei and A. Fischer and C. Kanzow and J. -M. Peng}, 28325 title = {A Simply Constrained Optimization Reformulation of {KKT} Systems Arising from 28326 Variational Inequalities}, 28327 institution = {University of Hamburg}, 28328 year = {1996} 28329} 28330 28331@Article{ facchinei.jiang.ea:smoothing, 28332 author = {F. Facchinei and H. Jiang and L. Qi}, 28333 title = {A Smoothing Method for Mathematical Programs with Equilibrium Constraints}, 28334 year = {1999}, 28335 journal = {Mathematical Programming}, 28336 volume = {85}, 28337 pages = {107--134} 28338} 28339 28340@Article{ facchinei.kanzow:nonsmooth, 28341 author = {F. Facchinei and C. Kanzow}, 28342 title = {A Nonsmooth Inexact {N}ewton Method for the solution of Large-Scale Nonlinear 28343 Complementarity Problems}, 28344 year = {1997}, 28345 journal = {Mathematical Programming}, 28346 volume = {76}, 28347 pages = {493--512} 28348} 28349 28350@Article{ facchinei.kanzow:unconstrained, 28351 author = {F. Facchinei and C. Kanzow}, 28352 title = {On Unconstrained and Constrained Stationary Points of the {I}mplicit 28353 {L}agrangian}, 28354 year = {1997}, 28355 journal = {Journal of Optimization Theory and Applications}, 28356 volume = {92}, 28357 pages = {99--115} 28358} 28359 28360@TechReport{ facchinei.pang:total, 28361 author = {F. Facchinei and J. S. Pang}, 28362 title = {Total stability of variational inequalities}, 28363 institution = {Universit\'a di Roma ``La Sapienza'', Dipartimento di Informatica e Sistemistica}, 28364 year = {1988}, 28365 type = {Manuscript}, 28366 address = {Roma, Italy} 28367} 28368 28369@Article{ facchinei.soares:merit, 28370 author = {F. Facchinei and J. Soares}, 28371 title = {A New Merit Function for Nonlinear Complementarity Problems and a Related 28372 Algorithm}, 28373 journal = {SIAM Journal on Optimization}, 28374 year = {1997}, 28375 volume = {7}, 28376 pages = {225--247} 28377} 28378 28379@InCollection{ facchinei.soares:testing, 28380 author = {F. Facchinei and J. Soares}, 28381 title = {Testing a new class of algorithms for nonlinear complementarity problems}, 28382 booktitle = {Variational Inequalities and Network Equilibrium Problems}, 28383 publisher = {Plenum Press}, 28384 address = {New York}, 28385 editor = {F. Giannessi and A. Maugeri}, 28386 year = {1995}, 28387 pages = {69--83} 28388} 28389 28390@InProceedings{ fahlman.lebiere:cascade-correlation, 28391 author = {S. E. Fahlman and C. Lebiere}, 28392 title = {The cascade-correlation learning architecture}, 28393 booktitle = {Advances in Neural Information Processing Systems II {(Denver 1989)}}, 28394 year = {1990}, 28395 editor = {D. S. Touretzky}, 28396 publisher = {Morgan Kaufmann}, 28397 address = {San Mateo, California}, 28398 pages = {524--532} 28399} 28400 28401@InProceedings{ fang.geiser.ea:software, 28402 author = {G. Fang and B. Geiser and T. R. Mackie}, 28403 title = {Software system for {UW}/{GE} tomotherapy prototype}, 28404 booktitle = {Proceedings of the XII International Conference on the Use of Computers in 28405 Radiation Therapy, Salt Lake City}, 28406 year = {1997}, 28407 editor = {D. D. Leavitt and G. Starkshall}, 28408 publisher = {Medical Physics Publishing}, 28409 address = {St. Louis, Missouri}, 28410 pages = {332--334} 28411} 28412 28413@Book{ fang.puthenpura:linear, 28414 author = {S.--C. Fang and S. Puthenpura}, 28415 title = {Linear Optimization and Extensions}, 28416 year = {1993}, 28417 publisher = {Prentice-Hall, Inc}, 28418 address = {Englewood Cliffs, New Jersey} 28419} 28420 28421@Article{ fayard.plateau:algorithm, 28422 author = {D. Fayard and G. Plateau}, 28423 title = {An Algorithm for the Solution of the 0--1 Knapsack Problem}, 28424 journal = {Computing}, 28425 year = {1982}, 28426 volume = {28}, 28427 pages = {269--287} 28428} 28429 28430@Book{ feller:introduction, 28431 author = {W. Feller}, 28432 title = {An Introduction to Probability Theory and its Applications}, 28433 publisher = {John Wiley \& Sons}, 28434 year = {1968}, 28435 address = {New York} 28436} 28437 28438@Article{ ferris.fourer.ea:expressing, 28439 author = {M. C. Ferris and R. Fourer and D. M. Gay}, 28440 title = {Expressing Complementarity Problems and Communicating them to Solvers}, 28441 journal = {SIAM Journal on Optimization}, 28442 volume = {9}, 28443 pages = {991--1009}, 28444 year = {1999}, 28445 url = {ftp://ftp.cs.wisc.edu/math-prog/tech-reports/98-02.ps}, 28446 key = {65}, 28447 institution = {Computer Sciences Department, University of Wisconsin}, 28448 address = {Madison, Wisconsin}, 28449 number = {98-02}, 28450 type = {Mathematical Programming Technical Report} 28451} 28452 28453@TechReport{ ferris.horn:nlp2mcp, 28454 author = {M. C. Ferris and J. D. Horn}, 28455 title = {{NLP2MCP}: Automatic conversion of nonlinear programs into mixed complementarity 28456 problems}, 28457 year = {1998}, 28458 institution = {Computer Sciences Department, University of Wisconsin}, 28459 note = {In preparation} 28460} 28461 28462@Article{ ferris.horn:partitioning, 28463 author = {M. C. Ferris and J. D. Horn}, 28464 title = {Partitioning Mathematical Programs for Parallel Solution}, 28465 year = {1998}, 28466 volume = {80}, 28467 pages = {35--62}, 28468 url = {ftp: //ftp.cs.wisc.edu/math-prog/tech-reports/tr1232.ps}, 28469 journal = {Mathematical Programming}, 28470 key = {40} 28471} 28472 28473@Article{ ferris.kanzow.ea:feasible, 28474 author = {M. C. Ferris and C. Kanzow and T. S. Munson}, 28475 title = {Feasible Descent Algorithms for Mixed Complementarity Problems}, 28476 year = {1999}, 28477 journal = {Mathematical Programming}, 28478 volume = {86}, 28479 pages = {475--497}, 28480 url = {ftp://ftp.cs.wisc.edu/math-prog/tech-reports/98-04.ps}, 28481 key = {67} 28482} 28483 28484@InCollection{ ferris.kanzow:complementarity, 28485 author = {M. C. Ferris and C. Kanzow}, 28486 title = {Complementarity and Related Problems: {A} Survey}, 28487 booktitle = {Handbook of Applied Optimization, forthcoming}, 28488 key = {74}, 28489 publisher = {Oxford University Press}, 28490 year = {2000}, 28491 editor = {P. M. Pardalos and M. G. C. Resende}, 28492 url = {ftp://ftp.cs.wisc.edu/math-prog/tech-reports/98-17.ps}, 28493 institution = {Computer Sciences Department, University of Wisconsin}, 28494 address = {Madison, Wisconsin}, 28495 number = {98-17}, 28496 type = {Mathematical Programming Technical Report} 28497} 28498 28499@Article{ ferris.lucidi.ea:nonmonotone, 28500 author = {M. C. Ferris and S. Lucidi and M. Roma}, 28501 title = {Nonmonotone Curvilinear Stabilization Techniques for Unconstrained Optimization}, 28502 journal = {Computational Optimization and Applications}, 28503 volume = {6}, 28504 pages = {117--136}, 28505 year = {1996}, 28506 url = {ftp: //ftp.cs.wisc.edu/math-prog/tech-reports/94-16.ps}, 28507 key = {43} 28508} 28509 28510@TechReport{ ferris.lucidi:globally, 28511 author = {M. C. Ferris and S. Lucidi}, 28512 title = {Globally Convergent Methods for Nonlinear Equations}, 28513 institution = {Computer Sciences Department, University of Wisconsin}, 28514 year = {1991}, 28515 address = {Madison, Wisconsin}, 28516 number = {1030}, 28517 url = {ftp: //ftp.cs.wisc.edu/tech-reports/reports/1991/tr1030.ps}, 28518 key = {21} 28519} 28520 28521@Article{ ferris.lucidi:nonmonotone, 28522 author = {M. C. Ferris and S. Lucidi}, 28523 title = {Nonmonotone Stabilization Methods for Nonlinear Equations}, 28524 journal = {Journal of Optimization Theory and Applications}, 28525 year = {1994}, 28526 volume = {81}, 28527 pages = {53--71}, 28528 key = {30} 28529} 28530 28531@Article{ ferris.mangasarian:breast, 28532 author = {M. C. Ferris and O. L. Mangasarian}, 28533 title = {Breast Cancer Diagnosis via Linear Programming}, 28534 key = {50}, 28535 journal = {{IEEE} Computational Science and Engineering}, 28536 year = {1995}, 28537 volume = {2}, 28538 pages = {70--71} 28539} 28540 28541@Article{ ferris.mangasarian:error, 28542 author = {M. C. Ferris and O. L. Mangasarian}, 28543 title = {Error Bounds and Strong Upper Semicontinuity for Monotone Affine Variational 28544 Inequalities}, 28545 journal = {Annals of Operations Research}, 28546 year = {1993}, 28547 volume = {47}, 28548 pages = {293--305}, 28549 url = {ftp://ftp.cs.wisc.edu/tech-reports/reports/1991/tr1056a.ps}, 28550 key = {24} 28551} 28552 28553@Article{ ferris.mangasarian:finite, 28554 author = {M. C. Ferris and O. L. Mangasarian}, 28555 title = {Finite Perturbation of Convex Programs}, 28556 journal = {Applied Mathematics and Optimization}, 28557 year = {1991}, 28558 volume = {23}, 28559 pages = {263--273}, 28560 key = {08} 28561} 28562 28563@Book{ ferris.mangasarian:linear, 28564 author = {M. C. Ferris and O. L. Mangasarian}, 28565 title = {Linear Programming via {MATLAB}}, 28566 publisher = {in preparation}, 28567 year = {1995}, 28568 address = {Madison, Wisconsin} 28569} 28570 28571@Article{ ferris.mangasarian:minimum, 28572 author = {M. C. Ferris and O. L. Mangasarian}, 28573 title = {Minimum Principle Sufficiency}, 28574 journal = {Mathematical Programming}, 28575 year = {1992}, 28576 volume = {57}, 28577 pages = {1--14}, 28578 key = {11} 28579} 28580 28581@Article{ ferris.mangasarian:parallel, 28582 author = {M. C. Ferris and O. L. Mangasarian}, 28583 title = {Parallel Constraint Distribution}, 28584 journal = {SIAM Journal on Optimization}, 28585 year = {1991}, 28586 volume = {1}, 28587 pages = {487--500}, 28588 url = {ftp://ftp.cs.wisc.edu/tech-reports/reports/1990/tr971a.ps}, 28589 key = {18} 28590} 28591 28592@Article{ ferris.mangasarian:parallel*1, 28593 author = {M. C. Ferris and O. L. Mangasarian}, 28594 title = {Parallel Variable Distribution}, 28595 journal = {SIAM Journal on Optimization}, 28596 year = {1994}, 28597 volume = {4}, 28598 pages = {815--832}, 28599 url = {ftp://ftp.cs.wisc.edu/tech-reports/reports/1993/tr1175.ps}, 28600 key = {31} 28601} 28602 28603@Article{ ferris.meeraus.ea:computing, 28604 title = {Computing {W}ardropian Equilibrium in a Complementarity Framework}, 28605 author = {M. C. Ferris and A. Meeraus and T. F. Rutherford}, 28606 journal = {Optimization Methods and Software}, 28607 year = {1999}, 28608 volume = {10}, 28609 pages = {669--685}, 28610 url = {ftp://ftp.cs.wisc.edu/math-prog/tech-reports/95-03.ps}, 28611 key = {45} 28612} 28613 28614@Article{ ferris.mesnier.ea:neos, 28615 author = {M. C. Ferris and M. P. Mesnier and J. Mor\'{e}}, 28616 title = {{NEOS} and {C}ondor: Solving Nonlinear Optimization Problems over the 28617 {I}nternet}, 28618 year = {2000}, 28619 journal = {{ACM} Transactions on Mathematical Software}, 28620 key = {54}, 28621 volume = {26}, 28622 pages = {1--18}, 28623 url = {ftp://ftp.cs.wisc.edu/math-prog/tech-reports/96-08.ps}, 28624 institution = {Computer Sciences Department, University of Wisconsin}, 28625 address = {Madison, Wisconsin}, 28626 number = {96-08}, 28627 type = {Mathematical Programming Technical Report}, 28628 note = {Also available as ANL/MCS-P708-0398, Mathematics and Computer Science Division, 28629 Argonne National Laboratory}, 28630 annote = {Revised version of: The {NEOS} System for Complementarity Problems: {PATH}, 28631 1996} 28632} 28633 28634@InCollection{ ferris.meyer:models, 28635 author = {M. C. Ferris and R. R. Meyer}, 28636 title = {Models and Solution for On-Demand Data Delivery Problems}, 28637 url = {ftp://ftp.cs.wisc.edu/math-prog/tech-reports/99-04.ps}, 28638 key = {80}, 28639 booktitle = {Approximation and Complexity in Numerical Optimization: Continuous and Discrete 28640 Problems}, 28641 editor = {P. M. Pardalos}, 28642 series = {Nonconvex Optimization and its Applications}, 28643 volume = {42}, 28644 address = {Dordrect}, 28645 year = {2000}, 28646 pages = {175--188}, 28647 publisher = {Kluwer}, 28648 type = {Mathematical Programming Technical Report}, 28649 institution = {Computer Sciences Department, University of Wisconsin}, 28650 number = {99-04} 28651} 28652 28653@InProceedings{ ferris.munson.ea:homotopy, 28654 author = {M. C. Ferris and T. S. Munson and D. Ralph}, 28655 title = {A Homotopy Method for Mixed Complementarity Problems based on the {PATH} Solver}, 28656 booktitle = {Numerical Analysis 1999}, 28657 key = {88}, 28658 year = {2000}, 28659 editor = {D. F. Griffiths and G. A. Watson}, 28660 series = {Research Notes in Mathematics}, 28661 url = {ftp://ftp.cs.wisc.edu/math-prog/tech-reports/99-09.ps}, 28662 address = {London}, 28663 pages = {143--167}, 28664 publisher = {Chapman and Hall}, 28665 institution = {Computer Sciences Department, University of Wisconsin}, 28666 number = {99-09}, 28667 type = {Mathematical Programming Technical Report} 28668} 28669 28670@TechReport{ ferris.munson.ea:practical, 28671 author = {M. C. Ferris and T. S. Munson and K. Sinapiromsaran}, 28672 title = {A Practical Approach to Sample-Path Simulation Optimization}, 28673 type = {Data Mining Institute Technical Report}, 28674 institution = {Computer Sciences Department, University of Wisconsin}, 28675 address = {Madison, Wisconsin}, 28676 year = {2000}, 28677 url = {ftp://ftp.cs.wisc.edu/pub/dmi/tech-reports/00-03.ps}, 28678 number = {00-03}, 28679 key = {92}, 28680 annote = {To appear in WSC 2000} 28681} 28682 28683@InCollection{ ferris.munson:case, 28684 author = {M. C. Ferris and T. S. Munson}, 28685 title = {Case Studies in Complementarity: Improving Model Formulation}, 28686 booktitle = {Ill--Posed Variational Problems and Regularization Techniques}, 28687 key = {73}, 28688 pages = {79--98}, 28689 publisher = {Springer Verlag}, 28690 year = {1999}, 28691 editor = {M. Th\'{e}ra and R. Tichatschke}, 28692 number = {477}, 28693 series = {Lecture Notes in Economics and Mathematical Systems}, 28694 address = {Berlin}, 28695 url = {ftp://ftp.cs.wisc.edu/math-prog/tech-reports/98-16.ps}, 28696 type = {Mathematical Programming Technical Report}, 28697 institution = {Computer Sciences Department, University of Wisconsin} 28698} 28699 28700@Article{ ferris.munson:complementarity, 28701 author = {M. C. Ferris and T. S. Munson}, 28702 title = {Complementarity Problems in {GAMS} and the {PATH} Solver}, 28703 year = {2000}, 28704 volume = {24}, 28705 pages = {165--188}, 28706 journal = {Journal of Economic Dynamics and Control}, 28707 url = {ftp://ftp.cs.wisc.edu/math-prog/tech-reports/98-12.ps}, 28708 key = {70}, 28709 type = {Mathematical Programming Technical Report}, 28710 institution = {Computer Sciences Department, University of Wisconsin}, 28711 address = {Madison, Wisconsin}, 28712 number = {98-12} 28713} 28714 28715@Misc{ ferris.munson:condor, 28716 author = {M. C. Ferris and T. S. Munson}, 28717 title = {Condor Modeling Language Interface}, 28718 organization = {Computer Sciences Department, University of Wisconsin}, 28719 address = {Madison, Wisconsin}, 28720 note = {ftp://ftp.cs.wisc.edu/math-prog/condor} 28721} 28722 28723@Manual{ ferris.munson:gams, 28724 author = {M. C. Ferris and T. S. Munson}, 28725 title = {{GAMS}/{PATH} User Guide: Version 4.3}, 28726 organization = {Department of Computer Sciences, University of Wisconsin, Madison} 28727} 28728 28729@Article{ ferris.munson:interfaces, 28730 author = {M. C. Ferris and T. S. Munson}, 28731 title = {Interfaces to {PATH} 3.0: Design, Implementation and Usage}, 28732 journal = {Computational Optimization and Applications}, 28733 volume = {12}, 28734 pages = {207--227}, 28735 year = {1999}, 28736 url = {ftp://ftp.cs.wisc.edu/math-prog/tech-reports/97-12.ps}, 28737 key = {63}, 28738 institution = {Computer Sciences Department, University of Wisconsin}, 28739 address = {Madison, Wisconsin}, 28740 number = {97-12}, 28741 type = {Mathematical Programming Technical Report} 28742} 28743 28744@TechReport{ ferris.munson:interior, 28745 author = {M. C. Ferris and T. S. Munson}, 28746 title = {Interior Point Methods for Massive Support Vector Machines}, 28747 institution = {Computer Sciences Department, University of Wisconsin}, 28748 year = {2000}, 28749 key = {94}, 28750 type = {Data Mining Institute Technical Report}, 28751 number = {00-05}, 28752 url = {ftp://ftp.cs.wisc.edu/pub/dmi/tech-reports/00-05.ps}, 28753 address = {Madison, Wisconsin}, 28754 annote = {Submitted to SIOPT} 28755} 28756 28757@Article{ ferris.munson:linear, 28758 author = {M. C. Ferris and T. S. Munson}, 28759 title = {Linear Programming for Emergency Broadcast Systems}, 28760 year = {1999}, 28761 journal = {{SIAG/OPT} Newsletter}, 28762 volume = {10}, 28763 pages = {6--8}, 28764 url = {ftp://ftp.cs.wisc.edu/math-prog/tech-reports/98-20.ps}, 28765 key = {76}, 28766 type = {Mathematical Programming Technical Report}, 28767 institution = {Computer Sciences Department, University of Wisconsin}, 28768 address = {Madison, Wisconsin}, 28769 number = {98-20} 28770} 28771 28772@Article{ ferris.munson:modeling, 28773 author = {M. C. Ferris and T. S. Munson}, 28774 title = {Modeling Languages and {C}ondor: Metacomputing for Optimization}, 28775 year = {2000}, 28776 journal = {Mathematical Programming}, 28777 volume = {88}, 28778 pages = {487--506}, 28779 url = {ftp://ftp.cs.wisc.edu/math-prog/tech-reports/98-13.ps}, 28780 key = {71}, 28781 type = {Mathematical Programming Technical Report}, 28782 institution = {Computer Sciences Department, University of Wisconsin}, 28783 address = {Madison, Wisconsin}, 28784 number = {98-13} 28785} 28786 28787@TechReport{ ferris.munson:preprocessing, 28788 author = {M. C. Ferris and T. S. Munson}, 28789 title = {Preprocessing Complementarity Problems}, 28790 type = {Mathematical Programming Technical Report}, 28791 institution = {Computer Sciences Department, University of Wisconsin}, 28792 address = {Madison, Wisconsin}, 28793 year = {1999}, 28794 url = {ftp://ftp.cs.wisc.edu/math-prog/tech-reports/99-07.ps}, 28795 number = {99-07}, 28796 key = {86}, 28797 annote = {Submitted to ICCP 99} 28798} 28799 28800@TechReport{ ferris.munson:semismooth, 28801 author = {M. C. Ferris and T. S. Munson}, 28802 title = {Semismooth Support Vector Machines}, 28803 institution = {Computer Sciences Department, University of Wisconsin}, 28804 year = {2000}, 28805 key = {97}, 28806 type = {Data Mining Institute Technical Report}, 28807 number = {00-09}, 28808 url = {ftp://ftp.cs.wisc.edu/pub/dmi/tech-reports/00-09.ps}, 28809 address = {Madison, Wisconsin}, 28810 annote = {Submitted to Math Prog B} 28811} 28812 28813@Article{ ferris.pang:engineering, 28814 author = {M. C. Ferris and J. S. Pang}, 28815 title = {Engineering and Economic Applications of Complementarity Problems}, 28816 year = {1997}, 28817 journal = {SIAM Review}, 28818 volume = {39}, 28819 pages = {669--713}, 28820 url = {http: //www.siam.org/journals/sirev/39-4/28596.html}, 28821 key = {46} 28822} 28823 28824@Article{ ferris.pang:nondegenerate, 28825 author = {M. C. Ferris and J. S. Pang}, 28826 title = {Nondegenerate Solutions and Related Concepts in Affine Variational Inequalities}, 28827 journal = {SIAM Journal on Control and Optimization}, 28828 year = {1996}, 28829 volume = {34}, 28830 pages = {244--263}, 28831 url = {ftp://ftp.cs.wisc.edu/tech-reports/reports/1994/tr1203.ps}, 28832 key = {35} 28833} 28834 28835@Article{ ferris.philpott:affine, 28836 author = {M. C. Ferris and A. B. Philpott}, 28837 title = {On Affine Scaling and Semi--Infinite Programming}, 28838 journal = {Mathematical Programming}, 28839 year = {1992}, 28840 volume = {56}, 28841 pages = {361--364}, 28842 key = {15} 28843} 28844 28845@Article{ ferris.philpott:interior, 28846 author = {M. C. Ferris and A. B. Philpott}, 28847 title = {An Interior Point Algorithm for Semi--Infinite Linear Programming}, 28848 journal = {Mathematical Programming}, 28849 year = {1989}, 28850 volume = {43}, 28851 pages = {257--276}, 28852 key = {04} 28853} 28854 28855@Article{ ferris.philpott:performance, 28856 author = {M. C. Ferris and A. B. Philpott}, 28857 title = {On the Performance of {K}armarkar's Algorithm}, 28858 journal = {Journal of the Operational Research Society}, 28859 year = {1988}, 28860 volume = {39}, 28861 pages = {257--270}, 28862 key = {03} 28863} 28864 28865@InCollection{ ferris.ralph:projected, 28866 author = {M. C. Ferris and D. Ralph}, 28867 title = {Projected Gradient Methods for Nonlinear Complementarity Problems via Normal 28868 Maps}, 28869 booktitle = {Recent Advances in Nonsmooth Optimization}, 28870 publisher = {World Scientific Publishers}, 28871 year = {1995}, 28872 pages = {57--87}, 28873 editor = {D. Du and L. Qi and R. Womersley}, 28874 url = {ftp://ftp.cs.wisc.edu/math-prog/tech-reports/94-08.ps}, 28875 key = {41} 28876} 28877 28878@Article{ ferris.ruszczynski:robust, 28879 author = {M. C. Ferris and A. Ruszczy{\'{n}}ski}, 28880 title = {Robust Path Choice and Vehicle Guidance in Networks with Failures}, 28881 year = {2000}, 28882 journal = {Networks}, 28883 volume = {35}, 28884 pages = {181--194}, 28885 url = {ftp://ftp.cs.wisc.edu/math-prog/tech-reports/97-04.ps}, 28886 key = {60} 28887} 28888 28889@InCollection{ ferris.rutherford:accessing, 28890 author = {M. C. Ferris and T. F. Rutherford}, 28891 title = {Accessing Realistic Complementarity Problems within {Matlab}}, 28892 booktitle = {Nonlinear Optimization and Applications}, 28893 key = {48}, 28894 url = {ftp://ftp.cs.wisc.edu/math-prog/tech-reports/95-10.ps}, 28895 editor = {G. Di Pillo and F. Giannessi}, 28896 year = {1996}, 28897 pages = {141--153}, 28898 publisher = {Plenum Press}, 28899 address = {New York} 28900} 28901 28902@InCollection{ ferris.shepard:optimizing, 28903 author = {M. C. Ferris and D. M. Shepard}, 28904 title = {Optimization of Gamma Knife Radiosurgery}, 28905 booktitle = {Discrete Mathematical Problems with Medical Applications, forthcoming}, 28906 editor = {D.-Z. Du and P. Pardolas and J. Wang}, 28907 publisher = {AMS}, 28908 year = {2000}, 28909 optseries = {DIMACS}, 28910 url = {ftp://ftp.cs.wisc.edu/pub/dmi/tech-reports/00-01.ps}, 28911 key = {91}, 28912 type = {Data Mining Institute Technical Report}, 28913 institution = {Computer Sciences Department, University of Wisconsin}, 28914 address = {Madison, Wisconsin}, 28915 number = {00-01} 28916} 28917 28918@InCollection{ ferris.sinapiromsaran:formulating, 28919 author = {M. C. Ferris and K. Sinapiromsaran}, 28920 title = {Formulating and Solving Nonlinear Programs as Mixed Complementarity Problems}, 28921 booktitle = {Optimization}, 28922 key = {77}, 28923 publisher = {Springer-Verlag}, 28924 year = {2000}, 28925 editor = {V.H. Nguyen and J. J. Strodiot and P. Tossings}, 28926 volume = {481}, 28927 series = {Lecture Notes in Economics and Mathematical Systems}, 28928 url = {ftp://ftp.cs.wisc.edu/math-prog/tech-reports/98-21.ps}, 28929 type = {Mathematical Programming Technical Report}, 28930 institution = {Computer Sciences Department, University of Wisconsin}, 28931 address = {Madison, Wisconsin}, 28932 number = {98-21} 28933} 28934 28935@Article{ ferris.tin-loi:limit, 28936 author = {M. C. Ferris and F. Tin-Loi}, 28937 title = {Limit Analysis of Frictional Block Assemblies as a Mathematical Program with 28938 Complementarity Constraints}, 28939 year = {2001}, 28940 url = {ftp://ftp.cs.wisc.edu/math-prog/tech-reports/99-01.ps}, 28941 key = {78}, 28942 journal = {International Journal of Mechanical Sciences}, 28943 pages = {209--224}, 28944 volume = {43}, 28945 type = {Mathematical Programming Technical Report}, 28946 institution = {Computer Sciences Department, University of Wisconsin}, 28947 address = {Madison, Wisconsin}, 28948 number = {99-01} 28949} 28950 28951@Article{ ferris.tin-loi:nonlinear, 28952 author = {M. C. Ferris and F. Tin-Loi}, 28953 title = {Nonlinear Programming Approach for a Class of Inverse Problems in 28954 Elastoplasticity}, 28955 year = {1998}, 28956 key = {64}, 28957 volume = {6}, 28958 pages = {857--870}, 28959 journal = {Structural Engineering and Mechanics} 28960} 28961 28962@Article{ ferris.tin-loi:solution, 28963 author = {M. C. Ferris and F. Tin-Loi}, 28964 title = {On the Solution of a Minimum Weight Elastoplastic Problem involving Displacement 28965 and Complementarity Constraints}, 28966 year = {1999}, 28967 journal = {Computer Methods in Applied Mechanics and Engineering}, 28968 volume = {174}, 28969 pages = {107--120}, 28970 url = {ftp://ftp.cs.wisc.edu/math-prog/tech-reports/minwt.ps}, 28971 key = {66} 28972} 28973 28974@Article{ ferris.vlach:scheduling, 28975 author = {M. C. Ferris and M. Vlach}, 28976 title = {Scheduling with Earliness and Tardiness Penalties}, 28977 journal = {Naval Research Logistics Quarterly}, 28978 year = {1992}, 28979 volume = {39}, 28980 pages = {229--245}, 28981 key = {13} 28982} 28983 28984@TechReport{ ferris.zavriev:linear, 28985 author = {M. C. Ferris and S. K Zavriev}, 28986 title = {The Linear Convergence of a Successive Linear Programming Algorithm}, 28987 institution = {Computer Sciences Department, University of Wisconsin}, 28988 year = {1996}, 28989 key = {56}, 28990 address = {Madison, Wisconsin}, 28991 type = {Mathematical Programming Technical Report}, 28992 number = {96--12}, 28993 url = {ftp://ftp.cs.wisc.edu/math-prog/tech-reports/96-12.ps} 28994} 28995 28996@Article{ ferris:finite, 28997 author = {M. C. Ferris}, 28998 title = {Finite Termination of the Proximal Point Algorithm}, 28999 journal = {Mathematical Programming}, 29000 year = {1991}, 29001 volume = {50}, 29002 pages = {359--366}, 29003 key = {06} 29004} 29005 29006@Article{ ferris:iterative, 29007 author = {M. C. Ferris}, 29008 title = {Iterative Linear Programming Solution of Convex Programs}, 29009 journal = {Journal of Optimization Theory and Applications}, 29010 year = {1990}, 29011 volume = {65}, 29012 pages = {53--65}, 29013 key = {07} 29014} 29015 29016@Article{ ferris:linear, 29017 author = {M. C. Ferris}, 29018 title = {The Linear Complementarity Problem}, 29019 journal = {Bulletin of the American Mathematical Society}, 29020 year = {1993}, 29021 volume = {28}, 29022 pages = {169--175}, 29023 key = {27} 29024} 29025 29026@MastersThesis{ ferris:linear*1, 29027 author = {M. C. Ferris}, 29028 title = {Linear Programming and Minimum Weight Design -- {A} Comparison of Methods for 29029 Solving a Class of Structural Optimization Problems}, 29030 year = {1985}, 29031 school = {University of Cambridge}, 29032 address = {England}, 29033 key = {01} 29034} 29035 29036@TechReport{ ferris:matlab, 29037 author = {M. C. Ferris}, 29038 title = {{MATLAB} and {GAMS}: Interfacing Optimization and Visualization Software}, 29039 institution = {Computer Sciences Department, University of Wisconsin}, 29040 year = {1998}, 29041 address = {Madison, Wisconsin}, 29042 type = {Mathematical Programming Technical Report}, 29043 url = {ftp://ftp.cs.wisc.edu/math-prog/tech-reports/98-19.ps}, 29044 number = {98-19}, 29045 key = {75} 29046} 29047 29048@Article{ ferris:parallel, 29049 author = {M. C. Ferris}, 29050 title = {Parallel Constraint Distribution for Convex Quadratic Programs}, 29051 journal = {Mathematics of Operations Research}, 29052 year = {1994}, 29053 volume = {19}, 29054 pages = {645--658}, 29055 url = {ftp://ftp.cs.wisc.edu/tech-reports/reports/1991/tr1009a.ps}, 29056 key = {20} 29057} 29058 29059@TechReport{ ferris:parallel*1, 29060 author = {M. C. Ferris}, 29061 title = {Parallel Solution of Extremely Large Knapsack Problems}, 29062 institution = {Computer Sciences Department, University of Wisconsin}, 29063 year = {1989}, 29064 address = {Madison, Wisconsin}, 29065 number = {842}, 29066 key = {09} 29067} 29068 29069@PhDThesis{ ferris:weak, 29070 author = {M. C. Ferris}, 29071 title = {Weak Sharp Minima and Penalty Functions in Mathematical Programming}, 29072 year = {1988}, 29073 school = {University of Cambridge}, 29074 address = {England}, 29075 key = {02} 29076} 29077 29078@TechReport{ ferris:weak*1, 29079 author = {M. C. Ferris}, 29080 title = {Weak Sharp Minima and Penalty Functions in Mathematical Programming}, 29081 institution = {Computer Sciences Department, University of Wisconsin}, 29082 year = {1988}, 29083 address = {Madison, Wisconsin}, 29084 number = {779}, 29085 key = {05} 29086} 29087 29088@Book{ fiacco.mccormick:nonlinear, 29089 author = {A. V. Fiacco and G. P. McCormick}, 29090 title = {Nonlinear Programming: Sequential Unconstrained Minimization Techniques}, 29091 year = {1968}, 29092 publisher = {John Wiley \& Sons}, 29093 address = {New York}, 29094 note = {SIAM Classics in Applied Mathematics 4, SIAM, Philadelphia, 1990} 29095} 29096 29097@Book{ fiacco:introduction, 29098 author = {A. V. Fiacco}, 29099 title = {Introduction to Sensitivity and Stability Analysis in Nonlinear Programming}, 29100 year = {1983}, 29101 publisher = {Academic Press}, 29102 address = {New York} 29103} 29104 29105@Article{ fiedler.ptak:matrices, 29106 author = {M. Fiedler and V. Pt\'{a}k}, 29107 title = {On matrices with nonpositive off-diagonal elements and positive principal 29108 minors}, 29109 journal = {Czechoslovak Mathematics Journal}, 29110 volume = {12}, 29111 pages = {382--400}, 29112 year = {1962} 29113} 29114 29115@Article{ fischer.kanzow:finite, 29116 author = {A. Fischer and C. Kanzow}, 29117 title = {On Finite Termination of an Iterative Method for Linear Complementarity 29118 Problems}, 29119 journal = {Mathematical Programming}, 29120 volume = {74}, 29121 pages = {279--292}, 29122 year = {1996} 29123} 29124 29125@TechReport{ fischer:constrained, 29126 author = {A. Fischer}, 29127 title = {A New Constrained Optimization Reformulation for Complementarity Problems}, 29128 institution = {Institute of Numerical Mathematics, Technical University of Dresden}, 29129 year = {1995}, 29130 type = {Technical Report}, 29131 number = {MATH-NM-10-1995}, 29132 address = {Dresden} 29133} 29134 29135@Article{ fischer:local, 29136 author = {A. Fischer}, 29137 title = {On the local superlinear convergence of a {N}ewton-type method for {LCP} under 29138 weak conditions}, 29139 journal = {Optimization Methods and Software}, 29140 year = {1995}, 29141 volume = {6}, 29142 pages = {83--107} 29143} 29144 29145@InCollection{ fischer:ncp-function, 29146 author = {A. Fischer}, 29147 title = {An {NCP}--Function and its Use for the Solution of Complementarity Problems}, 29148 booktitle = {Recent Advances in Nonsmooth Optimization}, 29149 publisher = {World Scientific Publishers}, 29150 editor = {D. Z. Du and L. Qi and R. S. Womersley}, 29151 year = {1995}, 29152 pages = {88--105} 29153} 29154 29155@Article{ fischer:newton-type, 29156 author = {A. Fischer}, 29157 title = {A {N}ewton-Type Method for Positive Semidefinite Linear Complementarity 29158 Problems}, 29159 journal = {Journal of Optimization Theory and Applications}, 29160 year = {1995}, 29161 volume = {86}, 29162 pages = {585--608} 29163} 29164 29165@Article{ fischer:solution, 29166 author = {A. Fischer}, 29167 title = {Solution of Monotone Complementarity Problems with Locally {L}ipschitzian 29168 Functions}, 29169 year = {1997}, 29170 journal = {Mathematical Programming}, 29171 pages = {513--532} 29172} 29173 29174@Article{ fischer:special, 29175 author = {A. Fischer}, 29176 title = {A Special {N}ewton--Type Optimization Method}, 29177 journal = {Optimization}, 29178 year = {1992}, 29179 volume = {24}, 29180 pages = {269--284} 29181} 29182 29183@Article{ fisher:use, 29184 author = {R. A. Fisher}, 29185 title = {The Use of Multiple Measurements in Taxonomic Problems}, 29186 journal = {Annual Eugenics}, 29187 year = {1936}, 29188 volume = {7}, 29189 number = {Part II}, 29190 pages = {179--188} 29191} 29192 29193@Book{ fishman:principles, 29194 author = {G. Fishman}, 29195 title = {Principles of Discrete Event Simulation}, 29196 publisher = {Wiley}, 29197 address = {New York, NY}, 29198 year = {1978} 29199} 29200 29201@Article{ fitchard.aldridge.ea:registration, 29202 author = {E. E. Fitchard and J. S. Aldridge and P. J. Reckwerdt and T. R. Mackie}, 29203 title = {Registration of Synthetic Tomographic Projection Data Sets Using 29204 Cross-Correlation}, 29205 journal = {Physics in Medicine and Biology}, 29206 year = {1998}, 29207 volume = {43}, 29208 pages = {1645--1657} 29209} 29210 29211@Article{ fletcher.matthews:stable, 29212 author = {R. Fletcher and S. P. J. Matthews}, 29213 title = {Stable Modifications of Explicit {LU} Factors for Simplex Updates}, 29214 journal = {Mathematical Programming}, 29215 year = {1984}, 29216 volume = {30}, 29217 pages = {267--284} 29218} 29219 29220@TechReport{ fletcher.maza:nonlinear, 29221 author = {R. Fletcher and E. Sainz de la Maza}, 29222 title = {Nonlinear Programming and Nonsmooth Optimization by Successive Linear 29223 Programming}, 29224 institution = {Department of Mathematical Sciences}, 29225 year = {1987}, 29226 address = {The University, Dundee, Scotland}, 29227 number = {NA/100}, 29228 type = {Numerical Analysis Report} 29229} 29230 29231@InCollection{ fletcher:class, 29232 author = {R. Fletcher}, 29233 title = {A Class of Methods for Nonlinear Programming with Termination and Convergence 29234 Properties}, 29235 booktitle = {Integer and Nonlinear Programming}, 29236 year = {1970}, 29237 editor = {J. Abadie}, 29238 publisher = {North--Holland}, 29239 address = {Amsterdam}, 29240 pages = {157--173} 29241} 29242 29243@Article{ fletcher:exact, 29244 author = {R. Fletcher}, 29245 title = {An Exact Penalty Function for Nonlinear Programming with Inequalities}, 29246 journal = {Mathematical Programming}, 29247 year = {1973}, 29248 volume = {5}, 29249 pages = {129--150} 29250} 29251 29252@Article{ fletcher:generalized, 29253 author = {R. Fletcher}, 29254 title = {Generalized Inverse Methods for the Best Least Squares Solution of Non--Linear 29255 Equations}, 29256 journal = {The Computer Journal}, 29257 year = {1968}, 29258 volume = {10}, 29259 pages = {392--399} 29260} 29261 29262@InProceedings{ fletcher:penalty, 29263 crossref = {bachem.grotschel.ea:mathematical}, 29264 author = {R. Fletcher}, 29265 title = {Penalty Functions}, 29266 pages = {87--114} 29267} 29268 29269@Book{ fletcher:practical, 29270 author = {R. Fletcher}, 29271 title = {Practical Methods of Optimization}, 29272 year = {1981}, 29273 publisher = {John Wiley \& Sons}, 29274 address = {Chichester}, 29275 volume = {1} 29276} 29277 29278@Book{ fletcher:practical*1, 29279 author = {R. Fletcher}, 29280 title = {Practical Methods of Optimization}, 29281 year = {1981}, 29282 publisher = {John Wiley \& Sons}, 29283 address = {Chichester}, 29284 volume = {2} 29285} 29286 29287@Book{ fletcher:practical*2, 29288 author = {R. Fletcher}, 29289 title = {Practical Methods of Optimization}, 29290 year = {1987}, 29291 publisher = {John Wiley \& Sons}, 29292 address = {New York}, 29293 edition = {second} 29294} 29295 29296@Unpublished{ fletcher:recent, 29297 author = {R. Fletcher}, 29298 title = {Recent Developments in Nonlinear Programming}, 29299 note = {Presentation at SOR 96, Braunchweig, Germany}, 29300 year = {1996} 29301} 29302 29303@InCollection{ fletcher:second, 29304 author = {R. Fletcher}, 29305 title = {Second Order Correction for Nondifferentiable Optimization}, 29306 booktitle = {Numerical Analysis}, 29307 year = {1982}, 29308 editor = {G. A. Watson}, 29309 publisher = {Springer-Verlag}, 29310 address = {Berlin}, 29311 pages = {85--114} 29312} 29313 29314@InCollection{ florian:mathematical, 29315 author = {M. Florian}, 29316 title = {Mathematical programming applications in national, regional, and urban planning}, 29317 editors = {M. Iri and K. Tanabe}, 29318 booktitle = {Mathematical Programming: Recent Developments and Applications}, 29319 publisher = {Kluwer Academic Publishers}, 29320 address = {Tokyo}, 29321 year = {1989} 29322} 29323 29324@Article{ florian:nonlinear, 29325 author = {M. Florian}, 29326 title = {Nonlinear Cost Network Models in Transportation Analysis}, 29327 journal = {Mathematical Programming Study}, 29328 year = {1986}, 29329 volume = {26}, 29330 pages = {167--196} 29331} 29332 29333@Article{ flynn:computer, 29334 author = {M.~J. Flynn}, 29335 title = {Some Computer Organizations and their Effectiveness}, 29336 journal = {IEEE Transactions on Computers}, 29337 year = {1972}, 29338 volume = {C-21}, 29339 pages = {948--960} 29340} 29341 29342@InProceedings{ fogarty:varying, 29343 crossref = {schaeffer:third}, 29344 author = {T. C. Fogarty}, 29345 title = {Varying the Probability of Mutation in the Genetic Algorithm}, 29346 pages = {422--427} 29347} 29348 29349@Article{ forrest.goldfarb:steepest-edge, 29350 author = {J. J. Forrest and D. Goldfarb}, 29351 title = {Steepest--Edge Simplex Algorithms for Linear Programming}, 29352 journal = {Mathematical Programming}, 29353 year = {1992}, 29354 volume = {57}, 29355 pages = {341--374} 29356} 29357 29358@Article{ forrest.tomlin:updating, 29359 author = {J. J. H. Forrest and J. A. Tomlin}, 29360 title = {Updating Triangular Factors of the Basis to Maintain Sparsity in the Product Form 29361 Simplex Method}, 29362 journal = {Mathematical Programming}, 29363 year = {1972}, 29364 volume = {2}, 29365 pages = {263--278} 29366} 29367 29368@TechReport{ forsgren.gill.ea:computing, 29369 author = {A. Forsgren and P. E. Gill and W. Murray}, 29370 title = {Computing Modified {N}ewton Directions using a Partial {C}holesky Factorization}, 29371 institution = {Department of Mathematics, Royal Institute of Technology}, 29372 year = {1993}, 29373 number = {TRITA-MAT-1993-9}, 29374 address = {Stockholm, Sweden} 29375} 29376 29377@TechReport{ forsgren.gill:primal-dual, 29378 author = {A. Forsgren and P. E. Gill}, 29379 title = {Primal-Dual Interior Methods for Nonconvex Nonlinear Programming}, 29380 institution = {Department of Mathematics, University of California}, 29381 year = {1996}, 29382 type = {Report NA}, 29383 number = {96-3}, 29384 address = {San Diego} 29385} 29386 29387@InCollection{ fortin.glowinski:decomposition-coordination, 29388 author = {M. Fortin and R. Glowinski}, 29389 title = {On Decomposition-Coordination Methods Using an Augmented Lagrangian}, 29390 booktitle = {Augmented Lagrangian methods: Applications to the Solution of Boundary Value 29391 Problems}, 29392 publisher = {North-Holland}, 29393 year = {1983}, 29394 editor = {M. Fortin and R. Glowinski}, 29395 address = {Amsterdam} 29396} 29397 29398@Misc{ foster.kesselman:globus, 29399 author = {I. Foster and C. Kesselman}, 29400 title = {The Globus Project}, 29401 howpublished = {www.globus.org} 29402} 29403 29404@Article{ foster.kesselman:globus*1, 29405 author = {I. Foster and C. Kesselman}, 29406 title = {Globus: A Metacomputing Infrastructure Toolkit}, 29407 journal = {International Journal of Supercomputer Applications}, 29408 volume = {11}, 29409 pages = {115--128}, 29410 year = {1997} 29411} 29412 29413@Book{ foster.kesselman:grid, 29414 editor = {I. Foster and C. Kesselman}, 29415 title = {The Grid: Blueprint for a Future Computing Infrastructure}, 29416 publisher = {Morgan Kaufmann Publishers}, 29417 year = {1999} 29418} 29419 29420@Book{ fourer.gay.ea:ampl, 29421 author = {R. Fourer and D. M. Gay and B. W. Kernighan}, 29422 title = {{AMPL}: {A} Modeling Language for Mathematical Programming}, 29423 year = {1993}, 29424 publisher = {Duxbury Press} 29425} 29426 29427@Article{ fourer.gay.ea:modeling, 29428 author = {R. Fourer and D. M. Gay and B. W. Kernighan}, 29429 title = {A Modeling Language for Mathematical Programming}, 29430 journal = {Management Science}, 29431 year = {1990}, 29432 volume = {36}, 29433 pages = {519--554} 29434} 29435 29436@Article{ fraass:development, 29437 author = {A. Fraass}, 29438 title = {The development of conformal radiation therapy}, 29439 journal = {Medical Physics}, 29440 year = {1995}, 29441 volume = {22}, 29442 number = {11}, 29443 pages = {1911--1921} 29444} 29445 29446@TechReport{ fraley:algorithms, 29447 author = {C. Fraley}, 29448 title = {Algorithms for Nonlinear Least Squares}, 29449 institution = {Stanford University}, 29450 year = {1988}, 29451 number = {{SOL} 88.16}, 29452 type = {Technical Report} 29453} 29454 29455@InCollection{ francois.mcdonald.ea:uruguay, 29456 author = {J. F. Francois and B. McDonald and H. Nordstrom}, 29457 title = {The {U}ruguay Round: {A} Numerically Based Qualitative Assessment}, 29458 booktitle = {The {U}ruguay Round and the Developing Economies}, 29459 address = {New York}, 29460 editors = {W. Martin and L. A. Winters}, 29461 publisher = {Cambridge University Press} 29462} 29463 29464@InCollection{ francois.mcdonald.ea:uruguay*1, 29465 author = {J. F. Francois and B. McDonald and H. Nordstrom}, 29466 title = {The {U}ruguay Round: {A} Global Analysis}, 29467 booktitle = {Challenges and Opportunities for East Asian Trade}, 29468 address = {Cambridge}, 29469 editors = {D. Robertson}, 29470 publisher = {Cambridge University Press} 29471} 29472 29473@Article{ frank.wolfe:algorithm, 29474 author = {M. Frank and P. Wolfe}, 29475 title = {An Algorithm for Quadratic Programming}, 29476 journal = {Naval Research Logistics Quarterly}, 29477 year = {1956}, 29478 volume = {3}, 29479 pages = {95--110} 29480} 29481 29482@Article{ freund.nachtigal:qmrpack, 29483 author = {R. W. Freund and N. M. Nachtigal}, 29484 title = {{QMRPACK}: {A} Package of {QMR} Algorithms}, 29485 journal = {{ACM} Transactions on Mathematical Software}, 29486 year = {1996}, 29487 volume = {22}, 29488 pages = {46--77} 29489} 29490 29491@InProceedings{ freund.schapire:experiments, 29492 author = {Y. Freund and R. E. Schapire}, 29493 title = {Experiments with a New Boosting Algorithm}, 29494 booktitle = {Machine Learning: Proceedings of the Thirteenth National Conference}, 29495 pages = {148--156}, 29496 year = {1996}, 29497 editor = {L. Saitta}, 29498 publisher = {Morgan Kaufmann} 29499} 29500 29501@Unpublished{ freund.todd:barrier, 29502 author = {Robert M. Freund and Michael J. Todd}, 29503 title = {Barrier functions and interior-point algorithms for linear programming with 29504 zero-, one-, or two-sided bounds on the variables}, 29505 year = {1992}, 29506 month = jul 29507} 29508 29509@Article{ friedman.chernina:iterative, 29510 author = {V. M. Friedman and V. S. Chernina}, 29511 title = {Iterative Methods Applied to the Solution of Contact Problems Between Bodies}, 29512 note = {In Russian}, 29513 journal = {Mekhanika Tvergodo Tela Academia Nauk SSSR}, 29514 volume = {1}, 29515 pages = {116--120}, 29516 year = {1967} 29517} 29518 29519@Article{ friesz.bernstein.ea:day-to-day, 29520 author = {T. L. Friesz and D. Bernstein and N. J. Mehta and R. L. Tobin and S. 29521 Ganjalizadeh}, 29522 title = {Day-to-day Dynamic Network Disequilibria and Idealized Traveller Information 29523 Systems}, 29524 journal = {Operations Research}, 29525 year = {1994}, 29526 volume = {42}, 29527 pages = {1120--1136} 29528} 29529 29530@Article{ friesz.tobin.ea:nonlinear, 29531 author = {T. L. Friesz and R. L. Tobin and T. E. Smith and P. T. Harker}, 29532 title = {A Nonlinear Complementarity Formulation and Solution Procedure for the General 29533 Derived Demand Network Equilibrium Problem}, 29534 journal = {Journal of Regional Science}, 29535 year = {1983}, 29536 volume = {23}, 29537 pages = {337--359} 29538} 29539 29540@Article{ friesz:network, 29541 author = {T. L. Friesz}, 29542 title = {Network Equilibrium, Design and Aggregation}, 29543 journal = {Transportation Research}, 29544 volume = {19A}, 29545 year = {1985}, 29546 pages = {413--427} 29547} 29548 29549@Unpublished{ frisch:logarithmic, 29550 author = {K. R. Frisch}, 29551 title = {The Logarithmic Potential Method of Convex Programming}, 29552 year = {1955}, 29553 note = {Unpublished manuscript, University Institute of Economics, Oslo} 29554} 29555 29556@Book{ fukunaga:statistical, 29557 author = {K. Fukunaga}, 29558 title = {Statistical Pattern Recognition}, 29559 year = {1990}, 29560 publisher = {Academic Press}, 29561 address = {New York} 29562} 29563 29564@Article{ fukushima.luo.ea:globally, 29565 author = {M. Fukushima and Z.--Q. Luo and J. S. Pang}, 29566 title = {A Globally Convergent Sequential Quadratic Programming Algorithm for Mathematical 29567 Programs with Linear Complementarity Constraints}, 29568 journal = {Computational Optimization and Applications}, 29569 year = {1998}, 29570 volume = {10}, 29571 pages = {5--34} 29572} 29573 29574@Article{ fukushima:equivalent, 29575 author = {M. Fukushima}, 29576 title = {Equivalent Differentiable Optimization Problems and Descent Methods for 29577 Asymmetric Variational Inequality Problems}, 29578 journal = {Mathematical Programming}, 29579 year = {1992}, 29580 volume = {53}, 29581 pages = {99--110} 29582} 29583 29584@Article{ fukushima:primal, 29585 author = {M. Fukushima}, 29586 title = {The Primal {D}ouglas-{R}achford Splitting Algorithm for a Class of Monotone 29587 Mappings with Application to the Traffic Equilibrium Problem}, 29588 journal = {Mathematical Programming}, 29589 year = {1996}, 29590 volume = {72}, 29591 pages = {1--15} 29592} 29593 29594@Article{ gabay.mercier:dual, 29595 author = {D. Gabay and B. Mercier}, 29596 title = {A Dual Algorithm for the Solution of Nonlinear Variational Inequalities via 29597 Finite Element Approximations}, 29598 journal = {Computational Mathematics and Applications}, 29599 year = {1976}, 29600 volume = {2}, 29601 pages = {17--48} 29602} 29603 29604@InCollection{ gabay:applications, 29605 author = {D. Gabay}, 29606 title = {Applications of the Method of Multipliers to Variational Inequalities}, 29607 booktitle = {Augmented {L}agrangian Methods: Applications to the Solution of Boundary Value 29608 Problems}, 29609 publisher = {North-Holland}, 29610 year = {1983}, 29611 editor = {M. Fortin and R. Glowinski}, 29612 address = {Amsterdam} 29613} 29614 29615@Unpublished{ gabriel.bernstein:path, 29616 author = {S. A. Gabriel and D. Berstein}, 29617 title = {A Path Generation Method for the Nonadditive, Asymmetric, Elastic Traffic 29618 Equilibrium Problem}, 29619 note = {Draft, 1995} 29620} 29621 29622@TechReport{ gabriel.kydes:nonlinear, 29623 author = {S. A. Gabriel and A. S. Kydes}, 29624 title = {A Nonlinear Complementarity Approach for Solving the National Energy Modeling 29625 System}, 29626 institution = {Mathematics and Computer Science Division, Argonne National Laboratory}, 29627 year = {1995}, 29628 type = {Preprint}, 29629 number = {MCS-P504-0395}, 29630 address = {Argonne, Illinois}, 29631 month = mar 29632} 29633 29634@InProceedings{ gabriel.more:smoothing, 29635 crossref = {ferris.pang:complementarity}, 29636 author = {S. A. Gabriel and J. J. Mor\'{e}}, 29637 title = {Smoothing of Mixed Complementarity Problems} 29638} 29639 29640@Article{ gabriel.pang:inexact, 29641 author = {S. A. Gabriel and J. S. Pang}, 29642 title = {An Inexact {NE/SQP} Method for Solving the Nonlinear Complementarity Problem}, 29643 journal = {Computational Optimization and Applications}, 29644 year = {1992}, 29645 volume = {1}, 29646 pages = {67--91} 29647} 29648 29649@InCollection{ gabriel.pang:trust, 29650 author = {S. A. Gabriel and J. S. Pang}, 29651 title = {A Trust Region Method for Constrained Nonsmooth Equations}, 29652 booktitle = {Large--Scale Optimization: State of the Art}, 29653 publisher = {Kluwer Academic Publishers}, 29654 year = {1994}, 29655 editor = {W. W. Hager and D. W. Hearn and P. M. Pardalos}, 29656 pages = {159--186} 29657} 29658 29659@PhDThesis{ gabriel:algorithms, 29660 author = {S. A. Gabriel}, 29661 title = {Algorithms for the Nonlinear Complementarity Problem: The {NE}/{SQP} Method and 29662 Extensions}, 29663 school = {The Johns Hopkins University}, 29664 year = {1992}, 29665 address = {Baltimore, Maryland} 29666} 29667 29668@Article{ gafni.bertsekas:two-metric, 29669 author = {E. M. Gafni and D. P. Bertsekas}, 29670 title = {Two-Metric Projection Methods for Constrained Optimization}, 29671 journal = {SIAM Journal on Control and Optimization}, 29672 year = {1984}, 29673 volume = {22}, 29674 pages = {936--964} 29675} 29676 29677@InProceedings{ gaivoronski:convergence, 29678 author = {A. A. Gaivoronski}, 29679 title = {Convergence of Parallel Backpropagation for Neural Networks}, 29680 booktitle = {SIAM Journal on Optimization}, 29681 year = {1994}, 29682 note = {Proceedings of Symposium on Parallel Optimization 3, Madison July 7-9, 1993, 29683 submitted} 29684} 29685 29686@Misc{ gaivoronski:private, 29687 author = {A. A. Gaivoronski}, 29688 title = {Private Communication}, 29689 year = {1992}, 29690 month = nov, 29691 address = {ITALTEL, Milan} 29692} 29693 29694@Book{ gale:theory, 29695 author = {D. Gale}, 29696 title = {The Theory of Linear Economic Models}, 29697 year = {1960}, 29698 publisher = {McGraw-Hill Book Company}, 29699 address = {New York} 29700} 29701 29702@Book{ gallant:neural, 29703 author = {S. I. Gallant}, 29704 title = {Neural Network Learning and Expert Systems}, 29705 year = {1993}, 29706 publisher = {MIT Press}, 29707 address = {Cambridge, Massachusetts} 29708} 29709 29710@InProceedings{ ganti.gehrke.ea:framework, 29711 author = {V. Ganti and J. Gehrke and R. Ramakrishnan}, 29712 title = {A Framework for Measuring Changes in Data Characteristics}, 29713 booktitle = {Proceedings of the Eighteenth ACM SIGACT-SIGMOD-SIGART Symposium on Principles of 29714 Database Systems, May 31 - June 2, 1999, Philadelphia, Pennsylvania}, 29715 publisher = {ACM Press}, 29716 year = {1999}, 29717 isbn = {1-58113-062-7}, 29718 pages = {126--137} 29719} 29720 29721@Book{ ganz:gamma, 29722 author = {J. C. Ganz}, 29723 title = {Gamma Knife Surgery}, 29724 publisher = {Springer-Verlag Wien}, 29725 year = {1997}, 29726 address = {Austria} 29727} 29728 29729@TechReport{ gao:nonlinear, 29730 author = {Y. Gao}, 29731 title = {Nonlinear Complementarity Problems in Large Deformed Beam Subject to Unilateral 29732 Conditions}, 29733 type = {Manuscript}, 29734 institution = {Department of Mathematics, Virginia Polytechnic Institute and State University}, 29735 month = oct, 29736 year = {1994} 29737} 29738 29739@Article{ garcia-palomares.mangasarian:superlinearly, 29740 author = {U. M. {Garcia--Palomares} and O. L. Mangasarian}, 29741 title = {Superlinearly Convergent {Q}uasi--{N}ewton Algorithms for Nonlinearly Constrained 29742 Optimization Problems}, 29743 journal = {Mathematical Programming}, 29744 year = {1976}, 29745 volume = {11}, 29746 pages = {1--13} 29747} 29748 29749@Article{ garcia-palomares.restuccia:global, 29750 author = {U. M. {Garcia--Palomares} and A. Restuccia}, 29751 title = {A Global Quadratic Algorithm for Solving a System of Mixed Equations}, 29752 journal = {Mathematical Programming}, 29753 year = {1981}, 29754 volume = {21}, 29755 pages = {290--300} 29756} 29757 29758@InProceedings{ garcia-palomares:superlinearly, 29759 author = {U. M. {Garcia--Palomares}}, 29760 title = {Superlinearly Convergent Algorithms for Linearly Constrained Optimization}, 29761 crossref = {mangasarian.meyer.ea:nonlinear*2}, 29762 pages = {101--119} 29763} 29764 29765@Article{ garcia.gould:theorem, 29766 author = {C. B. Garcia and F. J. Gould}, 29767 title = {A Theorem on Homotopy Paths}, 29768 journal = {Mathematics of Operations Research}, 29769 year = {1978}, 29770 volume = {3}, 29771 pages = {282--289} 29772} 29773 29774@Book{ garcia.zangwill:pathways, 29775 author = {C. B. Garcia and W. I. Zangwill}, 29776 title = {Pathways to Solutions, Fixed Points, and Equilibria}, 29777 year = {1981}, 29778 publisher = {Prentice-Hall, Inc}, 29779 address = {Englewood Cliffs, New Jersey} 29780} 29781 29782@Book{ garey.johnson:computers, 29783 author = {M. R. Garey and D. S. Johnson}, 29784 title = {Computers and Intractability, {A} Guide to the Theory of {NP}--Completeness}, 29785 year = {1979}, 29786 publisher = {W.H. Freeman and Company}, 29787 address = {San Francisco} 29788} 29789 29790@Article{ garey.tarjan.ea:one-processor, 29791 author = {M. R. Garey and R. E. Tarjan and G. T. Wilfong}, 29792 title = {One--Processor Scheduling with Symmetric Earliness and Tardiness Penalties}, 29793 journal = {Mathematics of Operations Research}, 29794 year = {1988}, 29795 volume = {13}, 29796 pages = {330--348} 29797} 29798 29799@Book{ garfinkel.nemhauser:integer, 29800 author = {R. S. Garfinkel and G. L. Nemhauser}, 29801 title = {Integer Programming}, 29802 year = {1972}, 29803 publisher = {John Wiley \& Sons}, 29804 address = {New York} 29805} 29806 29807@Book{ gass:linear, 29808 author = {S. Gass}, 29809 title = {Linear Programming Methods and Applications}, 29810 edition = {Fifth}, 29811 publisher = {Boyd and Fraser Publishing Company}, 29812 address = {Danvers, Massachusetts}, 29813 year = {1985} 29814} 29815 29816@InProceedings{ gay:combining, 29817 author = {D. M. Gay}, 29818 title = {On Combining the Schemes of {R}eid and {S}aunders for Sparse {LP} Bases}, 29819 booktitle = {Sparse Matrix Proceedings 1978}, 29820 editor = {I. S. Duff and G. W. Stewart}, 29821 year = {1978}, 29822 organization = {SIAM}, 29823 address = {Philadelphia, Pennsylvania}, 29824 pages = {313--334} 29825} 29826 29827@Article{ gay:electronic, 29828 author = {D. M. Gay}, 29829 title = {Electronic Mail Distribution of Linear Programming Test Problems}, 29830 journal = {{COAL} Newsletter}, 29831 year = {1985}, 29832 volume = {13}, 29833 pages = {10--12} 29834} 29835 29836@TechReport{ gay:hooking, 29837 author = {D. M. Gay}, 29838 title = {Hooking Your Solver to {AMPL}}, 29839 year = {1997}, 29840 institution = {Bell Laboratories}, 29841 address = {Murray Hill, New Jersey}, 29842 note = {Revised 1994, 1997} 29843} 29844 29845@Article{ gay:variant, 29846 author = {D. Gay}, 29847 title = {A Variant of {K}armarkar's Linear Programming Algorithm for Problems in Standard 29848 Form}, 29849 journal = {Mathematical Programming}, 29850 year = {1987}, 29851 volume = {37}, 29852 pages = {81--90} 29853} 29854 29855@Article{ geiger.kanzow:resolution, 29856 author = {C. Geiger and C. Kanzow}, 29857 title = {On the Resolution of Monotone Complementarity Problems}, 29858 journal = {Computational Optimization and Applications}, 29859 volume = {5}, 29860 year = {1996}, 29861 pages = {155--173} 29862} 29863 29864@Book{ geist.beguelin.ea:pvm, 29865 author = {G. A. Geist and A. L. Beguelin and J. J. Dongarra and W. Jiang and R. Manchek and 29866 V. S. Sunderam}, 29867 title = {{PVM}: Parallel Virtual Machine}, 29868 publisher = {MIT Press}, 29869 address = {Cambridge, Massachusetts}, 29870 year = {1994} 29871} 29872 29873@Article{ gendron.crainic:parallel, 29874 author = {B. Gendron and T. G. Crainic}, 29875 title = {Parallel Branch-and-Bound Algorithms: Survey and Synthesis}, 29876 journal = {Operations Research}, 29877 year = {1994}, 29878 volume = {42}, 29879 pages = {1042--1060} 29880} 29881 29882@Article{ george:automatic, 29883 author = {A. George}, 29884 title = {An automatic one-way dissection algorithm for irregular finite-element problems}, 29885 journal = {SIAM Journal on Numerical Analysis}, 29886 vol = {17}, 29887 pages = {740--751}, 29888 year = {1980} 29889} 29890 29891@InProceedings{ georges-schleuter:asparagos, 29892 crossref = {schaeffer:third}, 29893 author = {M. Georges--Schleuter}, 29894 title = {Asparagos: An Asynchronous Parallel Genetic Algorithm}, 29895 pages = {416--421} 29896} 29897 29898@Article{ georgiou:comments, 29899 author = {G. M. Georgiou}, 29900 title = {Comments On Hidden Nodes in Neural Nets}, 29901 journal = {IEEE Transactions on Circuits and Systems}, 29902 year = {1991}, 29903 volume = {38}, 29904 pages = {1410} 29905} 29906 29907@TechReport{ gertz.linderoth.ea:object-oriented, 29908 author = {M. Gertz and J. Linderoth and S. Wright}, 29909 title = {Object-Oriented Software for Linear Complementarity and Quadratic Programming}, 29910 institution = {MCS Division, Argonne National Laboratory}, 29911 year = {in preparation} 29912} 29913 29914@Article{ ghellinck.vial:polynomial, 29915 author = {G. de Ghellinck and J.--Ph. Vial}, 29916 title = {A Polynomial {N}ewton Method for Linear Programming}, 29917 journal = {Algorithmica}, 29918 year = {1986}, 29919 volume = {1}, 29920 pages = {425--453} 29921} 29922 29923@InCollection{ gilbert.ng:predicting, 29924 author = {J. R. Gilbert and E. Ng}, 29925 title = {Predicting Structure in Nonsymmetric Sparse Matrix Factorizations}, 29926 year = {1993}, 29927 booktitle = {Graph Theory and Sparse Matrix Computation}, 29928 editor = {A. George and J. Gilbert and J. Liu}, 29929 publisher = {Springer-Verlag} 29930} 29931 29932@Article{ gilbert-lemarechal, 29933 author = {J. C. Gilbert and C. Lemarechal}, 29934 title = {Some Numerical Experiments with Variable-Storage Quasi-Newton Algorithms}, 29935 journal = {Mathematical Programming}, 29936 year = {1989}, 29937 volume = {45}, 29938 pages = {407--434} 29939} 29940 29941@Article{ gill.murray.ea:computing, 29942 author = {P. E. Gill and W. Murray and M. A. Saunders and M. H. Wright}, 29943 title = {Computing Forward-Difference Intervals for Numerical Optimization}, 29944 journal = {SIAM Journal on Scientific and Statistical Computing}, 29945 year = {1983}, 29946 volume = {4}, 29947 pages = {310--321} 29948} 29949 29950@Article{ gill.murray.ea:maintaining, 29951 author = {P. E. Gill and W. Murray and M. A. Saunders and M. H. Wright}, 29952 title = {Maintaining {LU} Factors of a General Sparse Matrix}, 29953 year = {1987}, 29954 journal = {Linear Algebra and Its Applications}, 29955 volume = {88/89}, 29956 pages = {239--270} 29957} 29958 29959@Book{ gill.murray.ea:practical, 29960 author = {P. E. Gill and W. Murray and M. H. Wright}, 29961 title = {Practical Optimization}, 29962 year = {1981}, 29963 publisher = {Academic Press}, 29964 address = {London} 29965} 29966 29967@Article{ gill.murray.ea:practical*1, 29968 author = {P. E. Gill and W. Murray and M. A. Saunders and M. H. Wright}, 29969 title = {A Practical Anti-Cycling Procedure for Linearly Constrained Optimization}, 29970 journal = {Mathematical Programming}, 29971 year = {1989}, 29972 volume = {45}, 29973 pages = {437--474} 29974} 29975 29976@Article{ gill.murray.ea:projected, 29977 author = {P. E. Gill and W. Murray and M. A. Saunders and J. A. Tomlin and M. H. Wright}, 29978 title = {On Projected {N}ewton Barrier Methods for Linear Programming and an Equivalence 29979 to {K}armarkar's Projective Method}, 29980 journal = {Mathematical Programming}, 29981 year = {1986}, 29982 volume = {36}, 29983 pages = {183--209} 29984} 29985 29986@Article{ gill.murray:newton-type, 29987 author = {P. E. Gill and W. Murray}, 29988 title = {{N}ewton--Type Methods for Unconstrained and Linearly Constrained Optimization}, 29989 journal = {Mathematical Programming}, 29990 year = {1974}, 29991 volume = {7}, 29992 pages = {311--350} 29993} 29994 29995@InProceedings{ gill.murray:nonlinear, 29996 author = {P. E. Gill and W. Murray}, 29997 title = {Nonlinear Least Squares and Nonlinearly Constrained Optimization}, 29998 booktitle = {Numerical Analysis, Dundee 1975}, 29999 year = {1976}, 30000 editor = {G. A. Watson}, 30001 publisher = {Springer-Verlag}, 30002 address = {Berlin}, 30003 note = {Lecture Notes in Mathematics 506} 30004} 30005 30006@Book{ ginsburgh.waelbroeck:activity, 30007 author = {V. Ginsburgh and J. Waelbroeck}, 30008 title = {Activity Analysis and General Equilibrium Modelling}, 30009 publisher = {North--Holland}, 30010 year = {1981}, 30011 address = {Amsterdam} 30012} 30013 30014@Article{ glad.goldstein:errors, 30015 author = {T. Glad and A. Goldstein}, 30016 title = {Optimization of Functions Whose Values are Subject to Small Errors}, 30017 journal = {BIT}, 30018 year = {1977}, 30019 volume = {17}, 30020 pages = {160--169} 30021} 30022 30023@Article{ glad.polak:multiplier, 30024 author = {T. Glad and E. Polak}, 30025 title = {A Multiplier Method with Automatic Limitation of Penalty Growth}, 30026 journal = {Mathematical Programming}, 30027 year = {1979}, 30028 volume = {17}, 30029 pages = {140--155} 30030} 30031 30032@Book{ glashoff.gustafson:linear, 30033 author = {K. Glashoff and S.--\AA. Gustafson}, 30034 title = {Linear Optimization and Approximation}, 30035 year = {1983}, 30036 publisher = {Springer-Verlag}, 30037 address = {New York} 30038} 30039 30040@Article{ glover:improved, 30041 author = {F. Glover}, 30042 title = {Improved Linear Programming Models for Discriminant Analysis}, 30043 journal = {Decision Sciences}, 30044 year = {1990}, 30045 volume = {21}, 30046 pages = {771--785} 30047} 30048 30049@Book{ glasserman:gradient, 30050 author = {P. Glasserman}, 30051 title = {Gradient Estimation via Perturbation Analysis}, 30052 publisher = {Kluwer}, 30053 year = {1991}, 30054 address = {Norwell, MA} 30055} 30056 30057@Article{ glover:tabu, 30058 author = {F. Glover}, 30059 title = {Tabu Search -- Part 1}, 30060 journal = {ORSA Journal on Computing}, 30061 year = {1989}, 30062 volume = {1}, 30063 pages = {190--206} 30064} 30065 30066@Article{ glowinski.marroco:sur, 30067 author = {R. Glowinski and A. Marroco}, 30068 title = {Sur l'Approximation, par Elements d'Ordre un, et la Resolution, par 30069 Penalisation-Dualit\'{e}, d'une Classe de Problemes de {D}irichlet non Lineares}, 30070 journal = {Revue Fran\c{c}aise d'Automatique, Informatique, et Recherche Operationelle}, 30071 year = {1975}, 30072 volume = {9(R-2)}, 30073 pages = {41--76} 30074} 30075 30076@TechReport{ goeleven.nguyen:convergence, 30077 author = {D. Goeleven and V. H. Nguyen}, 30078 title = {On the Convergence of the Parallel Constraint Distribution Algorithm}, 30079 institution = {Department of Mathematics, Facultes Universitaires de Namur}, 30080 year = {1992}, 30081 address = {B-5000 Namur, Belgium} 30082} 30083 30084@Book{ goldberg:genetic, 30085 author = {D. E. Goldberg}, 30086 title = {Genetic Algorithms in Search, Optimization and Machine Learning}, 30087 year = {1989}, 30088 publisher = {Addison-Wesley}, 30089 address = {Reading MA} 30090} 30091 30092@Article{ golden.skiscim:simulated, 30093 author = {B. L. Golden and C. C. Skiscim}, 30094 title = {Using Simulated Annealing to Solve Routing and Location Problems}, 30095 journal = {Naval Research Logistics Quarterly}, 30096 year = {1989}, 30097 volume = {33}, 30098 pages = {261--279} 30099} 30100 30101@Article{ goldfarb.reid:practical, 30102 author = {D. Goldfarb and J. K. Reid}, 30103 title = {A Practical Steepest--Edge Simplex Algorithm}, 30104 journal = {Mathematical Programming}, 30105 year = {1977}, 30106 volume = {12}, 30107 pages = {361--371} 30108} 30109 30110@InProceedings{ goldman.tucker:theory, 30111 author = {A. J. Goldman and A. W. Tucker}, 30112 title = {Theory of Linear Programming}, 30113 booktitle = {Linear Inequalities and Related Systems}, 30114 year = {1956}, 30115 editor = {H. W. Kuhn and A. W. Tucker}, 30116 publisher = {Princeton University Press}, 30117 address = {Princeton, New Jersey}, 30118 pages = {53--97} 30119} 30120 30121@Book{ goldstein:constructive, 30122 author = {A. A. Goldstein}, 30123 title = {Constructive Real Analysis}, 30124 year = {1967}, 30125 publisher = {Harper and Row}, 30126 address = {New York} 30127} 30128 30129@Article{ golshtein:block, 30130 author = {Ye. G. Golshtein}, 30131 title = {The Block Method of Convex Programming}, 30132 journal = {Soviet Mathematics Doklady}, 30133 year = {1986}, 30134 volume = {33}, 30135 pages = {584--587} 30136} 30137 30138@Article{ golshtein:general, 30139 author = {Ye. G. Golshtein}, 30140 title = {A General Approach to Decomposition of Optimization Systems}, 30141 journal = {Soviet Journal of Computer and Systems Sciences}, 30142 year = {1987}, 30143 volume = {3}, 30144 pages = {105--114} 30145} 30146 30147@Article{ golub.kahan:calculating, 30148 author = {G. H. Golub and W. Kahan}, 30149 title = {Calculating the Singular Values and Pseudoinverse of a Matrix}, 30150 journal = {SIAM Journal on Numerical Analysis}, 30151 year = {1965}, 30152 volume = {2}, 30153 pages = {205--224} 30154} 30155 30156@Book{ golub.vanloan:matrix, 30157 author = {G. H. Golub and C. F. {Van Loan}}, 30158 title = {Matrix Computations}, 30159 year = {1996}, 30160 publisher = {The John Hopkins University Press}, 30161 address = {Baltimore, Maryland}, 30162 edition = {Third} 30163} 30164 30165@TechReport{ gomez.barron:exponential, 30166 author = {S. Gom\'{e}z and C. Barr\'{o}n}, 30167 title = {The Exponential Tunneling Method}, 30168 institution = {Universidad Nacional Autonoma de Mexico}, 30169 year = {1991}, 30170 type = {Serie Reportes de Investigacion}, 30171 number = {3}, 30172 address = {Mexico} 30173} 30174 30175@Article{ gondzio:multiple, 30176 author = {J. Gondzio}, 30177 title = {Multiple Centrality Corrections in a Primal-Dual Method for Linear Programming}, 30178 journal = {Computational Optimization and Applications}, 30179 year = {1996}, 30180 volume = {6}, 30181 pages = {137--156} 30182} 30183 30184@TechReport{ gonzaga:algorithm, 30185 author = {C. C. Gonzaga}, 30186 title = {An Algorithm for Solving Linear Programming Problems in {O}($n^3${L}) 30187 operations}, 30188 institution = {Electronics Research Laboratory, University of California}, 30189 year = {1987}, 30190 address = {Berkeley, California}, 30191 number = {UCB/ERL M87/10}, 30192 type = {Memorandum} 30193} 30194 30195@Article{ gould.tolle:necessary, 30196 author = {F. J. Gould and J. W. Tolle}, 30197 title = {A Necessary and Sufficient Qualification for Constrained Optimization}, 30198 journal = {SIAM Journal on Applied Mathematics}, 30199 year = {1971}, 30200 volume = {20}, 30201 pages = {164--172} 30202} 30203 30204@InProceedings{ goux.kulkarni.ea:enabling, 30205 author = {J.-P. Goux and S. Kulkarni and J. Linderoth and M. E. Yoder}, 30206 title = {An Enabling Framework for Master-Worker Applications on the Computational Grid}, 30207 booktitle = {Proceedings of the Ninth {IEEE} International Symposium on High Performance 30208 Distributed Computing}, 30209 year = {2000} 30210} 30211 30212@Article{ gowda.pang:basic, 30213 author = {M. S. Gowda and J. S. Pang}, 30214 title = {The Basic Theorem of Complementarity Revisited}, 30215 journal = {Mathematical Programming}, 30216 year = {1993}, 30217 volume = {58}, 30218 pages = {161--178} 30219} 30220 30221@Article{ gowda.pang:boundedness, 30222 author = {M. S. Gowda and J. S. Pang}, 30223 title = {On the Boundedness and Stability of Solutions to the Affine Variational 30224 Inequality Problem}, 30225 journal = {SIAM Journal on Control and Optimization}, 30226 year = {1994}, 30227 volume = {32}, 30228 pages = {421--441} 30229} 30230 30231@Article{ gowda.pang:stability, 30232 author = {M. S. Gowda and J. S. Pang}, 30233 title = {Stability analysis of variational inequalities and nonlinear complementarity 30234 problems, via the mixed linear complementarity problem and degree theory}, 30235 journal = {Mathematics of Operations Research}, 30236 year = {1994}, 30237 volume = {19}, 30238 pages = {831--879} 30239} 30240 30241@Article{ gowda.sznajder:generalizations, 30242 author = {M. S. Gowda and R. Sznajder}, 30243 title = {Generalizations of ${P}_0$-- and ${P}$-- properties; Extended Vertical and 30244 Horizontal {LCP}s}, 30245 journal = {Linear Algebra and Its Applications}, 30246 year = {1995}, 30247 volume = {223/224}, 30248 pages = {695--715} 30249} 30250 30251@Article{ gowda.sznajder:generalized, 30252 author = {M. S. Gowda and R. Sznajder}, 30253 title = {The Generalized Order Linear Complementarity Problem}, 30254 journal = {SIAM Journal on Matrix Analysis and Applications}, 30255 year = {1994} 30256} 30257 30258@Article{ gowda:analysis, 30259 author = {M. S. Gowda}, 30260 title = {An Analysis of Zero Set and Global Error Bound Properties of a Piecewise Affine 30261 Function via its Recession Function}, 30262 journal = {SIAM Journal on Matrix Analysis and Applications}, 30263 year = {1996}, 30264 volume = {17}, 30265 pages = {594--609} 30266} 30267 30268@Article{ gowda:applications, 30269 author = {M. S. Gowda}, 30270 title = {Applications of Degree Theory to Linear Complementarity Problems}, 30271 journal = {Mathematics of Operations Research}, 30272 year = {1993}, 30273 volume = {18}, 30274 pages = {868--879} 30275} 30276 30277@Article{ grant.woo:clinical, 30278 author = {W. I. Grant and S. Y. Woo}, 30279 title = {Clinical and Financial Issues for Intensity Modulated Radiation Therapy 30280 Delivery}, 30281 journal = {Seminars in Radiation Oncology}, 30282 year = {1999}, 30283 volume = {9}, 30284 pages = {99--107} 30285} 30286 30287@Article{ greenberg.hegerich:branch, 30288 author = {H. Greenberg and R. L. Hegerich}, 30289 title = {A Branch Search Algorithm for the Knapsack Problem}, 30290 journal = {Management Science}, 30291 year = {1970}, 30292 volume = {16}, 30293 pages = {327--332} 30294} 30295 30296@InCollection{ grefenstette:incorporating, 30297 crossref = {davis:genetic}, 30298 author = {J. J. Grefenstette}, 30299 title = {Incorporating Problem Specific Knowledge into Genetic Algorithms} 30300} 30301 30302@Book{ griewank.corliss:automatic, 30303 editor = {A. Griewank and G. F. Corliss}, 30304 title = {Automatic Differentiation of Algorithms: Theory, Implementation and Application}, 30305 publisher = {SIAM}, 30306 year = {1991}, 30307 address = {Philadelphia, Pennsylvania} 30308} 30309 30310@Article{ griewank.juedes.ea:adol-c, 30311 author = {A. Griewank and D. Juedes and J. Utke}, 30312 title = {{ADOL}-{C}: {A} Package for the Automatic Differentiation of Algorithms Written 30313 in {C}/{C}++}, 30314 journal = {{ACM} Transactions on Mathematical Software}, 30315 year = {1996}, 30316 volume = {22}, 30317 pages = {131--167} 30318} 30319 30320@Article{ griffith.stewart:nonlinear, 30321 author = {R. E. Griffith and R. A. Stewart}, 30322 title = {A Nonlinear Programming Technique for the Optimization of Continuous Processing 30323 Systems}, 30324 journal = {Management Science}, 30325 year = {1961}, 30326 volume = {7}, 30327 pages = {379--392} 30328} 30329 30330@Article{ grinold:mathematical, 30331 author = {R. C. Grinold}, 30332 title = {Mathematical Methods for {PA}ttern Classification}, 30333 journal = {Management Science}, 30334 year = {1972}, 30335 volume = {19}, 30336 pages = {272--289} 30337} 30338 30339@Article{ grippo.lampariello.ea:class, 30340 author = {L. Grippo and F. Lampariello and S. Lucidi}, 30341 title = {A Class of Nonmonotone Stabilization Methods in Unconstrained Optimization}, 30342 journal = {Numerische Mathematik}, 30343 year = {1991}, 30344 volume = {59}, 30345 pages = {779--805} 30346} 30347 30348@Article{ grippo.lampariello.ea:global, 30349 author = {L. Grippo and F. Lampariello and S. Lucidi}, 30350 title = {Global Convergence and Stabilization of Unconstrained Minimization Methods 30351 Without Derivatives}, 30352 journal = {Journal of Optimization Theory and Applications}, 30353 year = {1988}, 30354 volume = {56}, 30355 pages = {385--406} 30356} 30357 30358@Article{ grippo.lampariello.ea:nonmonotone, 30359 author = {L. Grippo and F. Lampariello and S. Lucidi}, 30360 title = {A Nonmonotone Line Search Technique for {N}ewton's Method}, 30361 journal = {SIAM Journal on Numerical Analysis}, 30362 year = {1986}, 30363 volume = {23}, 30364 pages = {707--716} 30365} 30366 30367@Misc{ grippo:private, 30368 author = {L. Grippo}, 30369 title = {Private Communication}, 30370 year = {1992}, 30371 address = {Universita degli Studi di Roma ``La Sapienza'',Roma} 30372} 30373 30374@Article{ grotschel.lovasz.ea:ellipsoid, 30375 author = {M. Gr{\"{o}}tschel and L. Lov\'{a}sz and A. Schrijver}, 30376 title = {The Ellipsoid Method and its Consequences in Combinatorial Optimization}, 30377 journal = {Combinatorica}, 30378 year = {1981}, 30379 volume = {1}, 30380 pages = {169--197} 30381} 30382 30383@Article{ guignard:generalized, 30384 author = {M. Guignard}, 30385 title = {Generalized {K}uhn--{T}ucker conditions for Mathematical Programming in a 30386 {B}anach Space}, 30387 journal = {SIAM Journal on Control and Optimization}, 30388 year = {1969}, 30389 volume = {7}, 30390 pages = {232--241} 30391} 30392 30393@Article{ guler.ye:convergence, 30394 author = {O. G{\"{u}}ler and Y. Ye}, 30395 title = {Convergence Behavior of Interior--Point Algorithms}, 30396 journal = {Mathematical Programming}, 30397 year = {1993}, 30398 volume = {60}, 30399 pages = {215--228} 30400} 30401 30402@Article{ guler:existence, 30403 author = {O. G{\"{u}}ler}, 30404 title = {Existence of Interior Points and Interior Paths in Nonlinear Monotone 30405 Complementarity Problems}, 30406 journal = {Mathematics of Operations Research}, 30407 year = {1993}, 30408 volume = {18}, 30409 pages = {128--147} 30410} 30411 30412@Article{ guler:generalized, 30413 author = {O. G{\"{u}}ler}, 30414 title = {Generalized Linear Complementarity Problems}, 30415 journal = {Mathematics of Operations Research}, 30416 year = {1995}, 30417 volume = {20}, 30418 pages = {441--448} 30419} 30420 30421@Article{ gupta.sen:minimizing, 30422 author = {S. Gupta and T. Sen}, 30423 title = {Minimizing the Range of Lateness on a Single Machine}, 30424 journal = {Journal of the Operational Research Society}, 30425 year = {1984}, 30426 volume = {35}, 30427 pages = {853--857} 30428} 30429 30430@InCollection{ gustafson:numerical, 30431 author = {S.-\AA. Gustafson}, 30432 title = {On Numerical Analysis in Semi-Infinite Programming}, 30433 booktitle = {Semi-Infinite Programming}, 30434 year = {1979}, 30435 editor = {R. Hettich}, 30436 publisher = {Springer-Verlag}, 30437 address = {Berlin} 30438} 30439 30440@Article{ gustafsson.lind.ea:simultaneous, 30441 author = {A. Gustafsson and B. K. Lind and R. Svensson and A. Brahme}, 30442 title = {Simultaneous optimization of dynamic multileaf collimation and scanning patterns 30443 or compensation filters using a generalized pencil beam algorithm}, 30444 journal = {Medical Physics}, 30445 year = {1995}, 30446 volume = {22}, 30447 number = {7}, 30448 pages = {1141--1156} 30449} 30450 30451@PhDThesis{ ha:decomposition, 30452 author = {C. D. Ha}, 30453 title = {Decomposition Methods for Structured Convex Programming}, 30454 year = {1980}, 30455 school = {Department of Industrial Engineering, University of Wisconsin--Madison} 30456} 30457 30458@TechReport{ haakonsen.mathiesen:toward, 30459 author = {L. Haakonsen and L. Mathiesen}, 30460 title = {Toward a more comprehensive cost measure for {CO2}-reductions}, 30461 institution = {NHH, Bergen}, 30462 year = {1995}, 30463 type = {Discussion Paper}, 30464 number = {3/95} 30465} 30466 30467@Article{ haaland.norman.ea:vemod, 30468 author = {J. Haaland and V. Norman and T. Rutherford and T. Wergeland}, 30469 title = {{VEMOD}: {A} {R}icardo--{H}eckscher--{O}hlin--{J}ones Model of World Trade}, 30470 journal = {Scandinavian Journal of Economics}, 30471 year = {1987} 30472} 30473 30474@Article{ haarhoff.buys:method, 30475 author = {P. C. Haarhoff and J. D. Buys}, 30476 title = {A New Method for the Optimization of a Nonlinear Function Subject to Nonlinear 30477 Constraints}, 30478 journal = {Computer Journal}, 30479 year = {1970}, 30480 volume = {12}, 30481 pages = {178--184} 30482} 30483 30484@Article{ habetler.kostreva:direct, 30485 author = {G. J. Habetler and M. M. Kostreva}, 30486 title = {On a direct algorithm for nonlinear complementarity problems}, 30487 journal = {SIAM Journal on Control and Optimization}, 30488 volume = {16}, 30489 year = {1978}, 30490 pages = {504--511} 30491} 30492 30493@Book{ hadamard:cauchys, 30494 author = {J. Hadamard}, 30495 title = {Cauchy's Problem in Linear Partial Differential Equations}, 30496 year = {1923}, 30497 publisher = {Yale University Press} 30498} 30499 30500@Article{ haddock.mittenthal:simulation, 30501 author = {J. Haddock and J. Mittenthal}, 30502 title = {Simulation optimization using simulated annealing}, 30503 journal = {Comput. Ind. Eng.}, 30504 year = {1992}, 30505 volume = {22}, 30506 pages = {387--395} 30507} 30508 30509@TechReport{ hamala:general, 30510 author = {M. Hamala}, 30511 title = {A General Approach to Interior Point Methods with Linear Parameter for 30512 Mathematical Programming}, 30513 institution = {Royal Institute of Technology}, 30514 year = {1978}, 30515 number = {1978--20}, 30516 type = {Department of Mathematics Paper TRITA--MAT} 30517} 30518 30519@Article{ han.mangasarian:dual, 30520 author = {S.--P. Han and O. L. Mangasarian}, 30521 title = {A Dual Differentiable Exact Penalty Function}, 30522 journal = {Mathematical Programming}, 30523 year = {1983}, 30524 volume = {25}, 30525 pages = {293--301} 30526} 30527 30528@Article{ han.mangasarian:exact, 30529 author = {S.--P. Han and O. L. Mangasarian}, 30530 title = {Exact Penalty Functions in Nonlinear Programming}, 30531 journal = {Mathematical Programming}, 30532 year = {1979}, 30533 volume = {17}, 30534 pages = {251--269} 30535} 30536 30537@Article{ han.pang.ea:globally, 30538 author = {S.--P. Han and J. S. Pang and N. Rangaraj}, 30539 title = {Globally Convergent {N}ewton Methods for Nonsmooth Equations}, 30540 journal = {Mathematics of Operations Research}, 30541 year = {1992}, 30542 volume = {17}, 30543 pages = {586--607} 30544} 30545 30546@Article{ han:decomposition, 30547 author = {S.--P. Han}, 30548 title = {A Decomposition Method and its Application to Convex Programming}, 30549 journal = {Mathematics of Operations Research}, 30550 year = {1989}, 30551 volume = {14}, 30552 pages = {237--248} 30553} 30554 30555@Article{ han:globally, 30556 author = {S.--P. Han}, 30557 title = {A Globally Convergent Method for Nonlinear Programming}, 30558 journal = {Journal of Optimization Theory and Applications}, 30559 year = {1977}, 30560 volume = {22}, 30561 pages = {297--309} 30562} 30563 30564@Article{ han:superlinearly, 30565 author = {S.--P. Han}, 30566 title = {Superlinearly Convergent Variable Metric Algorithms for General Nonlinear 30567 Programming Problems}, 30568 journal = {Mathematical Programming}, 30569 year = {1976}, 30570 volume = {11}, 30571 pages = {263--282} 30572} 30573 30574@Article{ hansen.koopmans:definition, 30575 author = {T. Hansen and T. C. Koopmans}, 30576 title = {On the Definition and Computation of a Capital Stock Invariant Under 30577 Optimization}, 30578 journal = {Journal of Economic Theory}, 30579 year = {1972}, 30580 volume = {5}, 30581 pages = {487--523} 30582} 30583 30584@InCollection{ harker.pang:damped, 30585 author = {P. T. Harker and J. S. Pang}, 30586 title = {A Damped {N}ewton Method for the Linear Complementarity Problem}, 30587 booktitle = {Computational Solution of Nonlinear Systems of Equations}, 30588 publisher = {AMS}, 30589 year = {1990}, 30590 editor = {E. L. Allgower and K. Georg}, 30591 number = {26}, 30592 series = {Lectures on Applied Mathematics}, 30593 address = {Providence, Rhode Island}, 30594 pages = {265--284} 30595} 30596 30597@Article{ harker.pang:existence, 30598 author = {P. T. Harker and J. S. Pang}, 30599 title = {Existence of Optimal Solutions to Mathematical Programs with Equilibrium 30600 Constraints}, 30601 journal = {Operations Research Letters}, 30602 year = {1988}, 30603 volume = {7}, 30604 pages = {61--64} 30605} 30606 30607@Article{ harker.pang:finite-dimensional, 30608 author = {P. T. Harker and J. S. Pang}, 30609 title = {Finite--dimensional variational inequality and nonlinear complementarity 30610 problems: {A} survey of theory, algorithms and applications}, 30611 journal = {Mathematical Programming}, 30612 year = {1990}, 30613 volume = {48}, 30614 pages = {161--220} 30615} 30616 30617@Article{ harker.xiao:newtons, 30618 author = {P. T. Harker and B. Xiao}, 30619 title = {{N}ewton's Method for the Nonlinear Complementarity Problem: {A} 30620 {B}--Differentiable Equation Approach}, 30621 journal = {Mathematical Programming}, 30622 year = {1990}, 30623 volume = {48}, 30624 pages = {339--358} 30625} 30626 30627@Article{ harker:accelerating, 30628 author = {P. T. Harker}, 30629 title = {Accelerating the Convergence of the Diagonalization and Projection Algorithms for 30630 Finite--Dimensional Variational Inequalities}, 30631 journal = {Mathematical Programming}, 30632 year = {1988}, 30633 volume = {41}, 30634 pages = {29--50} 30635} 30636 30637@Article{ harker:generalized, 30638 author = {P. T. Harker}, 30639 title = {Generalized {N}ash Games and Quasi-Variational Inequalities}, 30640 journal = {European Journal of Operations Research}, 30641 volume = {54}, 30642 pages = {81--94}, 30643 year = {1987} 30644} 30645 30646@Book{ harker:lectures, 30647 author = {P. T. Harker}, 30648 title = {Lectures on Computation of Equilibria with Equation--Based Methods}, 30649 publisher = {CORE Foundation, Louvain--la--Neuve, Universit\'{e} Catholique de Louvain}, 30650 year = {1993}, 30651 series = {CORE Lecture Series} 30652} 30653 30654@Article{ harris:pivot, 30655 author = {P. M. J. Harris}, 30656 title = {Pivot Selection Methods of the {D}evex {LP} Code}, 30657 journal = {Mathematical Programming}, 30658 year = {1973}, 30659 volume = {5}, 30660 pages = {1--28} 30661} 30662 30663@InCollection{ harrison.kristrom:carbon, 30664 author = {G. W. Harrison and B. Kristrom}, 30665 title = {Carbon Emissions and the Economic Costs of Transport Policy in {S}weden}, 30666 booktitle = {Environment and Transport in Economic Modelling}, 30667 publisher = {Kluwer Academic Publishers}, 30668 year = {1997}, 30669 editor = {R. Roson and K. A. Small}, 30670 address = {Amsterdam} 30671} 30672 30673@Article{ harrison.rutherford.ea:increased, 30674 author = {G. W. Harrison and T. F. Rutherford and D. G. Tarr}, 30675 title = {Increased Competition and Completion of the Market in the {E}uropean {U}nion}, 30676 journal = {Journal of Economic Integration}, 30677 year = {1996}, 30678 volume = {11}, 30679 pages = {332--365} 30680} 30681 30682@Article{ harrison.rutherford.ea:liberalizing, 30683 author = {G. W. Harrison and T. F. Rutherford and I. Wooton}, 30684 title = {Liberalizing Agriculture in the {E}uropean {U}nion}, 30685 journal = {Journal of Policy Modeling}, 30686 year = {1995}, 30687 volume = {17} 30688} 30689 30690@Article{ harrison.rutherford.ea:quantifying, 30691 author = {G. W. Harrison and T. F. Rutherford and D. Tarr}, 30692 title = {Quantifying the {U}ruguay Round}, 30693 journal = {Finance and Development}, 30694 year = {1995}, 30695 volume = {32}, 30696 pages = {38--41} 30697} 30698 30699@InProceedings{ harrison.rutherford.ea:quantifying*1, 30700 author = {G. W. Harrison and T. F. Rutherford and D. G. Tarr}, 30701 title = {Quantifying the {U}ruguay Round}, 30702 year = {1996}, 30703 booktitle = {The {U}ruguay Round and the Developing Economies}, 30704 address = {New York}, 30705 editors = {W. Martin and L. A. Winters}, 30706 publisher = {Cambridge University Press} 30707} 30708 30709@Article{ harrison.rutherford.ea:quantifying*2, 30710 author = {G. W. Harrison and T. F. Rutherford and D. Tarr}, 30711 title = {Quantifying the {U}ruguay Round}, 30712 journal = {The Economic Journal}, 30713 year = {1997}, 30714 volume = {107}, 30715 pages = {1405--1430} 30716} 30717 30718@Article{ harrison.rutherford.ea:trade, 30719 author = {G. W. Harrison and T. F. Rutherford and D. G. Tarr}, 30720 title = {Trade Reform in the Partially Liberalized Economy of {T}urkey}, 30721 journal = {The World Bank Economic Review}, 30722 year = {1993}, 30723 volume = {7}, 30724 pages = {191--217} 30725} 30726 30727@Article{ hartman.stampacchia:nonlinear, 30728 author = {P. Hartman and G. Stampacchia}, 30729 title = {On some nonlinear differential-functional equations}, 30730 journal = {Acta Mathematica}, 30731 year = {1966}, 30732 volume = {115}, 30733 pages = {271--310} 30734} 30735 30736@Book{ harvey:forecasting, 30737 author = {Andrew C. Harvey}, 30738 title = {Forecasting, Structural Time Series Models and the {K}alman Filter}, 30739 publisher = {Cambridge University Press}, 30740 address = {New York, NY}, 30741 year = {1989} 30742} 30743 30744@Article{ haurie.marcotte:relationship, 30745 author = {A. Haurie and P. Marcotte}, 30746 title = {On the Relationship between {N}ash--{C}ournot and {W}ardrop Equilibria}, 30747 journal = {Networks}, 30748 year = {1985}, 30749 volume = {15}, 30750 pages = {295--308} 30751} 30752 30753@Article{ hearn.lawphongpanich.ea:restricted, 30754 author = {D. W. Hearn and S. Lawphongpanich and J. A. Ventura}, 30755 title = {Restricted Simplicial Decomposition: Computation and Extensions}, 30756 journal = {Mathematical Programming Study}, 30757 year = {1987}, 30758 volume = {31}, 30759 pages = {99--118} 30760} 30761 30762@Article{ hearn:gap, 30763 author = {D. W. Hearn}, 30764 title = {The Gap Function of a Convex Program}, 30765 journal = {Operations Research Letters}, 30766 year = {1982}, 30767 volume = {1}, 30768 pages = {67--71} 30769} 30770 30771@Article{ hedlund.gustavsson:design, 30772 author = {P. Hedlund and A. Gustavsson}, 30773 title = {Design and Evaluation of Modified Simplex Methods having Enhanced Convergence 30774 Ability}, 30775 journal = {Analytica Chimica Acta}, 30776 year = {1992}, 30777 volume = {259}, 30778 pages = {243--256} 30779} 30780 30781@Article{ helgason.kennington.ea:parallelization, 30782 author = {R. V. Helgason and J. L. Kennington and H. A. Zaki}, 30783 title = {A Parallelization of the Simplex Method}, 30784 journal = {Annals of Operations Research}, 30785 year = {1988}, 30786 volume = {14}, 30787 pages = {17--40} 30788} 30789 30790@Article{ helgason.kennington.ea:polynomially, 30791 author = {Richard Helgason and James Kennington and H. Lall}, 30792 title = {A Polynomially Bounded Algorithm for Singly Constrained Quadratic Programs}, 30793 journal = {Mathematical Programming}, 30794 year = {1980}, 30795 volume = {18}, 30796 pages = {338--343} 30797} 30798 30799@Book{ henderson.quandt:microeconomic, 30800 author = {J. M. Henderson and R. E. Quandt}, 30801 title = {Microeconomic Theory}, 30802 publisher = {McGraw--Hill}, 30803 address = {New York}, 30804 year = {1980}, 30805 edition = {Third} 30806} 30807 30808@TechReport{ hendrickson.leland:chaco, 30809 author = {B. Hendrickson and R. Leland}, 30810 title = {The {C}haco User's Guide: Version 2}, 30811 institution = {Sandia National Laboratories}, 30812 type = {Technical Report}, 30813 number = {SAND94-2692}, 30814 address = {Albuquerque, New Mexico}, 30815 year = {1994} 30816} 30817 30818@InProceedings{ hendrickson.leland:multilevel, 30819 author = {B. Hendrickson and R. Leland}, 30820 title = {A Multilevel Algorithm for Partitioning Graphs}, 30821 booktitle = {Proceedings of Supercomputing '95}, 30822 year = {1995} 30823} 30824 30825@Book{ hertz.krogh.ea:introduction, 30826 author = {J. Hertz and A. Krogh and R. G. Palmer}, 30827 title = {Introduction to the Theory of Neural Computation}, 30828 year = {1991}, 30829 publisher = {Addison-Wesley}, 30830 address = {Redwood City, California} 30831} 30832 30833@Article{ hertz.werra:tabu, 30834 author = {A. Hertz and D. de Werra}, 30835 title = {Using {T}abu Search techniques for Graph Coloring}, 30836 journal = {Computing}, 30837 year = {1987}, 30838 volume = {29}, 30839 pages = {345--351} 30840} 30841 30842@InCollection{ hettich:review, 30843 author = {R. Hettich}, 30844 title = {A Review of Numerical Methods for Semi-Infinite Optimization}, 30845 booktitle = {Semi-Infinite Programming and Applications}, 30846 year = {1983}, 30847 editor = {A. V. Fiacco and K. O. Kortanek}, 30848 publisher = {Springer-Verlag}, 30849 address = {Berlin} 30850} 30851 30852@Article{ highleyman:note, 30853 author = {W. H. Highleyman}, 30854 title = {A Note on Linear Separation}, 30855 journal = {IRE Transactions on Electronic Computers}, 30856 year = {1961}, 30857 volume = {10}, 30858 pages = {777--778} 30859} 30860 30861@Article{ hildreth:quadratic, 30862 author = {C. Hildreth}, 30863 title = {A Quadratic Programming Procedure}, 30864 journal = {Naval Research Logistics Quarterly}, 30865 year = {1957}, 30866 volume = {4}, 30867 pages = {79--85}, 30868 note = {Erratum, p. 361} 30869} 30870 30871@Book{ himmelblau:applied, 30872 author = {D. M. Himmelblau}, 30873 title = {Applied Nonlinear Programming}, 30874 year = {1972}, 30875 publisher = {McGraw--Hill}, 30876 address = {New York} 30877} 30878 30879@Book{ hiriart-urruty.lemarechal:convex, 30880 author = {Jean-Baptiste Hiriart-Urruty and Claude Lemar\'{e}chal}, 30881 title = {Convex Analysis and Minimization Algorithms {I}}, 30882 year = {1993}, 30883 publisher = {Springer Verlag}, 30884 address = {Berlin}, 30885 volume = {305}, 30886 series = {Grundlehren der mathematischen Wissenschaften} 30887} 30888 30889@TechReport{ hironaka:introduction, 30890 author = {H. Hironaka}, 30891 title = {Introduction to real-analytic sets and real-analytic maps}, 30892 institution = {Instituto Matematico ``L. Tonelli'', Universit\`a di Pisa}, 30893 year = {1973}, 30894 type = {Technical Report}, 30895 address = {Pisa, Italy} 30896} 30897 30898@Article{ ho.lee.ea:decomposition, 30899 author = {J. K. Ho and T. C. Lee and R. P. Sundarraj}, 30900 title = {Decomposition of Linear Programs Using Parallel Computation}, 30901 journal = {Mathematical Programming}, 30902 year = {1988}, 30903 volume = {42}, 30904 pages = {391--405} 30905} 30906 30907@Article{ ho.loute:computational, 30908 author = {J. K. Ho and E. Loute}, 30909 title = {Computational Experience with Advanced Implementation of Decomposition Algorithms 30910 for Linear Programming}, 30911 journal = {Mathematical Programming}, 30912 year = {1983}, 30913 volume = {27}, 30914 pages = {283--290} 30915} 30916 30917@Book{ hock.schittkowski:test, 30918 author = {W. Hock and K. Schittkowski}, 30919 title = {Test Examples for Nonlinear Programming Codes}, 30920 volume = {187}, 30921 series = {Lecture Notes in Economics and Mathematical Systems}, 30922 year = {1981}, 30923 publisher = {Springer Verlag}, 30924 address = {Berlin, Germany} 30925} 30926 30927@Book{ hockney.jesshope:parallel, 30928 author = {R. W. Hockney and C. R. Jesshope}, 30929 title = {Parallel Computers 2}, 30930 publisher = {Adam Hilger}, 30931 year = {1988}, 30932 address = {Bristol} 30933} 30934 30935@Article{ hoffman:approximate, 30936 author = {A. J. Hoffman}, 30937 title = {On Approximate Solutions of Systems of Linear Inequalities}, 30938 journal = {Journal of Research of the National Bureau of Standards}, 30939 year = {1952}, 30940 volume = {49}, 30941 pages = {263--265} 30942} 30943 30944@Article{ hogan:comments, 30945 author = {W. W. Hogan}, 30946 title = {Comments on Manne and Richels: `{CO2} Emission Limits: An Economic Cost Analysis 30947 for the {USA}}, 30948 journal = {The Energy Journal}, 30949 year = {1990}, 30950 volume = {11}, 30951 pages = {75--84} 30952} 30953 30954@Article{ hogan:energy, 30955 author = {W. W. Hogan}, 30956 title = {Energy Policy Models for {P}roject {I}ndependence}, 30957 journal = {Computers \& Operations Research}, 30958 year = {1975}, 30959 volume = {2}, 30960 pages = {251--271} 30961} 30962 30963@Book{ holland:adaptation, 30964 author = {J. Holland}, 30965 title = {Adaptation in Natural and Artificial Systems}, 30966 year = {1975}, 30967 publisher = {The University of Michigan Press}, 30968 address = {Ann Arbor, Michigan} 30969} 30970 30971@Article{ holmes.mackie:comparison, 30972 author = {T. Holmes and T. R. Mackie}, 30973 title = {A comparison of three inverse treatment planning algorithms}, 30974 journal = {Physics in Medicine and Biology}, 30975 year = {1994}, 30976 volume = {39}, 30977 number = {1}, 30978 pages = {91--106} 30979} 30980 30981@Article{ holmes.mackie:filtered, 30982 author = {T. Holmes and T. R. Mackie}, 30983 title = {A filtered backprojection dose calculation method for inverse treatment 30984 planning}, 30985 journal = {Medical Physics}, 30986 year = {1994}, 30987 volume = {21}, 30988 number = {2}, 30989 pages = {303--313} 30990} 30991 30992@Article{ hooke.jeeves:direct, 30993 author = {R. Hooke and T. A. Jeeves}, 30994 title = {Direct Search Solution of Numerical and Statistical Problems}, 30995 journal = {Journal of Associated Computing Machinery}, 30996 year = {1961}, 30997 volume = {8}, 30998 pages = {212--229} 30999} 31000 31001@Article{ hoppe.mittelmann:multi-grid, 31002 author = {R. H. W. Hoppe and H. D. Mittelmann}, 31003 title = {A Multi-grid Continuation Strategy for Parameter-dependent Variational 31004 Inequalities}, 31005 journal = {Journal of Computational and Applied Mathematics}, 31006 year = {1989}, 31007 volume = {26}, 31008 pages = {35--46} 31009} 31010 31011@Book{ horn.johnson:matrix, 31012 author = {R. A. Horn and C. R. Johnson}, 31013 title = {Matrix Anaysis}, 31014 publisher = {Cambridge University Press}, 31015 year = {1985}, 31016 address = {Cambridge, England} 31017} 31018 31019@Article{ hornik.stinchcombe.ea:multilayer, 31020 author = {K. Hornik and M. Stinchcombe and H. White}, 31021 title = {Multilayer Feedforward Networks are Universal Approximators}, 31022 journal = {Neural Networks}, 31023 year = {1989}, 31024 volume = {2}, 31025 pages = {359--366} 31026} 31027 31028@Article{ horowitz.sahni:computing, 31029 author = {E. Horowitz and S. Sahni}, 31030 title = {Computing Partitions with Applications to the Knapsack Problem}, 31031 journal = {jacm}, 31032 year = {1974}, 31033 volume = {21}, 31034 pages = {277--292} 31035} 31036 31037@Article{ hristov.fallone:continuous, 31038 author = {D. H. Hristov and B. G. Fallone}, 31039 title = {A continuous penalty function method for inverse treatment planning}, 31040 journal = {Medical Physics}, 31041 year = {1998}, 31042 volume = {25}, 31043 number = {2}, 31044 pages = {208--223} 31045} 31046 31047@Article{ hu.cheng.ea:numerical, 31048 author = {Y. Hu and H. S. Cheng and T. Arai and Y. Kobayashi and S. Aoyama}, 31049 title = {Numerical simulation of piston ring in mixed lubrication---a nonaxisymmetrical 31050 analysis}, 31051 journal = {Transactions of the {ASME}}, 31052 volume = {116}, 31053 year = {1994}, 31054 pages = {470--478} 31055} 31056 31057@InProceedings{ hua.sheu:skyscraper, 31058 author = {K. A. Hua and S. Sheu}, 31059 title = {Skyscraper Broadcasting: {A} New Broadcasting System for Metropolitan 31060 Video-On-Demand Systems}, 31061 year = {1997}, 31062 booktitle = {Proceedings of the {ACM SIGCOMM'97} Conference}, 31063 address = {Cannes, France}, 31064 pages = {89--100} 31065} 31066 31067@Article{ huang.pang:option, 31068 author = {J. Huang and J. S. Pang}, 31069 title = {Option Pricing and Linear Complementarity}, 31070 journal = {Journal of Computational Finance}, 31071 volume = {2}, 31072 year = {1998}, 31073 pages = {31--60} 31074} 31075 31076@InCollection{ huard:resolution, 31077 author = {P. Huard}, 31078 title = {Resolution of Mathematical Programming with Nonlinear Constraints by the Method 31079 of Centers}, 31080 booktitle = {Nonlinear Programming}, 31081 year = {1967}, 31082 editor = {J. Abadie}, 31083 publisher = {North--Holland}, 31084 address = {Amsterdam}, 31085 pages = {207--219} 31086} 31087 31088@Book{ huber:robust, 31089 author = {P. J. Huber}, 31090 title = {Robust Statistics}, 31091 year = {1981}, 31092 publisher = {John Wiley}, 31093 address = {New York} 31094} 31095 31096@Book{ hudson:piecewise, 31097 author = {J. F. P. Hudson}, 31098 title = {Piecewise Linear Topology}, 31099 publisher = {Benjamin}, 31100 address = {New York}, 31101 year = {1969} 31102} 31103 31104@InCollection{ hunter.markusen.ea:north, 31105 author = {L. Hunter and J. R. Markusen and T. F. Rutherford}, 31106 title = {{N}orth {A}merican free trade and the production of finished automobiles}, 31107 booktitle = {Modeling North American Economic Integration}, 31108 publisher = {Kluwer Academic Publishers}, 31109 year = {1995}, 31110 editor = {T. Kehoe and P. Kehoe}, 31111 pages = {117--130} 31112} 31113 31114@Article{ ibarra.kim:fast, 31115 author = {O. H. Ibarra and C. E. Kim}, 31116 title = {Fast Approximation Algorithms for the Knapsack and Sum of Subset Problems}, 31117 journal = {jacm}, 31118 year = {1975}, 31119 volume = {22}, 31120 pages = {463--468} 31121} 31122 31123@Article{ ijiri:fundamental, 31124 author = {Y. Ijiri}, 31125 title = {Fundamental Queries in Aggregation Theory}, 31126 journal = {Journal of the American Statistical Association}, 31127 year = {1971}, 31128 volume = {66}, 31129 pages = {766--782} 31130} 31131 31132@Article{ ingargiola.korsh:reduction, 31133 author = {G. P. Ingargiola and J. F. Korsh}, 31134 title = {A Reduction Algorithm for the Zero--One Single Knapsack Problem}, 31135 journal = {Management Science}, 31136 year = {1973}, 31137 volume = {20}, 31138 pages = {460--463} 31139} 31140 31141@Article{ ioffe:variational, 31142 author = {A. D. Ioffe}, 31143 title = {Variational Analysis of a Composite Function: {A} Formula for the Lower 31144 Second--Order Directional Derivative}, 31145 journal = {Journal of Mathematical Analysis and its Applications}, 31146 year = {1993} 31147} 31148 31149@Article{ iri.imai:multiplicative, 31150 author = {M. Iri and H. Imai}, 31151 title = {A Multiplicative Barrier Function Method for Linear Programming}, 31152 journal = {Algorithmica}, 31153 year = {1986}, 31154 volume = {1}, 31155 pages = {455--482} 31156} 31157 31158@Article{ isac.goeleven:implicit, 31159 author = {G. Isac and D. Goeleven}, 31160 title = {The Implicit General Order Complementarity Problem, Models and Iterative 31161 Methods}, 31162 journal = {Annals of Operations Research}, 31163 year = {1993} 31164} 31165 31166@Article{ isac.kostreva:generalized, 31167 author = {G. Isac and M. M. Kostreva}, 31168 title = {The Generalized Order Complementarity Problem}, 31169 journal = {Journal of Optimization Theory and Applications}, 31170 volume = {19}, 31171 pages = {227--232}, 31172 year = {1991} 31173} 31174 31175@Book{ isac:complementarity, 31176 author = {G. Isac}, 31177 title = {Complementarity Problems}, 31178 publisher = {Springer-Verlag}, 31179 year = {1992}, 31180 series = {Lecture Notes in Mathematics}, 31181 address = {New York} 31182} 31183 31184@Article{ iusem.svaiter:variant, 31185 author = {A. N. Iusem and B. F. Svaiter}, 31186 title = {A Variant of {K}orpelevich's Method for Variational Inequalities with a New 31187 Search Strategy}, 31188 journal = {Optimization}, 31189 year = {1997}, 31190 volume = {42}, 31191 pages = {309--321} 31192} 31193 31194@Article{ iusem:convergence, 31195 author = {A. N. Iusem}, 31196 title = {On the Convergence of Iterative Methods for Symmetric Linear Complementarity 31197 Problems}, 31198 journal = {Mathematical Programming}, 31199 year = {1993}, 31200 volume = {59}, 31201 pages = {33--48} 31202} 31203 31204@Article{ jackson.kutcher.ea:probability, 31205 author = {A. Jackson and G. J. Kutcher and E. D. Yorke}, 31206 title = {Probability of Radiation-Induced Complications for Normal Tissues with Parallel 31207 Architecture subject to Non-Uniform Irradiation}, 31208 journal = {Medical Physics}, 31209 year = {1993}, 31210 volume = {20}, 31211 pages = {613--625} 31212} 31213 31214@Article{ jackson:optimization, 31215 author = {A. Jackson and X. H. Wang and R. Mohan}, 31216 title = {Optimization of Conformal Treatment Planning and Quadratic Dose Objectives 31217 (abstract)}, 31218 journal = {Medical Physics}, 31219 year = {1994}, 31220 volume = {21}, 31221 pages = {1006} 31222} 31223 31224@TechReport{ jackson:scheduling, 31225 author = {J. R. Jackson}, 31226 title = {Scheduling a Production Line to Minimize Maximum Tardiness}, 31227 institution = {University of California}, 31228 year = {1955}, 31229 address = {Los Angeles}, 31230 number = {43}, 31231 type = {Research Report} 31232} 31233 31234@Article{ jansen.roos.ea:polynomiality, 31235 author = {B. Jansen and C. Roos and T. Terlaky and A. Yoshise}, 31236 title = {Polynomiality of Primal-Dual Affine Scaling Algorithms for Nonlinear 31237 Complementarity Problems}, 31238 journal = {Mathematical Programming}, 31239 volume = {78}, 31240 pages = {315--346}, 31241 year = {1997} 31242} 31243 31244@Article{ jiang.fukushima.ea:trust, 31245 author = {H. Jiang and M. Fukushima and L. Qi and D. Sun}, 31246 title = {A Trust Region Method for Solving Generalized Complementarity Problems}, 31247 journal = {SIAM Journal on Optimization}, 31248 volume = {8}, 31249 pages = {140--157}, 31250 year = {1998} 31251} 31252 31253@Article{ jiang.qi:nonsmooth, 31254 author = {H. Jiang and L. Qi}, 31255 title = {A New Nonsmooth Equations Approach to Nonlinear Complementarity Problems}, 31256 journal = {SIAM Journal on Control and Optimization}, 31257 volume = {35}, 31258 pages = {178--193}, 31259 year = {1997} 31260} 31261 31262@TechReport{ jiang.ralph:qpecgen, 31263 author = {H. Jiang and D. Ralph}, 31264 title = {{QPECgen}, a {MATLAB} Generator for Mathematical Programs with Quadratic 31265 Objectives and Affine Variational Inequality Constraints}, 31266 year = {1997}, 31267 institution = {Department of Mathematics and Statistics, The University of Melbourne}, 31268 address = {Australia} 31269} 31270 31271@TechReport{ jiang.ralph:smooth, 31272 author = {H. Jiang and D. Ralph}, 31273 title = {Smooth {SQP} methods for Mathematical Programs with Nonlinear Complementarity 31274 Constraints}, 31275 year = {1997}, 31276 institution = {Department of Mathematics and Statistics, The University of Melbourne}, 31277 address = {Australia} 31278} 31279 31280@Article{ jiang:unconstrained, 31281 author = {H. Jiang}, 31282 title = {Unconstrained Minimization Approaches to Nonlinear Complementarity Problems}, 31283 journal = {Journal of Global Optimization, forthcoming}, 31284 year = {1997} 31285} 31286 31287@Article{ jittorntrum.osborne:strong, 31288 author = {K. Jittorntrum and M. R. Osborne}, 31289 title = {Strong uniqueness and second order convergence in nonlinear discrete 31290 approximation}, 31291 journal = {Numerische Mathematik}, 31292 year = {1980}, 31293 volume = {34}, 31294 pages = {439--455} 31295} 31296 31297@InProceedings{ jog.suh.ea:effects, 31298 crossref = {schaeffer:third}, 31299 author = {P. Jog and J. Y. Suh and D. Van Gucht}, 31300 title = {The Effects of Population Size, Heuristic Crossover and Local Improvement on a 31301 Genetic Algorithm for the Travelling Salesman Problem}, 31302 pages = {110--115} 31303} 31304 31305@Article{ jog.suh.ea:parallel, 31306 author = {P. Jog and J. Y. Suh and D. Van Gucht}, 31307 title = {Parallel Genetic Algorithms Applied to the Travelling Salesman Problem}, 31308 journal = {SIAM Journal on Optimization}, 31309 year = {1991}, 31310 volume = {1} 31311} 31312 31313@Article{ johansson.klarbring:rigid, 31314 author = {L. Johansson and A. Klarbring}, 31315 title = {The Rigid Punch Problem with Friction using Variational Inequalities and Linear 31316 Complementarity}, 31317 journal = {Mechanics of Structures \& Machines}, 31318 volume = {20}, 31319 pages = {293--319}, 31320 year = {1992} 31321} 31322 31323@Article{ johnson.aragon.ea:optimization, 31324 author = {D. S. Johnson and C. R. Aragon and L. A. McGeoch and C. Schevon}, 31325 title = {Optimization by Simulated Annealing: An Experimental Evaluation; Part {I}, Graph 31326 Partitioning}, 31327 journal = {Operations Research}, 31328 year = {1989}, 31329 volume = {37}, 31330 pages = {865--892} 31331} 31332 31333@Article{ johnson:optimally, 31334 author = {R. Johnson}, 31335 title = {Optimally Balancing Large Assembly Lines with {FABLE}}, 31336 journal = {Management Science}, 31337 year = {1988}, 31338 volume = {34}, 31339 pages = {240--253} 31340} 31341 31342@Article{ johnsson:solving, 31343 author = {S. L. Johnsson}, 31344 title = {Solving Tridiagonal Systems on Ensemble Architectures}, 31345 journal = {SIAM Journal on Scientific and Statistical Computing}, 31346 year = {1987}, 31347 volume = {8}, 31348 pages = {475--489} 31349} 31350 31351@Article{ jorgenson.wilcoxen:reducing, 31352 author = {D. W. Jorgenson and P. J. Wilcoxen}, 31353 title = {Reducing {US} Carbon Emissions: An Econometric General Equilibrium Assessment}, 31354 journal = {Resource and Energy Economics}, 31355 year = {1993}, 31356 volume = {15}, 31357 pages = {7--25} 31358} 31359 31360@TechReport{ josephy:hogans, 31361 author = {N. H. Josephy}, 31362 title = {Hogan's {PIES} Example and {L}emke's Algorithm}, 31363 institution = {Mathematics Research Center, University of Wisconsin--Madison}, 31364 year = {1979}, 31365 address = {Madison, Wisconsin}, 31366 number = {1972}, 31367 type = {Technical Summary Report} 31368} 31369 31370@TechReport{ josephy:newton, 31371 author = {N. H. Josephy}, 31372 title = {A {N}ewton Method for the {PIES} Energy Model}, 31373 institution = {Mathematics Research Center, University of Wisconsin--Madison}, 31374 year = {1979}, 31375 address = {Madison, Wisconsin}, 31376 number = {1971}, 31377 type = {Technical Summary Report} 31378} 31379 31380@PhDThesis{ josephy:newtons, 31381 author = {N. H. Josephy}, 31382 title = {{N}ewton's Method for Generalized Equations and the {PIES} Energy Model}, 31383 year = {1979}, 31384 school = {Department of Industrial Engineering, University of Wisconsin--Madison} 31385} 31386 31387@TechReport{ josephy:newtons*1, 31388 author = {N. H. Josephy}, 31389 title = {{N}ewton's Method for Generalized Equations}, 31390 institution = {Mathematics Research Center, University of Wisconsin}, 31391 year = {1979}, 31392 address = {Madison, Wisconsin}, 31393 number = {1965}, 31394 type = {Technical Summary Report} 31395} 31396 31397@TechReport{ josephy:quasi-newton, 31398 author = {N. H. Josephy}, 31399 title = {Quasi--{N}ewton Methods for Generalized Equations}, 31400 institution = {Mathematics Research Center, University of Wisconsin}, 31401 year = {1979}, 31402 address = {Madison, Wisconsin}, 31403 number = {1966}, 31404 type = {Technical Summary Report} 31405} 31406 31407@PhDThesis{ kabbadj:methodes, 31408 author = {S. Kabbadj}, 31409 title = {Methodes Proximales Entropiques}, 31410 school = {Universit\'{e} de Montpellier II -- Sciences et Techniques du Languedoc}, 31411 year = {1994}, 31412 type = {Doctoral Thesis} 31413} 31414 31415@Book{ kall.wallace:stochastic, 31416 author = {P. Kall and S. W. Wallace}, 31417 title = {Stochastic Programming}, 31418 publisher = {John Wiley \& Sons}, 31419 year = {1994}, 31420 address = {Chichester} 31421} 31422 31423@Article{ kallman.agren.ea:tumor, 31424 author = {P. Kallman and A. Agren and A. Brahme}, 31425 title = {Tumor and Normal Tissue Responses to Fractionated Non-Uniform Dose Delivery}, 31426 journal = {International Journal of Radiation Biology}, 31427 year = {1992}, 31428 volume = {62}, 31429 pages = {249--262} 31430} 31431 31432@Misc{ kalvelagen:gams, 31433 author = {Erwin Kalvelagen}, 31434 title = {The {GAMS} {I/O} Library}, 31435 howpublished = {mimeo, GAMS Development Corporation}, 31436 year = {1992}, 31437 note = {Preliminary Version} 31438} 31439 31440@Article{ kaneko:complete, 31441 author = {I. Kaneko}, 31442 title = {Complete solution of a class of elastic-plastic structures}, 31443 journal = {Computer Methods in Applied Mechanics and Engineering}, 31444 volume = {21}, 31445 year = {1980}, 31446 pages = {193--209} 31447} 31448 31449@Article{ kaneko:mathematical, 31450 author = {I. Kaneko}, 31451 title = {A mathematical programming method for the inelastic analysis of reinforced 31452 concrete frames}, 31453 journal = {International Journal for Numerical Methods in Engineering}, 31454 volume = {11}, 31455 year = {1977}, 31456 pages = {1137--1154} 31457} 31458 31459@Article{ kaneko:piecewise, 31460 author = {I. Kaneko}, 31461 title = {Piecewise linear elastic-plastic analysis}, 31462 journal = {International Journal for Numerical Methods in Engineering}, 31463 volume = {14}, 31464 year = {1979}, 31465 pages = {757--767} 31466} 31467 31468@Article{ kanet:minimizing, 31469 author = {J. J. Kanet}, 31470 title = {Minimizing the Average Deviation of Job Completion Times about a Common Due 31471 Date}, 31472 journal = {Naval Research Logistics Quarterly}, 31473 year = {1981}, 31474 volume = {28}, 31475 pages = {643--651} 31476} 31477 31478@Article{ kantorovich:mathematical, 31479 author = {L. V. Kantorovich}, 31480 title = {Mathematical Methods in the Organization and Planning of Production}, 31481 journal = {Management Science}, 31482 year = {1960}, 31483 volume = {6}, 31484 pages = {366--422}, 31485 note = {English translation, Russian version 1939} 31486} 31487 31488@Article{ kanzow.fukushima:equivalence, 31489 author = {C. Kanzow and M. Fukushima}, 31490 title = {Equivalence of the Generalized Complementarity Problem to Differentiable 31491 Unconstrained Minimization}, 31492 journal = {Journal of Optimization Theory and Applications}, 31493 year = {1996}, 31494 volume = {90}, 31495 pages = {581--603} 31496} 31497 31498@Article{ kanzow.fukushima:theoretical, 31499 author = {C. Kanzow and M. Fukushima}, 31500 title = {Theoretical and Numerical Investigation of the {D}-gap function for 31501 Box-Constrained Variational Inequalities}, 31502 journal = {Mathematical Programming}, 31503 year = {1998}, 31504 volume = {83}, 31505 pages = {55--88} 31506} 31507 31508@Article{ kanzow.jiang:continuation, 31509 author = {C. Kanzow and H. Jiang}, 31510 title = {A Continuation Method for (Strongly) Monotone Variational Inequalities}, 31511 journal = {Mathematical Programming}, 31512 year = {1998}, 31513 volume = {81}, 31514 pages = {103--125} 31515} 31516 31517@Article{ kanzow.kleinmichel:class, 31518 author = {C. Kanzow and H. Kleinmichel}, 31519 title = {A Class of {N}ewton-Type Methods for Equality and Inequality Constrained 31520 Optimization}, 31521 journal = {Optimization Methods and Software}, 31522 year = {1995}, 31523 volume = {5}, 31524 pages = {173--198} 31525} 31526 31527@Article{ kanzow.kleinmichel:new, 31528 author = {C. Kanzow and H. Kleinmichel}, 31529 title = {A New Class of Semismooth {N}ewton-Type Methods for Nonlinear Complementarity 31530 Problems}, 31531 journal = {Computational Optimization and Applications}, 31532 volume = {11}, 31533 pages = {227--251}, 31534 year = {1998} 31535} 31536 31537@Article{ kanzow.pieper:jacobian, 31538 author = {C. Kanzow and H. Pieper}, 31539 title = {Jacobian Smoothing Methods for Nonlinear Complementarity Problems}, 31540 journal = {SIAM Journal on Optimization}, 31541 year = {1999}, 31542 volume = {9}, 31543 pages = {342--373} 31544} 31545 31546@Article{ kanzow.qi:qp-free, 31547 author = {C. Kanzow and H. -D. Qi}, 31548 title = {A {QP}-free constrained {N}ewton-type method for variational inequality 31549 problems}, 31550 journal = {Mathematical Programming}, 31551 year = {1999}, 31552 volume = {85}, 31553 pages = {81--106} 31554} 31555 31556@Article{ kanzow.yamashita.ea:ncp-functions, 31557 author = {C. Kanzow and N. Yamashita and M. Fukushima}, 31558 title = {New {NCP}-functions and their properties}, 31559 journal = {Journal of Optimization Theory and Applications}, 31560 year = {1997}, 31561 volume = {94}, 31562 pages = {115--135} 31563} 31564 31565@TechReport{ kanzow.zupke:inexact, 31566 author = {C. Kanzow and M. Zupke}, 31567 title = {Inexact Trust-Region Methods for Nonlinear Complementarity Problems}, 31568 year = {1997}, 31569 institution = {Institute of Applied Mathematics, University of Hamburg}, 31570 type = {Preprint}, 31571 number = {127}, 31572 address = {Hamburg, Germany} 31573} 31574 31575@Article{ kanzow:approach, 31576 author = {C. Kanzow}, 31577 title = {A New Approach to Continuation Methods for Complementarity Problems with Uniform 31578 {P}-Functions}, 31579 journal = {Operations Research Letters}, 31580 volume = {20}, 31581 year = {1997}, 31582 pages = {85--92} 31583} 31584 31585@Article{ kanzow:equation-based, 31586 author = {C. Kanzow}, 31587 title = {Some Equation--Based Methods for the Nonlinear Complementarity Problem}, 31588 journal = {Optimization Methods and Software}, 31589 year = {1994}, 31590 volume = {3}, 31591 pages = {327--340} 31592} 31593 31594@Article{ kanzow:global, 31595 author = {C. Kanzow}, 31596 title = {Global Convergence Properties of Some Iterative Methods for Linear 31597 Complementarity Problems}, 31598 journal = {SIAM Journal on Optimization}, 31599 year = {1996}, 31600 volume = {6}, 31601 pages = {326--341} 31602} 31603 31604@Article{ kanzow:inexact, 31605 author = {C. Kanzow}, 31606 title = {An Inexact {QP}--based method for nonlinear complementarity problems}, 31607 journal = {Numerische Mathematik, forthcoming}, 31608 year = {1999} 31609} 31610 31611@Article{ kanzow:noninterior, 31612 author = {C. Kanzow}, 31613 title = {Some Noninterior Continuation Methods for Linear Complementarity Problems}, 31614 journal = {SIAM Journal on Matrix Analysis and Applications}, 31615 volume = {17}, 31616 pages = {851--868}, 31617 year = {1996} 31618} 31619 31620@Article{ kanzow:nonlinear, 31621 author = {C. Kanzow}, 31622 title = {Nonlinear Complementarity as Unconstrained Optimization}, 31623 journal = {Journal of Optimization Theory and Applications}, 31624 year = {1996}, 31625 volume = {88}, 31626 pages = {139--155} 31627} 31628 31629@TechReport{ kanzow:semismooth, 31630 author = {C. Kanzow}, 31631 title = {Semismooth {N}ewton-Type Methods for the Solution of Nonlinear Complementarity 31632 Problems}, 31633 institution = {Institute of Applied Mathematics, University of Hamburg}, 31634 year = {1997}, 31635 type = {Preprint}, 31636 address = {Hamburg, Germany} 31637} 31638 31639@TechReport{ kanzow:tools, 31640 annote = {This should be replaced by kanzow:noninterior}, 31641 author = {C. Kanzow}, 31642 title = {Some Tools Allowing Interior--Point Methods to Become Noninterior}, 31643 institution = {Institute of Applied Mathematics, University of Hamburg}, 31644 year = {1994}, 31645 address = {Germany} 31646} 31647 31648@Article{ kaplan.meier:nonparametric, 31649 author = {E. L. Kaplan and P. Meier}, 31650 title = {Nonparametric Estimation from Incomplete Observations}, 31651 journal = {J. Am. Stat. Assoc.}, 31652 year = {1958}, 31653 volume = {53}, 31654 pages = {457--481} 31655} 31656 31657@Article{ karamardian:complementarity, 31658 author = {S. Karamardian}, 31659 title = {The Complementarity Problem}, 31660 journal = {Mathematical Programming}, 31661 year = {1972}, 31662 volume = {2}, 31663 pages = {107--129} 31664} 31665 31666@Article{ karamardian:complementarity*1, 31667 author = {S. Karamardian}, 31668 title = {Complementarity Problems over {C}ones with Monotone and Pseudomonotone Maps}, 31669 journal = {Journal of Optimization Theory and Applications}, 31670 year = {1976}, 31671 volume = {18}, 31672 pages = {445--454} 31673} 31674 31675@Article{ karamardian:generalized, 31676 author = {S. Karamardian}, 31677 title = {Generalized Complementarity Problem}, 31678 journal = {Journal of Optimization Theory and Applications}, 31679 year = {1971}, 31680 volume = {8}, 31681 pages = {161--167} 31682} 31683 31684@Article{ karmarkar.karp.ea:probabilistic, 31685 author = {N. Karmarkar and R. M. Karp and G. S. Lueker and A. M. Odlyzko}, 31686 title = {Probabilistic Analysis of Optimum Partitioning}, 31687 journal = {Journal of Applied Probability}, 31688 year = {1986}, 31689 volume = {23}, 31690 pages = {626--645} 31691} 31692 31693@Article{ karmarkar:polynomial, 31694 author = {N. Karmarkar}, 31695 title = {A New Polynomial Time Algorithm for Linear Programming}, 31696 journal = {Combinatorica}, 31697 year = {1984}, 31698 volume = {4}, 31699 pages = {373--395} 31700} 31701 31702@Unpublished{ karp:probabilistic, 31703 author = {R. M. Karp}, 31704 title = {Probabilistic Analysis of Algorithms}, 31705 note = {(Lecture Notes)} 31706} 31707 31708@InCollection{ karp:reducibility, 31709 author = {R. M. Karp}, 31710 title = {Reducibility among Combinatorial Problems}, 31711 booktitle = {Complexity of Computer Computations}, 31712 year = {1972}, 31713 editor = {R. E. Miller and J. W. Thatcher}, 31714 publisher = {Plenum Press}, 31715 address = {New York}, 31716 pages = {85--103} 31717} 31718 31719@MastersThesis{ karush:minima, 31720 author = {W. Karush}, 31721 title = {Minima of Functions of Several Variables with Inequalities as Side Conditions}, 31722 year = {1939}, 31723 school = {Department of Mathematics, University of Chicago} 31724} 31725 31726@TechReport{ karypis.kumar:metis, 31727 author = {G. Karypis and V. Kumar}, 31728 title = {{METIS}: Unstructured Graph Partitioning and Sparse Matrix Ordering System, 31729 Version 2.0}, 31730 institution = {University of Minnesota, Department of Computer Science}, 31731 type = {Technical Report}, 31732 address = {Minnesota}, 31733 year = {1995} 31734} 31735 31736@TechReport{ karypis.kumar:multilevel, 31737 author = {G. Karypis and V. Kumar}, 31738 title = {Multilevel k-way Partitioning Scheme for Irregular Graphs}, 31739 institution = {University of Minnesota, Department of Computer Science}, 31740 type = {Technical Report}, 31741 number = {95-064}, 31742 address = {Minnesota}, 31743 year = {1995} 31744} 31745 31746@Article{ katukani:generalization, 31747 author = {S. Katukani}, 31748 title = {A Generalization of {B}rouwer's Fixed Point Theorem}, 31749 journal = {Duke Mathematical Journal}, 31750 year = {1941}, 31751 volume = {8}, 31752 pages = {457--459} 31753} 31754 31755@Article{ keifer.wolfowitz:stochastic, 31756 author = {J. Keifer and J. Wolfowitz}, 31757 title = {Stochastic Estimation of the Maximum of a Regression Function}, 31758 journal = {Annals of Mathematical Statistics}, 31759 year = {1952}, 31760 volume = {23}, 31761 pages = {462--466} 31762} 31763 31764@InCollection{ kellog.li.ea:method, 31765 author = {R. B. Kellog and T. Y. Li and J. A. Yorke}, 31766 title = {A Method of Continuation for Calculating a {B}rouwer Fixed Point}, 31767 booktitle = {Computing Fixed Points with Applications}, 31768 year = {1977}, 31769 editor = {S. Karamardian}, 31770 publisher = {Academic Press}, 31771 pages = {133--147} 31772} 31773 31774@Book{ kennington.helgason:algorithms, 31775 author = {J. L. Kennington and R. V. Helgason}, 31776 title = {Algorithms for Network Programming}, 31777 year = {1980}, 31778 publisher = {John Wiley \& Sons}, 31779 address = {New York} 31780} 31781 31782@Article{ kernighan.lin:efficient, 31783 author = {B. W. Kernighan and S. Lin}, 31784 title = {An Efficient Heuristic Procedure for Partitioning Graphs}, 31785 journal = {The Bell System Technical Journal}, 31786 pages = {291--307}, 31787 volume = {29}, 31788 year = {1970} 31789} 31790 31791@Article{ khachian:polynomial, 31792 author = {L. G. Khachian}, 31793 title = {A Polynomial Algorithm for Linear Programming}, 31794 journal = {Soviet Mathematics Doklady}, 31795 year = {1979}, 31796 volume = {20}, 31797 pages = {191--194} 31798} 31799 31800@Article{ khobotov:modification, 31801 author = {E. N. Khobotov}, 31802 title = {A Modification of the Extragradient Method for the Solution of Variational 31803 Inequalities and some Optimization Problems}, 31804 journal = {Zhurnal Vychislitel'noi Matematiki i Matematicheskoi Fiziki}, 31805 year = {1987}, 31806 volume = {27}, 31807 pages = {1462--1473} 31808} 31809 31810@Book{ khuri.cornell:response, 31811 author = {A. I. Khuri and J. A. Cornell}, 31812 title = {Response Surfaces: Designs and Analyses}, 31813 publisher = {Marcel Dekker}, 31814 year = {1987}, 31815 address = {New York} 31816} 31817 31818@Article{ kibardin:decomposition, 31819 author = {V. M. Kibardin}, 31820 title = {Decomposition into Functions in the Minimization Problems}, 31821 journal = {Automation and Remote Control}, 31822 year = {1980}, 31823 volume = {40}, 31824 pages = {1311--1323} 31825} 31826 31827@TechReport{ king:sposl, 31828 author = {A. J. King}, 31829 title = {{SP/OSL} Version 1.0 Stochastic Programming Interface Library User's Guide}, 31830 institution = {IBM T.J. Watson Research Center}, 31831 year = {1994}, 31832 number = {RC 19757}, 31833 address = {Yorktown Heights, New York} 31834} 31835 31836@Article{ kirkpatrick.gelatt.ea:optimization, 31837 author = {S. Kirkpatrick and C. D. Gelatt and M. P. {Vecchi Jr.}}, 31838 title = {Optimization by Simulated Annealing}, 31839 journal = {Science}, 31840 year = {1983}, 31841 volume = {220}, 31842 pages = {671--680} 31843} 31844 31845@Book{ kiwiel:methods, 31846 author = {K. C. Kiwiel}, 31847 title = {Methods of Descent for Nondifferentiable Optimization}, 31848 year = {1985}, 31849 publisher = {Springer-Verlag}, 31850 address = {Berlin}, 31851 series = {Lecture Notes in Mathematics}, 31852 number = {1133} 31853} 31854 31855@Article{ kiwiel:twice, 31856 author = {K. C. Kiwiel}, 31857 title = {On the Twice Differentiable Cubic Augmented {L}agrangian}, 31858 journal = {Journal of Optimization Theory and Applications}, 31859 year = {1996}, 31860 volume = {88}, 31861 pages = {233--236} 31862} 31863 31864@Article{ klarbring.bjorkman:mathematical, 31865 author = {A. Klarbring and G. Bj{\"{o}}rkman}, 31866 title = {A mathematical programming approach to contact problems with friction and varying 31867 contact surface}, 31868 journal = {Computers \& Structures}, 31869 volume = {30}, 31870 year = {1988}, 31871 pages = {1185--1198} 31872} 31873 31874@Article{ klarbring.bjorkman:solution, 31875 author = {A. Klarbring and G. Bj{\"{o}}rkman}, 31876 title = {Solution of large displacement contact problems with friction using {N}ewton's 31877 method for generalized equations}, 31878 journal = {International Journal for Numerical Methods in Engineering}, 31879 volume = {34}, 31880 year = {1992}, 31881 pages = {249--269} 31882} 31883 31884@Article{ klarbring.pang:existence, 31885 author = {A. Klarbring and J. S. Pang}, 31886 title = {Existence of solution to discrete semicoercive frictional contact problems}, 31887 journal = {{SIAM} Journal on Optimization, under review}, 31888 year = {1996} 31889} 31890 31891@Article{ klarbring:discrete, 31892 author = {A. Klarbring}, 31893 title = {On Discrete and Discretized Non-linear Elastic Structures in Unilateral Contact 31894 (Stability, Uniqueness and Variational Principles)}, 31895 journal = {International Journal on Solids and Structures}, 31896 volume = {24}, 31897 pages = {459--479}, 31898 year = {1988} 31899} 31900 31901@TechReport{ klarbring:large, 31902 author = {A. Klarbring}, 31903 title = {Large Displacement Frictional Contact: a Continuum Framework for Finite Element 31904 Discretization}, 31905 number = {LiTH-IKP-R-798}, 31906 institution = {Department of Mechanical Engineering, Link{\"o}ping Institute of Technology}, 31907 address = {Link{\"o}ping}, 31908 year = {1994} 31909} 31910 31911@Article{ klarbring:mathematical, 31912 author = {A. Klarbring}, 31913 title = {A mathematical programming approach to three dimensional contact problems with 31914 friction}, 31915 journal = {Computer Methods in Applied Mechanics and Engineering}, 31916 volume = {58}, 31917 year = {1986}, 31918 pages = {175--200} 31919} 31920 31921@InCollection{ klarbring:mathematical*1, 31922 author = {A. Klarbring}, 31923 title = {Mathematical programming and augmented {L}agrangian methods for frictional 31924 contact problems}, 31925 editor = {A. Curnier}, 31926 booktitle = {Proceedings Contact Mechanics International Symposium}, 31927 publisher = {Presse Polytechniques et Universitaires Romandes}, 31928 address = {Lausanne}, 31929 year = {1992}, 31930 pages = {409--422} 31931} 31932 31933@InCollection{ klarbring:mathematical*2, 31934 author = {A. Klarbring}, 31935 title = {Mathematical programming in contact problems}, 31936 editors = {M. H. Aliabadi and C. A. Brebbia}, 31937 booktitle = {Computational Methods for Contact Problems}, 31938 publisher = {Computational Mechanics Publications}, 31939 address = {Southampton}, 31940 year = {1993}, 31941 pages = {233--264} 31942} 31943 31944@Article{ klarbring:quadratic, 31945 author = {A. Klarbring}, 31946 title = {A quadratic program in frictionless contact problems}, 31947 journal = {International Journal of Engineering Science}, 31948 volume = {24}, 31949 pages = {1207--1217}, 31950 year = {1986} 31951} 31952 31953@InCollection{ klee.minty:how, 31954 author = {V. Klee and G. J. Minty}, 31955 title = {How Good is the Simplex Algorithm?}, 31956 booktitle = {Inequalities--III}, 31957 year = {1972}, 31958 publisher = {Academic Press}, 31959 pages = {159--175} 31960} 31961 31962@Article{ kleywegt.shapiro:sample, 31963 author = {A. Kleywegt and A. Shapiro}, 31964 title = {The Sample Average Approximation Method for Stochastic Discrete Optimization}, 31965 journal = {Stochastic Programming E-Print Series}, 31966 year = {1999}, 31967 note = {Available from dochost.rz.hu-berlin.de/speps} 31968} 31969 31970@Book{ knuth:art, 31971 author = {D. E. Knuth}, 31972 title = {The Art of Computer Programming}, 31973 publisher = {Addison-Wesley Longman Inc.}, 31974 address = {Reading, Massachusetts}, 31975 year = {1998}, 31976 edition = {Third}, 31977 volume = {2} 31978} 31979 31980@InProceedings{ kocvara.outrata:nonsmooth, 31981 author = {M. Ko\v{c}vara and J. V. Outrata}, 31982 title = {A nonsmooth approach to optimization problems with equilibrium constraints}, 31983 crossref = {ferris.pang:complementarity}, 31984 pages = {148--164} 31985} 31986 31987@Article{ kocvara.outrata:optimization, 31988 author = {M. Ko\v{c}vara and J. V. Outrata}, 31989 title = {On Optimization of Systems Governed by Implicit Complementarity Problems}, 31990 volume = {15}, 31991 journal = {Numerical Fucntional Analysis and Optimization}, 31992 year = {1994}, 31993 pages = {869--887} 31994} 31995 31996@InCollection{ kocvara.outrata:solution, 31997 author = {M. Ko\v{c}vara and J. V. Outrata}, 31998 title = {On the solution of optimum design problems with variational inequalities}, 31999 editors = {D. Z. Du and L. Qi and R. Womersley}, 32000 booktitle = {Recent Advances in Nonsmooth Optimization}, 32001 publisher = {World Scientific Publishers}, 32002 address = {Singapore}, 32003 year = {1995}, 32004 pages = {172--192} 32005} 32006 32007@Article{ kojima.hirabayashi:homotopy, 32008 author = {M. Kojima and R. Hirabayashi}, 32009 title = {Continuous deformation of nonlinear programs}, 32010 journal = {Mathematical Programming Study}, 32011 editor = {A.~V. Fiacco}, 32012 publisher = {North--Holland}, 32013 address = {Amsterdam}, 32014 year = {1984}, 32015 volume = {21}, 32016 pages = {150--198} 32017} 32018 32019@Article{ kojima.megiddo.ea:homotopy, 32020 author = {M. Kojima and N. Megiddo and T. Noma}, 32021 title = {Homotopy Continuation Methods for Nonlinear Complementarity Problems}, 32022 journal = {Mathematics of Operations Research}, 32023 year = {1991}, 32024 volume = {16}, 32025 pages = {754--774} 32026} 32027 32028@TechReport{ kojima.megiddo.ea:primal-dual, 32029 author = {M. Kojima and N. Megiddo and S. Mizuno}, 32030 title = {A primal-dual exterior point algorithm for linear programming}, 32031 institution = {IBM Alamaden Research Center}, 32032 year = {1991}, 32033 number = {RJ 8500}, 32034 address = {San Jose, California} 32035} 32036 32037@Book{ kojima.megiddo.ea:unified, 32038 author = {M. Kojima and N. Megiddo and T. Noma and A. Yoshise}, 32039 title = {A Unified Approach to Interior Point Algorithms for Linear Complementarity 32040 Problems}, 32041 year = {1991}, 32042 publisher = {Springer-Verlag}, 32043 address = {Berlin}, 32044 volume = {538}, 32045 series = {Lecture Notes in Computer Science} 32046} 32047 32048@Article{ kojima.mizuno.ea:continuation, 32049 author = {M. Kojima and S. Mizuno and T. Noma}, 32050 title = {A New Continuation Method for Complementarity Problems with Uniform 32051 {P}-function}, 32052 journal = {Mathematical Programming}, 32053 year = {1989}, 32054 volume = {43}, 32055 pages = {107--113} 32056} 32057 32058@TechReport{ kojima.mizuno.ea:infeasible, 32059 author = {M. Kojima and S. Mizuno and M. Todd}, 32060 title = {Infeasible interior-point primal-dual potential-reduction algorithms for linear 32061 programming}, 32062 institution = {School of Operations Research and Industrial Engineering, Cornell University}, 32063 year = {1992}, 32064 number = {1023}, 32065 address = {Ithaca, New York}, 32066 month = aug 32067} 32068 32069@Article{ kojima.mizuno.ea:onl, 32070 author = {M. Kojima and S. Mizuno and A. Yoshise}, 32071 title = {An ${O}(\sqrt{n}{L})$ iteration potential reduction algorithm for linear 32072 complementarity problems}, 32073 journal = {Mathematical Programming}, 32074 year = {1991}, 32075 volume = {50}, 32076 pages = {331--342} 32077} 32078 32079@Article{ kojima.mizuno.ea:polynomial-time, 32080 author = {M. Kojima and S. Mizuno and A. Yoshise}, 32081 title = {A Polynomial-Time Algorithm for a Class of Linear Complementarity Problems}, 32082 journal = {Mathematical Programming}, 32083 year = {1989}, 32084 volume = {44}, 32085 pages = {1--20} 32086} 32087 32088@Article{ kojima.noma.ea:global, 32089 author = {M. Kojima and T. Noma and A. Yoshise}, 32090 title = {Global Convergence in Infeasible Interior--Point Algorithms}, 32091 journal = {Mathematical Programming}, 32092 volume = {65}, 32093 pages = {43--72}, 32094 year = {1994} 32095} 32096 32097@Article{ kojima.shindo.ea:interior-point, 32098 author = {M. Kojima and S. Shindo and S. Hara}, 32099 title = {Interior--Point Methods for the Monotone Semidefinite Linear Complementarity 32100 Problem in Symmetric Matrices}, 32101 journal = {SIAM Journal on Optimization}, 32102 volume = {7}, 32103 pages = {86--125} 32104} 32105 32106@Article{ kojima.shindo:extensions, 32107 author = {M. Kojima and S. Shindo}, 32108 title = {Extensions of {N}ewton and Quasi-{N}ewton Methods to Systems of {PC}$^1$ 32109 Equations}, 32110 journal = {Journal of Operations Research Society of Japan}, 32111 year = {1986}, 32112 volume = {29}, 32113 pages = {352--374} 32114} 32115 32116@Article{ kojima:computational, 32117 author = {M. Kojima}, 32118 title = {Computational Methods for Solving the Nonlinear Complementarity Problem}, 32119 journal = {Keio Engineering Reports}, 32120 year = {1974}, 32121 volume = {27}, 32122 pages = {1--41} 32123} 32124 32125@Article{ kojima:recent, 32126 author = {M. Kojima}, 32127 title = {Recent advances in mathematical programming. {X}. Computation of fixed points by 32128 continuation methods}, 32129 journal = {Systems and Control}, 32130 year = {1981}, 32131 volume = {25}, 32132 pages = {421--430} 32133} 32134 32135@Article{ kolesar:branch, 32136 author = {P. J. Kolesar}, 32137 title = {A Branch and Bound Algorithm for the Knapsack Problem}, 32138 journal = {Management Science}, 32139 year = {1967}, 32140 volume = {13}, 32141 pages = {723--735} 32142} 32143 32144@Book{ kolman.beck:elementary, 32145 author = {B. Kolman and R. E. Beck}, 32146 title = {Elementary Linear Programming with Applications}, 32147 year = {1980}, 32148 publisher = {Academic Press} 32149} 32150 32151@Book{ koopmans:activity, 32152 editor = {T. C. Koopmans}, 32153 title = {Activity Analysis of Production and Allocation}, 32154 publisher = {John Wiley}, 32155 address = {New York}, 32156 year = {1951} 32157} 32158 32159@Article{ korpelevich:extragradient, 32160 author = {G. M. Korpelevich}, 32161 title = {The Extragradient Method for Finding Saddle Points and Other Problems}, 32162 journal = {Matecon}, 32163 year = {1976}, 32164 volume = {12}, 32165 pages = {747--756} 32166} 32167 32168@Article{ kortanek.shi:convergence, 32169 author = {K. O. Kortanek and M. Shi}, 32170 title = {Convergence Results and Numerical Experiments on a Linear Programming Hybrid 32171 Algorithm}, 32172 journal = {European Journal of Operational Research}, 32173 year = {1987}, 32174 volume = {32}, 32175 pages = {47--61} 32176} 32177 32178@TechReport{ kortanek.shi:remarks, 32179 author = {K. O. Kortanek and M. Shi}, 32180 title = {Remarks on `Convergence Results and Numerical Experiments on a Linear Programming 32181 Hybrid Algorithm 1985-6'}, 32182 institution = {College of Business Administration, University of Iowa}, 32183 year = {1987}, 32184 address = {Iowa City}, 32185 number = {87--1}, 32186 type = {Working Paper} 32187} 32188 32189@TechReport{ kortanek:vector-supercomputer, 32190 author = {K. O. Kortanek}, 32191 title = {Vector--Supercomputer Experiments with the Linear Programming Scaling Algorithm}, 32192 institution = {College of Business Administration, University of Iowa}, 32193 year = {1987}, 32194 address = {Iowa City}, 32195 number = {87--2}, 32196 type = {Working Paper} 32197} 32198 32199@Article{ kostreva:block, 32200 author = {M. M. Kostreva}, 32201 title = {Block Pivot Methods for Solving the Complementarity Problem}, 32202 journal = {Linear Algebra and Its Applications}, 32203 volume = {21}, 32204 pages = {207--215}, 32205 year = {1978} 32206} 32207 32208@Article{ kostreva:elasto-hydrodynamic, 32209 author = {M. M. Kostreva}, 32210 title = {Elasto-hydrodynamic Lubrication: {A} non-linear complementarity problem}, 32211 journal = {International Journal for Numerical Methods in Fluids}, 32212 year = {1984}, 32213 volume = {4}, 32214 pages = {377--397} 32215} 32216 32217@Article{ kostreva:recent, 32218 author = {M. M. Kostreva}, 32219 title = {Recent Results on Complementarity Models for Engineering and Economics}, 32220 journal = {Infor, Journal of the Canadian {OR} Society}, 32221 year = {1990}, 32222 volume = {28}, 32223 pages = {324--334} 32224} 32225 32226@Article{ kotiah.steinberg:occurrences, 32227 author = {T. C. T. Kotiah and D. I. Steinberg}, 32228 title = {Occurrences of Cycling and Other Phenomena Arising in a Class of Linear 32229 Programming Models}, 32230 journal = {Communications of the ACM}, 32231 volume = {20}, 32232 year = {1977}, 32233 pages = {107--112} 32234} 32235 32236@Article{ kotiah.steinberg:possibility, 32237 author = {T. C. T. Kotiah and D. I. Steinberg}, 32238 title = {On the Possibility of Cycling with the Simplex Method}, 32239 journal = {Operations Research}, 32240 volume = {26}, 32241 year = {1978}, 32242 pages = {374--376} 32243} 32244 32245@InCollection{ kuhn.tucker:nonlinear, 32246 author = {H. W. Kuhn and A. W. Tucker}, 32247 title = {Nonlinear Programming}, 32248 booktitle = {Proceedings of the Second Berkeley Symposium on Mathematical Statistics and 32249 Probability}, 32250 year = {1951}, 32251 editor = {J. Neyman}, 32252 publisher = {University of California Press}, 32253 address = {Berkeley and Los Angeles}, 32254 pages = {481--492} 32255} 32256 32257@Article{ kummer:metric, 32258 author = {B. Kummer}, 32259 title = {Metric regularity: characterizations, nonsmooth variations, and successive 32260 approximation}, 32261 journal = {Journal of Mathematical Analysis and its Applications}, 32262 year = {}, 32263 optkey = {}, 32264 optvolume = {}, 32265 optnumber = {}, 32266 optpages = {}, 32267 optmonth = {}, 32268 optnote = {}, 32269 optannote = {} 32270} 32271 32272@InCollection{ kummer:newtons, 32273 author = {B. Kummer}, 32274 title = {{N}ewton's Method for Non--Differentiable Functions}, 32275 booktitle = {Advances in Mathematical Optimization}, 32276 publisher = {Akademie--Verlag}, 32277 year = {1988}, 32278 editors = {J. Guddat et al.}, 32279 pages = {114--125}, 32280 address = {Berlin} 32281} 32282 32283@Unpublished{ kuntsevich.kappel:solvopt, 32284 author = {A. Kuntsevich and F. Kappel}, 32285 title = {{SolvOpt}: The Solver for Local Nonlinear Optimization Problems}, 32286 year = {1997}, 32287 note = {Institute for Mathematics, Karl-Franzens University of Graz}, 32288 url = {http://bedvgm.kfunigraz.ac.at:8001/alex/solvopt/solvopt.html} 32289} 32290 32291@Book{ kushner.clark:stochastic, 32292 author = {H. J. Kushner and D. S. Clark}, 32293 title = {Stochastic Approximation Methods for Constrained and Unconstrained Systems}, 32294 publisher = {Springer-Verlag}, 32295 year = {1978}, 32296 address = {New York} 32297} 32298 32299@Article{ kutcher.burman.ea:histogram, 32300 author = {G. J. Kutcher and C. Burman and L. Brewster and M. Goitein and R. Mohan}, 32301 title = {Histogram reduction method for calculating complication probabilities for 32302 three-dimensional treatment planning evaluation}, 32303 journal = {International Journal of Radiation Oncology, Biology and Physics}, 32304 year = {1991}, 32305 optvolume = {21}, 32306 optpages = {137-146} 32307} 32308 32309@Article{ kutcher.burman:calculation, 32310 author = {G. J. Kutcher and C. Burman}, 32311 title = {Calculation of Complication Probability Factors for Non-Uniform Normal Tissue 32312 Irradiation: The Effective Volume Method}, 32313 journal = {International Journal of Radiation Oncology, Biology and Physics}, 32314 year = {1989}, 32315 volume = {16}, 32316 pages = {1623--1630} 32317} 32318 32319@Article{ kwak.lee:complementarity, 32320 author = {B. M. Kwak and B. C. Lee.}, 32321 title = {A Complementarity Problem Formulation for Two-Dimensional Frictional Contact 32322 Problem}, 32323 journal = {Computers and Structures}, 32324 volume = {18}, 32325 pages = {469--480}, 32326 year = {1988} 32327} 32328 32329@Article{ kwak:complementarity, 32330 author = {B. M. Kwak}, 32331 title = {Complementarity Problem Formulation of Three-Dimensional Frictional Contact}, 32332 journal = {Journal of Applied Mechanics}, 32333 volume = {58}, 32334 pages = {134--140}, 32335 year = {1991} 32336} 32337 32338@Article{ lagarias.reeds.ea:convergence, 32339 author = {J. C. Lagarias and J. A. Reeds and M. H. Wright and P. E. Wright}, 32340 title = {Convergence of the {N}elder-{M}ead Simplex method in Low Dimensions}, 32341 journal = {SIAM Journal on Optimization}, 32342 year = {1998}, 32343 volume = {9}, 32344 pages = {112--147} 32345} 32346 32347@Article{ lahaye:methode, 32348 author = {E. Lahaye}, 32349 title = {Une {M}\'{e}thode de {R}\'{e}solution d'une Cat\'{e}gorie d'\'{E}quations 32350 transcendantes}, 32351 journal = {C. R. Acad. Sci. Paris}, 32352 year = {1934}, 32353 volume = {198}, 32354 pages = {1840--1842} 32355} 32356 32357@Article{ lahaye:solution, 32358 author = {E. Lahaye}, 32359 title = {Solution of Systems of Transcendental Equations}, 32360 journal = {Acad. Roy. Belg. Bull. Cl. Sci.}, 32361 year = {1948}, 32362 volume = {5}, 32363 pages = {805--822} 32364} 32365 32366@Article{ lahenbruch.mickey:estimation, 32367 author = {P. A. Lahenbruch and R. M. Mickey}, 32368 title = {Estimation of Error Rates in Discriminant Analysis}, 32369 journal = {Technometrics}, 32370 year = {1968}, 32371 volume = {10}, 32372 pages = {1--11} 32373} 32374 32375@Article{ lakshminarayan.lakshmanan.ea:optimal, 32376 author = {S. Lakshminarayan and R. Lakshmanan and R. L. Papineau and R. Rochette}, 32377 title = {Optimal Single--Machine Scheduling with Earliness and Tardiness}, 32378 journal = {Operations Research}, 32379 year = {1978}, 32380 volume = {26}, 32381 pages = {1079--1082} 32382} 32383 32384@Article{ land.doig:automatic, 32385 author = {A. H. Land and A. G. Doig}, 32386 title = {An Automatic Method for Solving Discrete Programming Problems}, 32387 journal = {Econometrica}, 32388 volume = {28}, 32389 year = {1960}, 32390 pages = {497-520} 32391} 32392 32393@Article{ langer.morrill:comparison, 32394 author = {M. Langer and S. Morrill}, 32395 title = {A comparison of mixed integer programming and fast simulated annealing for 32396 optimized beam weights in radiation therapy}, 32397 journal = {Medical Physics}, 32398 year = {1996}, 32399 volume = {23}, 32400 number = {6}, 32401 pages = {957--964} 32402} 32403 32404@Article{ larsson.patriksson:class, 32405 author = {T. Larsson and M. Patriksson}, 32406 title = {A Class of Gap Functions for Variational Inequalities}, 32407 journal = {Mathematical Programming}, 32408 year = {1994}, 32409 volume = {64}, 32410 pages = {53--79} 32411} 32412 32413@Article{ lasdon.waren.ea:solving, 32414 author = {L. S. Lasdon and A. Waren and S. Sarkar and F. Palacios}, 32415 title = {Solving the Pooling Problem Using Generalized Reduced Gradient and Successive 32416 Linear Programming Algorithms}, 32417 journal = {ACM SIGMAP Bulletin}, 32418 year = {1979}, 32419 volume = {27}, 32420 pages = {9--15} 32421} 32422 32423@TechReport{ lawler.lenstra.ea:sequencing, 32424 author = {E. L. Lawler and J. K. Lenstra and A. H. G. Rinnooy Kan and D. B. Shmoys}, 32425 title = {Sequencing and Scheduling: Algorithms and Complexity}, 32426 institution = {Centre for Mathematics and Computer Science}, 32427 year = {1989}, 32428 address = {P.O. Box 4079, 1009 AB Amsterdam, The Netherlands}, 32429 number = {BS--R89xx} 32430} 32431 32432@Article{ lawler:fast, 32433 author = {E. L. Lawler}, 32434 title = {Fast Approximations Algorithms for Knapsack Problems}, 32435 journal = {Mathematics of Operations Research}, 32436 year = {1979}, 32437 volume = {4}, 32438 pages = {339--356} 32439} 32440 32441@Book{ lawless:statistical, 32442 author = {J. F. Lawless}, 32443 title = {Statistical Models and Methods for Lifetime Data}, 32444 year = {1982}, 32445 publisher = {John Wiley and Sons}, 32446 address = {New York, NY} 32447} 32448 32449@Article{ lawrence.spingarn:fixed, 32450 author = {J. Lawrence and J. E. Spingarn}, 32451 title = {On fixed points of non-expansive piecewise isometric mappings}, 32452 journal = {Proceedings of the London Mathematical Society}, 32453 year = {1987}, 32454 volume = {55}, 32455 number = {3}, 32456 pages = {605--624} 32457} 32458 32459@Article{ leavitt.martin.ea:dynamic, 32460 author = {D. D. Leavitt and M. Martin and J. H. Moeller and W. L. Lee}, 32461 title = {Dynamic wedge field techniques through computer-controlled collimator motion and 32462 dose delivery}, 32463 journal = {Medical Physics}, 32464 year = {1990}, 32465 volume = {17}, 32466 number = {1}, 32467 pages = {87--92} 32468} 32469 32470@Article{ leblanc.morlok.ea:efficient, 32471 author = {L. J. LeBlanc and E. K. Morlok and W. P. Pierskalla}, 32472 title = {An Efficient Approach to Solving the Road Network Equilibrium Traffic Assignment 32473 Problem}, 32474 journal = {Transportation Research}, 32475 volume = {9}, 32476 year = {1975}, 32477 pages = {309--318} 32478} 32479 32480@Article{ lee:computational, 32481 author = {S. S. Lee}, 32482 title = {A computational method for frictional contact problem using finite element 32483 method}, 32484 journal = {International Journal for Numerical Methods in Engineering}, 32485 volume = {37}, 32486 year = {1994}, 32487 pages = {217--228} 32488} 32489 32490@PhDThesis{ lee:military, 32491 author = {D. K. Lee}, 32492 title = {Military Force Planning Problems Under Uncertainty}, 32493 school = {University of Wisconsin -- Madison}, 32494 year = {1996}, 32495 address = {Madison, Wisconsin} 32496} 32497 32498@Article{ leibel.kutcher.ea:improved, 32499 author = {S. A. Leibel and G. J. Kutcher and L. B. Harrison and D. E. Fass and C. Burman 32500 and M. Hunt and R. Mohan and L. J. Brewster and C. C. Ling and Z. Y. Fuks}, 32501 title = {Improved Dose Distributions For 3{D} Conformal Boost Treatments in Carcinoma of 32502 the Nasopharynx}, 32503 journal = {International Journal of Radiation Oncology, Biology and Physics}, 32504 year = {1991}, 32505 volume = {20}, 32506 pages = {823--833} 32507} 32508 32509@Article{ lee.gallagher.ea:treatment, 32510 author = {E. K. Lee and R. J. Gallagher and D. Silvern and C. S. Wuu and M. Zaider}, 32511 title = {Treatment Planning for Brachytherapy: an Integer Programming Model, Two 32512 Computational Approaches and Experiments with Permanent Prostate Implant 32513 Planning}, 32514 journal = {Physics in Medicine and Biology}, 32515 year = {1999}, 32516 volume = {44}, 32517 pages = {145--165} 32518} 32519 32520@Article{ lemarechal.nemirovskii.ea:variants, 32521 author = {C. Lemar\'{e}chal and A. Nemirovskii and Y. Nesterov}, 32522 title = {New Variants of Bundle Methods}, 32523 year = {1995}, 32524 journal = {Mathematical Programming}, 32525 volume = {69}, 32526 pages = {111--147} 32527} 32528 32529@InCollection{ lemarechal.strodiot.ea:bundle, 32530 author = {C. Lemar\'{e}chal and J. J. Strodiot and A. Bihain}, 32531 title = {On a Bundle Algorithm for Nonsmooth Optimization}, 32532 booktitle = {Nonlinear Programming}, 32533 year = {1981}, 32534 editor = {O. L. Mangasarian and R. R. Meyer and S. M. Robinson}, 32535 publisher = {Academic Press}, 32536 pages = {245--282}, 32537 volume = {4} 32538} 32539 32540@Article{ lemke.howson:equilibrium, 32541 author = {C. E. Lemke and J. T. Howson}, 32542 title = {Equilibrium Points of Bimatrix Games}, 32543 journal = {SIAM Journal on Applied Mathematics}, 32544 year = {1964}, 32545 volume = {12}, 32546 pages = {413--423} 32547} 32548 32549@Article{ lemke:bimatrix, 32550 author = {C. E. Lemke}, 32551 title = {Bimatrix Equilibrium Points and Mathematical Programming}, 32552 journal = {Management Science}, 32553 year = {1965}, 32554 volume = {11}, 32555 pages = {681--689} 32556} 32557 32558@InCollection{ lemke:complementary, 32559 author = {C. E. Lemke}, 32560 title = {On Complementary Pivot Theory}, 32561 booktitle = {Mathematics of the Decision Sciences: Part 1}, 32562 publisher = {American Mathematical Society}, 32563 year = {1968}, 32564 editor = {G. B. Dantzig and A. F. Veinott}, 32565 volume = {11}, 32566 series = {Lectures in Applied Mathematics}, 32567 address = {Providence}, 32568 pages = {95--114} 32569} 32570 32571@Article{ levenberg:method, 32572 author = {K. Levenberg}, 32573 title = {A Method for the Solution of Certain Nonlinear Problems in Least Squares}, 32574 journal = {Quarterly Applied Mathematics}, 32575 year = {1944}, 32576 volume = {2}, 32577 pages = {164--168} 32578} 32579 32580@Article{ levitin.polyak:constrained, 32581 author = {E. S. Levitin and B. T. Polyak}, 32582 title = {Constrained minimization methods}, 32583 journal = {Computational Mathematics and Mathematical Physics}, 32584 year = {1968}, 32585 volume = {6}, 32586 pages = {1--50}, 32587 note = {Translated from Russian} 32588} 32589 32590@Article{ li.swetis:linear, 32591 author = {W. Li and J. J. Swetits}, 32592 title = {The Linear $\ell_1$ Estimator and the {H}uber {M}-Estimator}, 32593 journal = {SIAM Journal on Optimization}, 32594 volume = {8}, 32595 pages = {457-475}, 32596 year = {1998} 32597} 32598 32599@TechReport{ li:error, 32600 author = {W. Li}, 32601 title = {Error Bounds for Piecewise Convex Quadratic Programs and Applications}, 32602 institution = {Department of Mathematics and Statistics, Old Dominion University}, 32603 year = {1993}, 32604 address = {Norfolk, VA 23529}, 32605 number = {TR93-1}, 32606 note = {SIAM Journal on Control and Optimization, to appear} 32607} 32608 32609@TechReport{ li:linearly, 32610 author = {W. Li}, 32611 title = {Linearly Convergent Descent Methods for Unconstrained Minimization of Convex 32612 Quadratic Splines}, 32613 institution = {Department of Mathematics and Statistics, Old Dominion University}, 32614 year = {1993}, 32615 address = {Norfolk, VA 23529}, 32616 number = {TR93-3}, 32617 note = {Journal of Optimization Theory and Applications, to appear} 32618} 32619 32620@InProceedings{ li:merit, 32621 author = {W. Li}, 32622 title = {A Merit Function and a {N}ewton-Type Method for Symmetric Linear Complementarity 32623 Problems}, 32624 crossref = {ferris.pang:complementarity} 32625} 32626 32627@Article{ li:remarks, 32628 author = {W. Li}, 32629 title = {Remarks on Convergence of Matrix Splitting Algorithm for the Symmetric Linear 32630 Complementarity Problem}, 32631 journal = {SIAM Journal on Optimization}, 32632 year = {1993}, 32633 volume = {3}, 32634 pages = {155--163} 32635} 32636 32637@TechReport{ li:sharp, 32638 author = {W. Li}, 32639 title = {Sharp {L}ipschitz Constants for Basic Optimal Solutions of Linear Programs}, 32640 institution = {Department of Mathematics and Statistics, Old Dominion University}, 32641 year = {1991}, 32642 address = {Norfolk, VA 23529}, 32643 number = {TR91-13}, 32644 note = {SIAM Journal on Control and Optimization, to appear} 32645} 32646 32647@Article{ lin.kernighan:efficient, 32648 author = {S. Lin and B. W. Kernighan}, 32649 title = {An Efficient Heuristic Algorithm for the Traveling Salesman Problem}, 32650 journal = {Operations Research}, 32651 year = {1973}, 32652 volume = {21}, 32653 pages = {498--516} 32654} 32655 32656@Article{ lin.pang:iterative, 32657 author = {Y. Y. Lin and J. S. Pang}, 32658 title = {Iterative Methods for Large Convex Quadratic Programs: {A} Survey}, 32659 journal = {SIAM Journal on Control and Optimization}, 32660 year = {1987}, 32661 volume = {25}, 32662 pages = {383--411} 32663} 32664 32665@Unpublished{ linderoth:branch, 32666 author = {J. Linderoth}, 32667 title = {A {B}ranch-and-{P}rice Approach to Stochastic Integer Programming}, 32668 institution = {Argonne National Laboratories}, 32669 year = {2000}, 32670 note = {Working Paper} 32671} 32672 32673@Article{ lions.stampacchia:variational, 32674 author = {J. L. Lions and G. Stampacchia}, 32675 title = {Variational Inequalities}, 32676 journal = {Communications on Pure and Applied Math}, 32677 year = {1967}, 32678 volume = {20}, 32679 pages = {493--19} 32680} 32681 32682@Article{ lions.mercier:splitting, 32683 author = {P.--L. Lions and B. Mercier}, 32684 title = {Splitting Methods for the Sum of Two Nonlinear Operators}, 32685 journal = {SIAM Journal on Numerical Analysis}, 32686 year = {1979}, 32687 volume = {16}, 32688 pages = {964--979} 32689} 32690 32691@Article{ lions:methode, 32692 author = {P.--L. Lions}, 32693 title = {Une {M}\'{e}thode it\'{e}rative de resolution d'une inequation variationnelle}, 32694 journal = {Israel Journal of Mathematics}, 32695 year = {1978}, 32696 volume = {31}, 32697 number = {2}, 32698 pages = {204--208} 32699} 32700 32701@InProceedings{ litzkow.livny.ea:condor, 32702 author = {M. J. Litzkow and M. Livny and M. W. Mutka}, 32703 title = {Condor: {A} Hunter of Idle Workstations}, 32704 booktitle = {Proceedings of the 8th International Conference on Distributed Computing 32705 Systems}, 32706 year = {1988}, 32707 pages = {104--111}, 32708 month = jun 32709} 32710 32711@Article{ liu.nocedal:limited, 32712 author = {D. C. Liu and J. Nocedal}, 32713 title = {On the Limited Memory Method for Large Scale Optimization}, 32714 journal = {Mathematical Programming}, 32715 year = {1989}, 32716 volume = {45}, 32717 pages = {503--528} 32718} 32719 32720@InBook{ livny.raman:high, 32721 author = {M. Livny and R. Raman}, 32722 title = {The Grid: Blueprint for a Future Computing Infrastructure}, 32723 chapter = {High Throughput Resource Management}, 32724 publisher = {Morgan Kaufmann Publishers}, 32725 year = {1999}, 32726 pages = {311--337} 32727} 32728 32729@Article{ llacer:inverse, 32730 author = {J. Llacer}, 32731 title = {Inverse Radiation Treatment Planning using the Dynamically Penalized Likelihood 32732 Method}, 32733 journal = {Medical Physics}, 32734 year = {1997}, 32735 volume = {24}, 32736 number = {11}, 32737 pages = {1751--1764} 32738} 32739 32740@Book{ lojasiewicz:ensembles, 32741 author = {M. S. Lojasiewicz}, 32742 title = {Ensembles semi-analytiques}, 32743 publisher = {Institut des Hautes Etudes Scientifiques}, 32744 year = {1964}, 32745 address = {Bures-sur-Yvette} 32746} 32747 32748@Article{ lootsma:logarithmic, 32749 author = {F. A. Lootsma}, 32750 title = {Logarithmic Programming: {A} Method of Solving Nonlinear Programming Problems}, 32751 journal = {Phillips Research Reports}, 32752 year = {1967}, 32753 volume = {22}, 32754 pages = {329--344} 32755} 32756 32757@InCollection{ lootsma:survey, 32758 author = {F. A. Lootsma}, 32759 title = {A Survey of Methods for Solving Constrained Minimization Problems via 32760 Unconstrained Minimization}, 32761 booktitle = {Numerical Methods for Nonlinear Optimization}, 32762 year = {1972}, 32763 editor = {F. A. Lootsma}, 32764 publisher = {Academic Press}, 32765 address = {London} 32766} 32767 32768@TechReport{ lopezdesilanes.markusen.ea:anti-competitive, 32769 author = {F. {Lopez-de-Silanes} and J. R. Markusen and T. F. Rutherford}, 32770 title = {Anti--Competitive and Rent--Shifting Aspects of Domestic--Content Provisions in 32771 Regional Trade Blocks}, 32772 institution = {National Bureau of Economic Research, Inc.}, 32773 year = {1993}, 32774 number = {4512}, 32775 address = {Cambridge, Massechusetts} 32776} 32777 32778@InCollection{ lopezdesilanes.markusen.ea:auto, 32779 author = {F. {Lopez-de-Silanes} and J. R. Markusen and T. F. Rutherford}, 32780 title = {The auto industry and the {N}orth {A}merican free-trade agreement}, 32781 year = {1994}, 32782 booktitle = {Modelling Trade Policy: AGE Assessments of North American Free Trade}, 32783 publisher = {Cambridge University Press}, 32784 editor = {C. Shields and J. Francois} 32785} 32786 32787@Article{ lopezdesilanes.markusen.ea:complementarity, 32788 author = {F. {Lopez-de-Silanes} and J. R. Markusen and T. F. Rutherford}, 32789 title = {Complementarity and Increasing Returns in Intermediate Inputs}, 32790 journal = {Journal of Development Economics}, 32791 year = {1994}, 32792 volume = {45}, 32793 pages = {133--151} 32794} 32795 32796@Article{ lopezdesilanes.markusen.ea:trade, 32797 author = {F. {Lopez-de-Silanes} and J. R. Markusen and T. F. Rutherford}, 32798 title = {Trade Policy Subtleties with Multinational Firms}, 32799 journal = {European Economic Review}, 32800 year = {1996} 32801} 32802 32803@Article{ lotstedt:coulomb, 32804 author = {P. L{\"{o}}tstedt}, 32805 title = {Coulomb friction in two-dimensional rigid body systems}, 32806 journal = {Zeitschrift f{\"{u}}r Angewandte Mathematik und Mechanik}, 32807 volume = {61}, 32808 year = {1981}, 32809 pages = {605--615} 32810} 32811 32812@Article{ lotstedt:mechanical, 32813 author = {P. L{\"{o}}tstedt}, 32814 title = {Mechanical systems of rigid bodies subject to unilateral constraints}, 32815 journal = {SIAM Journal on Applied Mathematics}, 32816 volume = {42}, 32817 year = {1982}, 32818 pages = {281--296} 32819} 32820 32821@Book{ luenberger:linear, 32822 author = {D. G. Luenberger}, 32823 title = {Linear and Nonlinear Programming}, 32824 year = {1984}, 32825 publisher = {Addison-Wesley}, 32826 edition = {Second} 32827} 32828 32829@Book{ luenberger:optimization, 32830 author = {D. G. Luenberger}, 32831 title = {Optimization by Vector Space Methods}, 32832 year = {1969}, 32833 publisher = {John Wiley \& Sons}, 32834 address = {New York} 32835} 32836 32837@Article{ lundy.mees:convergence, 32838 author = {M. Lundy and A. Mees}, 32839 title = {Convergence of an Annealing Algorithm}, 32840 journal = {Mathematical Programming}, 32841 year = {1986}, 32842 volume = {34}, 32843 pages = {111--124} 32844} 32845 32846@Article{ luo.luo:extension, 32847 author = {X.-D. Luo and Z.-Q. Luo}, 32848 title = {Extension of Hoffman's Error Bound to Polynomial Systems}, 32849 journal = {SIAM Journal on Optimization}, 32850 year = {1994}, 32851 volume = {4}, 32852 pages = {383--392} 32853} 32854 32855@Article{ luo.mangasarian.ea:error, 32856 author = {Z.-Q. Luo and O. L. Mangasarian and J. Ren and M. V. Solodov}, 32857 title = {New Error Bounds for the Linear Complementarity Problem}, 32858 journal = {Mathematics of Operations Research}, 32859 year = {1994}, 32860 pages = {880--892}, 32861 volume = {19} 32862} 32863 32864@Article{ luo.pang.ea:exact, 32865 author = {Z.-Q. Luo and J. S. Pang and D. Ralph and S.-Q. Wu}, 32866 title = {Exact Penalization and Stationarity Conditions of Mathematical Programs with 32867 Equilibrium Constraints}, 32868 journal = {Mathematical Programming}, 32869 volume = {75}, 32870 pages = {19--76}, 32871 year = {1996} 32872} 32873 32874@Book{ luo.pang.ea:mathematical, 32875 author = {Z.-Q. Luo and J. S. Pang and D. Ralph}, 32876 title = {Mathematical Programs with Equilibrium Constraints}, 32877 publisher = {Cambridge University Press}, 32878 year = {1996} 32879} 32880 32881@Article{ luo.pang:error, 32882 author = {Z.-Q. Luo and J. S. Pang}, 32883 title = {Error Bounds for Analytic Systems and their Applications}, 32884 journal = {Mathematical Programming}, 32885 year = {1994}, 32886 volume = {67}, 32887 pages = {1--28} 32888} 32889 32890@Article{ luo.shu.ea:optimizing, 32891 author = {L. Luo and H. Shu and W. Yu and Y. Yan and X. Bao and Y. Fu}, 32892 title = {Optimizing computerized treatment planning for the Gamma Knife by source 32893 culling}, 32894 journal = {International Journal of Radiation Oncology, Biology and Physics}, 32895 year = {1999}, 32896 volume = {45}, 32897 number = {5}, 32898 pages = {1339--1346} 32899} 32900 32901@InProceedings{ luo.tseng:class, 32902 author = {Z.-Q. Luo and P. Tseng}, 32903 title = {A New Class of Merit Functions for the Nonlinear Complementarity Problem}, 32904 crossref = {ferris.pang:complementarity}, 32905 pages = {204--225} 32906} 32907 32908@Article{ luo.tseng:convergence, 32909 author = {Z.-Q. Luo and P. Tseng}, 32910 title = {On the Convergence of the Coordinate Descent Method for Convex Differentiable 32911 Minimization}, 32912 journal = {Journal of Optimization Theory and Applications}, 32913 year = {1992}, 32914 volume = {72}, 32915 pages = {7--35} 32916} 32917 32918@Article{ luo.tseng:convergence*1, 32919 author = {Z.-Q. Luo and P. Tseng}, 32920 title = {On the Convergence of a Matrix Splitting Algorithm for the Symmetric Monotone 32921 Linear Complementarity Problem}, 32922 journal = {SIAM Journal on Control and Optimization}, 32923 year = {1991}, 32924 volume = {29}, 32925 pages = {1037--1060} 32926} 32927 32928@Article{ luo.tseng:convergence*2, 32929 author = {Z.-Q. Luo and P. Tseng}, 32930 title = {On the Convergence Rate of Dual Ascent Methods for Strictly Convex Minimization}, 32931 journal = {Mathematics of Operations Research}, 32932 year = {1993}, 32933 volume = {18}, 32934 pages = {846--867} 32935} 32936 32937@Article{ luo.tseng:error, 32938 author = {Z.--Q. Luo and P. Tseng}, 32939 title = {Error Bound and Convergence Analysis of Matrix Splitting Algorithms for the 32940 Affine Variational Inequality Problem}, 32941 journal = {SIAM Journal on Optimization}, 32942 year = {1992}, 32943 volume = {2}, 32944 pages = {43--54} 32945} 32946 32947@Article{ luo.tseng:error*1, 32948 author = {Z.-Q. Luo and P. Tseng}, 32949 title = {Error Bound and Reduced Gradient Projection Algorithms for Convex Minimization 32950 Over a Polyhedral Set}, 32951 journal = {SIAM Journal on Optimization}, 32952 year = {1993}, 32953 volume = {3}, 32954 pages = {43--59} 32955} 32956 32957@Article{ luo.tseng:error*2, 32958 author = {Z.-Q. Luo and P. Tseng}, 32959 title = {Error Bounds and Convergence Analysis of Feasible Descent Methods: {A} General 32960 Approach}, 32961 journal = {Annals of Operations Research}, 32962 year = {1993}, 32963 volume = {46}, 32964 pages = {157--178} 32965} 32966 32967@Article{ luo.tseng:global, 32968 author = {Z.-Q. Luo and P. Tseng}, 32969 title = {On Global Error Bound for a Class of Monotone Affine Variational Inequality 32970 Problems}, 32971 journal = {Operations Research Letters}, 32972 year = {1992}, 32973 volume = {11}, 32974 pages = {159--165} 32975} 32976 32977@Article{ luo.tseng:linear, 32978 author = {Z.-Q. Luo and P. Tseng}, 32979 title = {On the linear convergence of descent methods for convex essentially smooth 32980 minimization}, 32981 journal = {SIAM Journal on Control and Optimization}, 32982 year = {1992}, 32983 volume = {30}, 32984 pages = {408--425} 32985} 32986 32987@TechReport{ luo:convergence, 32988 author = {Z.-Q. Luo}, 32989 title = {Convergence Analysis of Primal--Dual Interior--Point Algorithms for Convex 32990 Quadratic Programs}, 32991 institution = {Communications Research Laboratory, McMaster University}, 32992 year = {1992}, 32993 address = {Hamilton, Ontario} 32994} 32995 32996@Article{ lustig.marsten.ea:computational, 32997 author = {I. J. Lustig and R. E. Marsten and D. F. Shanno}, 32998 title = {Computational Experience with a Primal-Dual Interior Point Method for Linear 32999 Programming}, 33000 journal = {Linear Algebra and Its Applications}, 33001 year = {1991}, 33002 volume = {152}, 33003 pages = {191--222} 33004} 33005 33006@Article{ lustig.marsten.ea:implementing, 33007 author = {I. J. Lustig and R. E. Marsten and D. F. Shanno}, 33008 title = {On implementing {M}ehrotra's predictor-corrector interior point method for linear 33009 programming}, 33010 journal = {SIAM Journal on Optimization}, 33011 year = {1992}, 33012 volume = {2}, 33013 pages = {435--449} 33014} 33015 33016@Article{ lustig.marsten.ea:interior-point, 33017 author = {I. J. Lustig and R. E. Marsten and D. F. Shanno}, 33018 title = {Interior-Point Methods for Linear Programming: Computational State of the Art}, 33019 journal = {ORSA Journal on Computing}, 33020 year = {1994}, 33021 volume = {6}, 33022 number = {1}, 33023 pages = {1--38} 33024} 33025 33026@Article{ lyman.wolbarst:optimization, 33027 author = {J. T. Lyman and A. B. Wolbarst}, 33028 title = {Optimization of Radiation Therapy {IV}: {A} Dose Volume Histogram Reduction 33029 Algorithm}, 33030 journal = {International Journal of Radiation Oncology, Biology and Physics}, 33031 year = {1989}, 33032 volume = {17}, 33033 pages = {433--436} 33034} 33035 33036@Article{ mackie.holmes.ea:tomotherapy*1, 33037 author = {T. R. Mackie and T. Holmes and S. Swerdloff and P. Reckwerdt and J. O. Deasy and 33038 J. Yang and B. Paliwal and T. Kinsella}, 33039 title = {Tomotherapy: a new concept for the delivery of dynamic conformal radiotherapy}, 33040 journal = {Medical Physics}, 33041 year = {1993}, 33042 volume = {20}, 33043 number = {6}, 33044 pages = {1709--1719} 33045} 33046 33047@Article{ mackie.holmes.ea:tomotherapy*2, 33048 author = {T. R. Mackie and T. W. Holmes and P. J. Reckwerdt and J. Yang}, 33049 title = {Tomotherapy: Optimized Planning and Delivery of Radiation Therapy}, 33050 journal = {Int. J. of Imaging Systems and Technology}, 33051 year = {1995}, 33052 volume = {6}, 33053 pages = {43--55} 33054} 33055 33056@Article{ mackie.scrimger.ea:convolution, 33057 author = {T. R. Mackie and J. W. Scrimger and J. J. Batista}, 33058 title = {A convolution method of calculating dose from 15 Me{V} x-rays}, 33059 journal = {Medical Physics}, 33060 year = {1985}, 33061 volume = {12}, 33062 pages = {188--196} 33063} 33064 33065@Article{ mackinnon:technique, 33066 author = {James G. Mac{K}innon}, 33067 title = {A Technique for the Solution of Spatial Equilibrium Models}, 33068 journal = {Journal of Regional Science}, 33069 year = {1976}, 33070 volume = {16}, 33071 pages = {293--307} 33072} 33073 33074@PhDThesis{ madsen:minimization, 33075 author = {K. Madsen}, 33076 title = {Minimization of Nonlinear Approximation Functions}, 33077 year = {1985}, 33078 address = {Lyngby, Denmark}, 33079 school = {Institute of Numerical Analysis, Technical University of Denmark}, 33080 annote = {Dissertation} 33081} 33082 33083@Book{ magill.quinzii:theory, 33084 author = {M. Magill and M. Quinzii}, 33085 title = {Theory of Incomplete Markets}, 33086 publisher = {MIT Press}, 33087 year = {1996} 33088} 33089 33090@InCollection{ magnanti:models, 33091 author = {T. L. Magnanti}, 33092 title = {Models and Algorithms for Predicting Urban Traffic Equilibria}, 33093 booktitle = {Transportation Planning Models}, 33094 year = {1984}, 33095 editor = {M. Florian}, 33096 publisher = {North Holland}, 33097 pages = {153--186} 33098} 33099 33100@InCollection{ maguregui:modified, 33101 author = {J. Maguregui}, 33102 title = {A modified {N}ewton algorithm for functions over convex sets}, 33103 crossref = {mangasarian.meyer.ea:nonlinear*3}, 33104 pages = {461--473} 33105} 33106 33107@PhDThesis{ maguregui:regular, 33108 author = {J. Maguregui}, 33109 title = {Regular Multivalued Functions and Algorithmic Applications}, 33110 year = {1977}, 33111 address = {Madison, Wisconsin}, 33112 school = {Computer Sciences Department, University of Wisconsin} 33113} 33114 33115@Article{ mahey.oualibouch.ea:proximal, 33116 author = {P. Mahey and S. Oualibouch and D. T. Pham}, 33117 title = {Proximal Decomposition on the Graph of a Maximal Monotone Operator}, 33118 journal = {SIAM Journal on Optimization}, 33119 year = {1995}, 33120 volume = {5}, 33121 pages = {454--466} 33122} 33123 33124@Article{ mahey.pham:partial, 33125 author = {P. Mahey and D. T. Pham}, 33126 title = {Partial Regularization of the Sum of Two Maximal Monotone Operators}, 33127 journal = {{RAIRO} Mod\'{e}lisation et Analyse Num\'{e}rique}, 33128 year = {1993}, 33129 volume = {27}, 33130 pages = {375--392} 33131} 33132 33133@InCollection{ maier.novati:shakedown, 33134 author = {G. Maier and G. Novati}, 33135 title = {A shakedown and bounding theory allowing for nonlinear hardening and second order 33136 geometric effects with reference to discrete structural models}, 33137 editors = {J. A. K{\"{o}}nig and M. Kleiber}, 33138 booktitle = {Inelastic Solids and Structures, A. Sawczuk memorial volume}, 33139 publisher = {Pineridge Press}, 33140 address = {Swansea}, 33141 year = {1990}, 33142 pages = {451--471} 33143} 33144 33145@Article{ maier:incremental, 33146 author = {G. Maier}, 33147 title = {Incremental Plastic Analysis in the Presence of Large Displacement and Physical 33148 Instabilizing Effects}, 33149 journal = {International Journal of Solids and Structures}, 33150 volume = {7}, 33151 year = {1971}, 33152 pages = {345--372} 33153} 33154 33155@InCollection{ maier:inverse, 33156 author = {G. Maier}, 33157 title = {Inverse Problems in Engineering Plasticity: {A} Quadratic Programming Approach}, 33158 booktitle = {Serie VIII}, 33159 publisher = {Academia Nazionale dei Lincei}, 33160 year = {1981}, 33161 volume = {LXX}, 33162 pages = {203--209} 33163} 33164 33165@Article{ maier:matrix, 33166 author = {G. Maier}, 33167 title = {A matrix structural theory of piecewise linear elastoplasticity with interacting 33168 yield planes}, 33169 journal = {Meccanica}, 33170 volume = {5}, 33171 year = {1970}, 33172 pages = {54--66} 33173} 33174 33175@Article{ maier:quadratic, 33176 author = {G. Maier}, 33177 title = {A quadratic programming approach for certain classes of nonlinear structural 33178 problems}, 33179 journal = {Meccanica}, 33180 volume = {3}, 33181 year = {1968}, 33182 pages = {121--130} 33183} 33184 33185@Book{ manber:introduction, 33186 author = {U. Manber}, 33187 title = {Introduction to Algorithms: {A} Creative Approach}, 33188 year = {1989}, 33189 publisher = {Addison-Wesley} 33190} 33191 33192@Article{ mangasarian.deleone:error, 33193 author = {O. L. Mangasarian and R. {De~Leone}}, 33194 title = {Error Bounds for Strongly Convex Programs and (Super)linearly Convergent 33195 Iterative Schemes for the Least 2--norm Solution of Linear Programs}, 33196 journal = {Applied Mathematics and Optimization}, 33197 year = {1988}, 33198 volume = {17}, 33199 pages = {1--14} 33200} 33201 33202@Article{ mangasarian.deleone:parallel, 33203 author = {O. L. Mangasarian and R. {De~Leone}}, 33204 title = {Parallel Successive Overrelaxation Methods for Symmetric Linear Complementarity 33205 Problems and Linear Programs}, 33206 journal = {Journal of Optimization Theory and Applications}, 33207 year = {1987}, 33208 volume = {54}, 33209 pages = {437--446} 33210} 33211 33212@Article{ mangasarian.fromovitz:fritz, 33213 author = {O. L. Mangasarian and S. Fromovitz}, 33214 title = {The {F}ritz {J}ohn necessary optimality conditions in the presence of equality 33215 and inequality constraints}, 33216 journal = {Journal of Mathematical Analysis and its Applications}, 33217 year = {1967}, 33218 volume = {17}, 33219 pages = {37--47} 33220} 33221 33222@Article{ mangasarian.mclinden:simple, 33223 author = {O. L. Mangasarian and L. McLinden}, 33224 title = {Simple Bounds for Solutions of Monotone Complementarity Problems and Convex 33225 Programs}, 33226 journal = {Mathematical Programming}, 33227 year = {1985}, 33228 volume = {32}, 33229 pages = {32--40} 33230} 33231 33232@Article{ mangasarian.meyer:nonlinear, 33233 author = {O. L. Mangasarian and R. R. Meyer}, 33234 title = {Nonlinear Perturbation of Linear Programs}, 33235 journal = {SIAM Journal on Control and Optimization}, 33236 year = {1979}, 33237 volume = {17}, 33238 pages = {745--752} 33239} 33240 33241@TechReport{ mangasarian.musicant:active, 33242 author = {O. L. Mangasarian and David R. Musicant}, 33243 title = {Active Set Support Vector Machine Classification}, 33244 institution = {Data Mining Institute, Computer Sciences Department, University of Wisconsin}, 33245 year = {2000}, 33246 number = {00-04}, 33247 address = {Madison, Wisconsin} 33248} 33249 33250@TechReport{ mangasarian.musicant:lagrangian, 33251 author = {O. L. Mangasarian and D. R. Musicant}, 33252 title = {Lagrangian Support Vector Machines}, 33253 institution = {Data Mining Institute, Computer Sciences Department, University of Wisconsin}, 33254 year = {2000}, 33255 number = {00-06}, 33256 address = {Madison, Wisconsin} 33257} 33258 33259@TechReport{ mangasarian.musicant:robust, 33260 author = {O. L. Mangasarian and David R. Musicant}, 33261 title = {Robust Linear and Support Vector Regression}, 33262 institution = {Data Mining Institute, Computer Sciences Department, University of Wisconsin}, 33263 year = {1999}, 33264 number = {99-09}, 33265 address = {Madison, Wisconsin} 33266} 33267 33268@Article{ mangasarian.musicant:successive, 33269 author = {O. L. Mangasarian and David R. Musicant}, 33270 title = {Successive Overrelaxation for Support Vector Machines}, 33271 journal = {IEEE Transactions on Neural Networks}, 33272 volume = {10}, 33273 year = {1999}, 33274 pages = {1032-1037} 33275} 33276 33277@Article{ mangasarian.pang:exact, 33278 author = {O. L. Mangasarian and J. S. Pang}, 33279 title = {Exact Penalty Functions for Mathematical Programs with Linear Complementarity 33280 Constraints}, 33281 journal = {Optimization}, 33282 year = {1997}, 33283 volume = {42}, 33284 pages = {1--8} 33285} 33286 33287@Article{ mangasarian.pang:extended, 33288 author = {O. L. Mangasarian and J. S. Pang}, 33289 title = {The Extended Linear Complementarity Problem}, 33290 journal = {SIAM Journal on Matrix Analysis and Applications}, 33291 year = {1994}, 33292 volume = {16} 33293} 33294 33295@Article{ mangasarian.ren:error, 33296 author = {O. L. Mangasarian and J. Ren}, 33297 title = {New error bounds for the nonlinear complementarity problem}, 33298 year = {1994}, 33299 volume = {1}, 33300 pages = {49--56}, 33301 journal = {Communications on Applied Nonlinear Analysis} 33302} 33303 33304@Article{ mangasarian.ren:improved, 33305 author = {O. L. Mangasarian and J. Ren}, 33306 title = {New Improved Error Bounds for the Linear Complementarity Problem}, 33307 year = {1994}, 33308 volume = {66}, 33309 journal = {Mathematical Programming}, 33310 pages = {241--255} 33311} 33312 33313@InProceedings{ mangasarian.setiono.ea:pattern, 33314 crossref = {coleman.li:large-scale}, 33315 author = {O. L. Mangasarian and R. Setiono and W. H. Wolberg}, 33316 title = {Pattern Recognition via Linear Programming: Theory and Application to Medical 33317 Diagnosis}, 33318 pages = {22--31} 33319} 33320 33321@Article{ mangasarian.shiau:error, 33322 author = {O. L. Mangasarian and T.--H. Shiau}, 33323 title = {Error Bounds for Monotone Linear Complementarity Problems}, 33324 journal = {Mathematical Programming}, 33325 year = {1986}, 33326 volume = {36}, 33327 pages = {81--89} 33328} 33329 33330@Article{ mangasarian.shiau:lipschitz, 33331 author = {O. L. Mangasarian and T.--H. Shiau}, 33332 title = {{L}ipschitz Continuity of Solutions of Linear Inequalities, Programs and 33333 Complementarity Problems}, 33334 journal = {SIAM Journal on Control and Optimization}, 33335 year = {1987}, 33336 volume = {25}, 33337 pages = {583--595} 33338} 33339 33340@Article{ mangasarian.solodov:nonlinear, 33341 author = {O. L. Mangasarian and M. V. Solodov}, 33342 title = {Nonlinear Complementarity as Unconstrained and Constrained Minimization}, 33343 journal = {Mathematical Programming}, 33344 year = {1993}, 33345 volume = {62}, 33346 pages = {277--298} 33347} 33348 33349@Article{ mangasarian.solodov:serial, 33350 author = {O. L. Mangasarian and M. V. Solodov}, 33351 title = {Serial and Parallel Backpropagation Convergence via Nonmonotone Perturbed 33352 Minimization}, 33353 year = {1994}, 33354 journal = {Optimization Methods and Software}, 33355 volume = {4}, 33356 pages = {103--116} 33357} 33358 33359@Article{ mangasarian.street.ea:breast, 33360 author = {O. L. Mangasarian and W. N. Street and W. H. Wolberg}, 33361 title = {Breast Cancer Diagnosis and Prognosis via Linear Programming}, 33362 journal = {Operations Research}, 33363 year = {1995}, 33364 volume = {43}, 33365 pages = {570--577} 33366} 33367 33368@Article{ mangasarian.wolberg:cancer, 33369 author = {O. L. Mangasarian and W. H. Wolberg}, 33370 title = {Cancer Diagnosis via Linear Programming}, 33371 journal = {SIAM News}, 33372 year = {1990}, 33373 volume = {23}, 33374 pages = {1 \& 18} 33375} 33376 33377@InCollection{ mangasarian:applications, 33378 author = {O. L. Mangasarian}, 33379 title = {Some Applications of Penalty Functions in Mathematical Programming}, 33380 booktitle = {Optimization and Related Fields}, 33381 year = {1986}, 33382 editor = {R. Conti and E. De~Giorgi and F. Giannessi}, 33383 publisher = {Springer-Verlag}, 33384 address = {Heidelberg}, 33385 pages = {307--329}, 33386 note = {Lecture Notes in Mathematics 1190} 33387} 33388 33389@Article{ mangasarian:characterization, 33390 author = {O. L. Mangasarian}, 33391 title = {Characterization of linear complementarity problems as linear programs}, 33392 journal = {Mathematical Programming Study}, 33393 year = {1978}, 33394 volume = {7}, 33395 pages = {74--87} 33396} 33397 33398@InProceedings{ mangasarian:condition, 33399 author = {O. L. Mangasarian}, 33400 title = {A condition number for linear inequalities and linear programs}, 33401 booktitle = {Proceedings of 6. Symposium uber Operations Research, Augsburg, 7-9 September 33402 1981}, 33403 year = {1981}, 33404 editor = {G. Bamberg and O. Opitz}, 33405 publisher = {Verlagsgruppe Athenaum/Hain/Scriptor/Hanstein}, 33406 address = {Konigstein}, 33407 pages = {3--15} 33408} 33409 33410@Article{ mangasarian:convergence, 33411 author = {O. L. Mangasarian}, 33412 title = {On the Convergence of Iterates of an Inexact Matrix Splitting Algorithm for the 33413 Symmetric Monotone Linear Complementarity Problem}, 33414 journal = {SIAM Journal on Optimization}, 33415 volume = {1}, 33416 pages = {114--122}, 33417 year = {1991} 33418} 33419 33420@Article{ mangasarian:equivalence, 33421 author = {O. L. Mangasarian}, 33422 title = {Equivalence of the Complementarity Problem to a System of Nonlinear Equations}, 33423 journal = {SIAM Journal on Applied Mathematics}, 33424 year = {1976}, 33425 volume = {31}, 33426 pages = {89--92} 33427} 33428 33429@Article{ mangasarian:error, 33430 author = {O. L. Mangasarian}, 33431 title = {Error Bounds for Inconsistent Linear Inequalities and Programs}, 33432 journal = {ORSA Journal on Computing}, 33433 volume = {15}, 33434 pages = {187--192}, 33435 year = {1994} 33436} 33437 33438@Article{ mangasarian:error*1, 33439 author = {O. L. Mangasarian}, 33440 title = {Error Bounds for Nondegenerate Monotone Linear Complementarity Problems}, 33441 journal = {Mathematical Programming}, 33442 year = {1990}, 33443 volume = {48}, 33444 pages = {437--445} 33445} 33446 33447@Article{ mangasarian:generalized, 33448 author = {O. L. Mangasarian}, 33449 title = {Generalized Linear Complementarity Problems as Linear Programs}, 33450 journal = {Methods of Operations Research}, 33451 year = {1979}, 33452 editor = {W. Oettli and F. Steffens}, 33453 volume = {31}, 33454 pages = {393--402} 33455} 33456 33457@InCollection{ mangasarian:generalized*1, 33458 author = {O. L. Mangasarian}, 33459 title = {Generalized Support Vector Machines}, 33460 year = {2000}, 33461 pages = {135-146}, 33462 booktitle = {Advances in Large Margin Classifiers}, 33463 editor = {A. Smola and P.~Bartlett and B.~Sch{\"o}lkopf and D.~Schuurmans}, 33464 publisher = {MIT Press}, 33465 address = {Cambridge, MA} 33466} 33467 33468@Article{ mangasarian:global, 33469 author = {O. L. Mangasarian}, 33470 title = {Global error bounds for monotone affine variational inequality problems}, 33471 journal = {Linear Algebra and Its Applications}, 33472 year = {1992}, 33473 pages = {153--164} 33474} 33475 33476@InCollection{ mangasarian:least, 33477 author = {O. L. Mangasarian}, 33478 title = {Least Norm Solution of Non--Monotone Complementarity Problems}, 33479 booktitle = {Functional Analysis, Optimization and Mathematical Economics}, 33480 year = {1990}, 33481 publisher = {Oxford University Press}, 33482 address = {New York}, 33483 pages = {217--221} 33484} 33485 33486@Article{ mangasarian:least-norm, 33487 author = {O. L. Mangasarian}, 33488 title = {Least--Norm Linear Programming Solution as an Unconstrained Minimization 33489 Problem}, 33490 journal = {Journal of Mathematical Analysis and Applications}, 33491 year = {1983}, 33492 volume = {92}, 33493 pages = {240--251} 33494} 33495 33496@Article{ mangasarian:linear, 33497 author = {O. L. Mangasarian}, 33498 title = {Linear Complementarity Problems Solvable by a Single Linear Program}, 33499 journal = {Mathematical Programming}, 33500 year = {1976}, 33501 volume = {10}, 33502 pages = {263--270} 33503} 33504 33505@Article{ mangasarian:linear*1, 33506 author = {O. L. Mangasarian}, 33507 title = {Linear and Nonlinear Separation of Patterns by Linear Programming}, 33508 journal = {Operations Research}, 33509 year = {1965}, 33510 volume = {13}, 33511 pages = {444--452} 33512} 33513 33514@Article{ mangasarian:locally, 33515 author = {O. L. Mangasarian}, 33516 title = {Locally Unique Solutions of Quadratic Programs, Linear and Nonlinear 33517 Complementarity Problems}, 33518 journal = {Mathematical Programming}, 33519 year = {1980}, 33520 volume = {19}, 33521 pages = {200--212} 33522} 33523 33524@InCollection{ mangasarian:machine, 33525 author = {O. L. Mangasarian}, 33526 title = {Machine Learning via Polyhedral Concave Minimization}, 33527 editor = {H. Fischer and B. Riedmueller and S. Schaeffler}, 33528 booktitle = {Applied Mathematics and Parallel Computing - Festschrift for Klaus Ritter}, 33529 pages = {175-188}, 33530 year = {1996}, 33531 address = {Heidelberg}, 33532 publisher = {Physica-Verlag A Springer-Verlag Company} 33533} 33534 33535@Article{ mangasarian:mathematical, 33536 author = {O. L. Mangasarian}, 33537 title = {Mathematical Programming in Neural Networks}, 33538 journal = {ORSA Journal on Computing}, 33539 volume = {5}, 33540 pages = {349--360}, 33541 year = {1993} 33542} 33543 33544@InProceedings{ mangasarian:mathematical*1, 33545 author = {O. L. Mangasarian}, 33546 title = {Mathematical Programming in Machine Learning}, 33547 booktitle = {Nonlinear Optimization and Applications}, 33548 editor = {G. Di Pillo and F. Giannessi}, 33549 publisher = {Plenum Publishing}, 33550 address = {New York}, 33551 pages = {283--295}, 33552 year = {1996} 33553} 33554 33555@Article{ mangasarian:mathematical*2, 33556 author = {O. L. Mangasarian}, 33557 title = {Mathematical Programming in Data Mining}, 33558 journal = {Data Mining and Knowledge Discovery}, 33559 volume = {1}, 33560 year = {1997}, 33561 pages = {183-201} 33562} 33563 33564@Article{ mangasarian:multi-surface, 33565 author = {O. L. Mangasarian}, 33566 title = {Multi-surface Method of Pattern Separation}, 33567 journal = {IEEE Transactions on Information Theory}, 33568 year = {1968}, 33569 volume = {IT-14}, 33570 pages = {801--807} 33571} 33572 33573@Book{ mangasarian:nonlinear, 33574 author = {O. L. Mangasarian}, 33575 title = {Nonlinear Programming}, 33576 year = {1969}, 33577 publisher = {McGraw--Hill}, 33578 address = {New York}, 33579 note = {SIAM Classics in Applied Mathematics 10, SIAM, Philadelphia, 1994} 33580} 33581 33582@Article{ mangasarian:normal, 33583 author = {O. L. Mangasarian}, 33584 title = {Normal Solutions of Linear Programs}, 33585 journal = {Mathematical Programming Study}, 33586 year = {1984}, 33587 volume = {22}, 33588 pages = {206--216} 33589} 33590 33591@Article{ mangasarian:optimal, 33592 author = {O. L. Mangasarian}, 33593 title = {Optimal Simplex Tableau Characterization of Unique and Bounded Solutions of 33594 Linear Programs}, 33595 journal = {Journal of Optimization Theory and Applications}, 33596 year = {1981}, 33597 volume = {35}, 33598 pages = {123--128} 33599} 33600 33601@Article{ mangasarian:parallel, 33602 author = {O. L. Mangasarian}, 33603 title = {Parallel Gradient Distribution in Unconstrained Optimization}, 33604 journal = {SIAM Journal on Control and Optimization}, 33605 volume = {33}, 33606 pages = {1916--1925}, 33607 year = {1995} 33608} 33609 33610@TechReport{ mangasarian:regularized, 33611 author = {O. L. Mangasarian}, 33612 title = {Regularized Linear Programs with Equilibrium Constraints}, 33613 institution = {Computer Sciences Department, University of Wisconsin}, 33614 year = {1997}, 33615 address = {Madison, Wisconsin}, 33616 type = {Mathematical Programming Technical Report}, 33617 number = {97--13}, 33618 url = {ftp: //ftp.cs.wisc.edu/math-prog/tech-reports/97-13.ps} 33619} 33620 33621@Article{ mangasarian:simple, 33622 author = {O. L. Mangasarian}, 33623 title = {A Simple Characterization of Solution Sets of Convex Programs}, 33624 journal = {Operations Research Letters}, 33625 year = {1988}, 33626 volume = {7}, 33627 pages = {21--26} 33628} 33629 33630@Article{ mangasarian:solution, 33631 author = {O. L. Mangasarian}, 33632 title = {Solution of Symmetric Linear Complementarity Problems by Iterative Methods}, 33633 journal = {Journal of Optimization Theory and Applications}, 33634 year = {1977}, 33635 month = aug, 33636 volume = {22}, 33637 pages = {465--485} 33638} 33639 33640@Article{ mangasarian:stable, 33641 author = {O. L. Mangasarian}, 33642 title = {A Stable Theorem of the Alternative: An Extension of the {G}ordan Theorem}, 33643 journal = {Linear Algebra and Its Applications}, 33644 year = {1981}, 33645 volume = {41}, 33646 pages = {209--223} 33647} 33648 33649@Article{ mangasarian:sufficiency, 33650 author = {O. L. Mangasarian}, 33651 title = {Sufficiency of Exact Penalty Minimization}, 33652 journal = {SIAM Journal on Control and Optimization}, 33653 year = {1985}, 33654 month = jan, 33655 volume = {23}, 33656 pages = {30--37} 33657} 33658 33659@Article{ mangasarian:unconstrained, 33660 author = {O. L. Mangasarian}, 33661 title = {Unconstrained {L}agrangians in Nonlinear Programming}, 33662 journal = {SIAM Journal on Control and Optimization}, 33663 year = {1975}, 33664 volume = {13}, 33665 pages = {772--791} 33666} 33667 33668@Book{ manne.richels:buying, 33669 author = {A. S. Manne and R. G. Richels}, 33670 title = {Buying Greenhouse Insurance: The Economics of Carbon Dioxide Emission Limits}, 33671 publisher = {MIT Press}, 33672 year = {1992}, 33673 address = {Cambridge MA} 33674} 33675 33676@Article{ manne.richels:global, 33677 author = {A. S. Manne and R. G. Richels}, 33678 title = {Global {CO2} Emission Reductions - the Impacts of Rising Energy Costs}, 33679 journal = {The Energy Journal}, 33680 year = {1991}, 33681 volume = {12}, 33682 pages = {87--107} 33683} 33684 33685@Article{ manne.richels:international, 33686 author = {A. S. Manne and R. G. Richels}, 33687 title = {International Trade in Carbon Emission Rights: {A} Decomposition Procedure}, 33688 journal = {Economic Review}, 33689 year = {1991}, 33690 volume = {81}, 33691 pages = {135--139} 33692} 33693 33694@Article{ manne.rutherford:international, 33695 author = {A. S. Manne and T. F. Rutherford}, 33696 title = {International Trade in Oil, Gas and Carbon Emission Rights: An Intertemporal 33697 General Equilibrium Model}, 33698 journal = {The Energy Journal}, 33699 year = {1993}, 33700 volume = {14}, 33701 pages = {1--20} 33702} 33703 33704@InCollection{ manne:eta-macro, 33705 author = {A. S. Manne}, 33706 title = {{ETA}-{M}acro: {A} {M}odel of Energy-Economy Interactions}, 33707 booktitle = {Modeling Energy-Economy Interactions}, 33708 year = {1977}, 33709 editor = {C. J. Hitch}, 33710 publisher = {Resources for the Future}, 33711 address = {Washington DC} 33712} 33713 33714@PhDThesis{ maratos:exact, 33715 author = {N. Maratos}, 33716 title = {Exact Penalty Function Algorithms for Finite Dimensional and Control Optimization 33717 Problems}, 33718 year = {1978}, 33719 school = {Imperial College, University of London} 33720} 33721 33722@Article{ marcotte.dussault:note, 33723 author = {P. Marcotte and J.--P. Dussault}, 33724 title = {A Note on a Globally Convergent {N}ewton Method for Solving Monotone Variational 33725 Inequalities}, 33726 journal = {Operations Research Letters}, 33727 year = {1987}, 33728 volume = {6}, 33729 pages = {35--42} 33730} 33731 33732@Article{ marcotte.zhu:exact, 33733 author = {P. Marcotte and D. L. Zhu}, 33734 title = {Exact and Inexact Penalty Methods for the Generalized Bilevel Programming 33735 Problem}, 33736 journal = {Mathematical Programming}, 33737 year = {1996}, 33738 volume = {74}, 33739 pages = {141--158} 33740} 33741 33742@Article{ marcotte:algorithm, 33743 author = {P. Marcotte}, 33744 title = {A New Algorithm for Solving Variational Inequalities with Application to the 33745 Traffic Assignment Problem}, 33746 journal = {Mathematical Programming}, 33747 year = {1985}, 33748 volume = {33}, 33749 pages = {339--351} 33750} 33751 33752@Article{ marcotte:application, 33753 author = {P. Marcotte}, 33754 title = {Application of {K}hobotov's Algorithm to Variational Inequalities and Network 33755 Equilibrium Problems}, 33756 journal = {Information Systems and Operational Research}, 33757 year = {1991}, 33758 volume = {29}, 33759 pages = {258--270} 33760} 33761 33762@Article{ marcotte:network, 33763 author = {P. Marcotte}, 33764 title = {Network Design Problem with Congestion Effects: {A} Case of Bilevel Programming}, 33765 journal = {Mathematical Programming}, 33766 year = {1986}, 33767 volume = {34}, 33768 pages = {142--162} 33769} 33770 33771@Article{ markusen.rutherford.ea:el, 33772 author = {J. R. Markusen and T. F. Rutherford and L. Hunter}, 33773 title = {El libre comercio en {A}merica del {N}orte y la produccion de automoviles}, 33774 journal = {Cuadernos Economicos de Ice}, 33775 year = {1995}, 33776 volume = {59}, 33777 pages = {57--68} 33778} 33779 33780@Article{ markusen.rutherford.ea:trade, 33781 author = {J. R. Markusen and T. F. Rutherford and L. Hunter}, 33782 title = {Trade liberalization in a multinational-dominated industry}, 33783 journal = {Journal of International Economics}, 33784 year = {1995}, 33785 volume = {38}, 33786 pages = {95--118} 33787} 33788 33789@Article{ markusen.rutherford:discrete, 33790 author = {J. R. Markusen and T. F. Rutherford}, 33791 title = {Discrete plant-location decisions in an applied general equilibrium model of 33792 trade liberalization}, 33793 journal = {Weltwirtshchaftliches Archiv}, 33794 year = {1994} 33795} 33796 33797@Article{ markusen.wigle:nash, 33798 author = {J. Markusen and R. Wigle}, 33799 title = {Nash Equilibrium Tariffs for the {U}nited {S}tates and {C}anada: The Roles of 33800 Country Size, Scale Economies and Capital Mobility}, 33801 journal = {Journal of Political Mobility}, 33802 year = {1989}, 33803 volume = {97}, 33804 pages = {368--386} 33805} 33806 33807@Article{ marquardt:algorithm, 33808 author = {D. W. Marquardt}, 33809 title = {An Algorithm for Least--Squares Estimation of Nonlinear Parameters}, 33810 journal = {SIAM Journal on Applied Mathematics}, 33811 year = {1963}, 33812 volume = {11}, 33813 pages = {431--441} 33814} 33815 33816@Article{ martello.toth:algorithm, 33817 author = {S. Martello and P. Toth}, 33818 title = {A New Algorithm for the 0--1 Knapsack Problem}, 33819 journal = {Management Science}, 33820 year = {1988}, 33821 volume = {34}, 33822 pages = {633--644} 33823} 33824 33825@InCollection{ martello.toth:algorithms, 33826 author = {S. Martello and P. Toth}, 33827 title = {Algorithms for Knapsack Problems}, 33828 booktitle = {Surveys in Combinatorial Optimization}, 33829 year = {1987}, 33830 editor = {S. Martello and G. Laporte and M. Minoux and C. Ribeiro}, 33831 publisher = {Annals of Discrete Mathematics 31, North--Holland}, 33832 address = {Amsterdam} 33833} 33834 33835@Article{ martello.toth:mixture, 33836 author = {S. Martello and P. Toth}, 33837 title = {A Mixture of Dynamic Programming and Branch--and--Bound for the Subset--Sum 33838 Problem}, 33839 journal = {Management Science}, 33840 year = {1984}, 33841 volume = {30}, 33842 pages = {765--771} 33843} 33844 33845@Article{ martello.toth:worst-case, 33846 author = {S. Martello and P. Toth}, 33847 title = {Worst--Case Analysis of Greedy Algorithms for the Subset Sum Problem}, 33848 journal = {Mathematical Programming}, 33849 year = {1984}, 33850 volume = {28}, 33851 pages = {198--205} 33852} 33853 33854@Article{ martinet:regularisation, 33855 author = {Bernard Martinet}, 33856 title = {Regularisation d'Inequations Variationelles par Approximations Successives}, 33857 journal = {Revue Fran\c{c}aise d'Informatique et Recherche Operationelle}, 33858 year = {1970}, 33859 volume = {4}, 33860 pages = {154--159} 33861} 33862 33863@Article{ maskin.tirole:theory, 33864 author = {E. Maskin and J. Tirole}, 33865 title = {A theory of Dynamic Oligopoly, {I}: Overview and quantity competition with large 33866 fixed costs}, 33867 journal = {Econometrica}, 33868 volume = {56}, 33869 year = {1988}, 33870 pages = {549--569} 33871} 33872 33873@Article{ maskin.tirole:theory*1, 33874 author = {E. Maskin and J. Tirole}, 33875 title = {A theory of Dynamic Oligopoly, {II}: Price competition, Kinked demand curves, and 33876 Edgeworth cycles}, 33877 journal = {Econometrica}, 33878 volume = {56}, 33879 year = {1988}, 33880 pages = {571--579} 33881} 33882 33883@Article{ maskus.rutherford.ea:economic, 33884 author = {K. Maskus and T. F. Rutherford and S. Selby}, 33885 title = {Economic Implications of Changes in Labor Standards: a Computational Analysis for 33886 {M}exico}, 33887 journal = {North American Journal of Economics and Finance}, 33888 year = {1996} 33889} 33890 33891@Article{ mastor:experimental, 33892 author = {A. A. Mastor}, 33893 title = {An Experimental Investigation and Comparative Evaluation of Production Line 33894 Balancing Techniques}, 33895 journal = {Management Science}, 33896 year = {1970}, 33897 volume = {16}, 33898 pages = {728--746} 33899} 33900 33901@Article{ mathias.pang:error, 33902 author = {R. Mathias and J. S. Pang}, 33903 title = {Error bounds for the linear complementarity problem with a {P}-matrix}, 33904 journal = {Linear Algebra and Its Applications}, 33905 year = {1990}, 33906 volume = {132}, 33907 pages = {123--136} 33908} 33909 33910@Article{ mathiesen:algorithm, 33911 author = {L. Mathiesen}, 33912 title = {An Algorithm based on a Sequence of Linear Complementarity Problems applied to a 33913 {W}alrasian Equilibrium Model: An Example}, 33914 journal = {Mathematical Programming}, 33915 year = {1987}, 33916 volume = {37}, 33917 pages = {1--18} 33918} 33919 33920@Article{ mathiesen:computation, 33921 author = {L. Mathiesen}, 33922 title = {Computation of Economic Equilibria by a Sequence of Linear Complementarity 33923 Problems}, 33924 journal = {Mathematical Programming Study}, 33925 year = {1985}, 33926 volume = {23}, 33927 pages = {144--162} 33928} 33929 33930@Article{ mathiesen:computational, 33931 author = {L. Mathiesen}, 33932 title = {Computational Experience in Solving Equilibrium Models by a Sequence of Linear 33933 Complementarity Problems}, 33934 journal = {Operations Research}, 33935 year = {1985}, 33936 volume = {33}, 33937 pages = {1225--1250} 33938} 33939 33940@Book{ matlab:users, 33941 author = {{MATLAB}}, 33942 title = {User's Guide}, 33943 year = {1992}, 33944 publisher = {The MathWorks, Inc.} 33945} 33946 33947@Book{ mcclelland.rummelhart:explorations, 33948 author = {J. L. McClelland and D. E. Rummelhart}, 33949 title = {Explorations in Parallel Distributed Processing: {A} Handbook of Models, 33950 Programs, and Exercises}, 33951 year = {1987}, 33952 publisher = {MIT Press}, 33953 address = {Cambridge, Massachusetts} 33954} 33955 33956@Article{ mccormick:modification, 33957 author = {G. P. McCormick}, 33958 title = {A Modification of {A}rmijo's Step--Size Rule for Negative Curvature}, 33959 journal = {Mathematical Programming}, 33960 year = {1977}, 33961 volume = {13}, 33962 pages = {111--115} 33963} 33964 33965@Book{ mccormick:nonlinear, 33966 author = {G. P. McCormick}, 33967 title = {Nonlinear Programming: Theory, Algorithms and Applications}, 33968 year = {1983}, 33969 publisher = {John Wiley \& Sons}, 33970 address = {New York} 33971} 33972 33973@Article{ mcculloch.pitts:logical, 33974 author = {W. McCulloch and W. Pitts}, 33975 title = {A Logical Calculus of the Ideas Immanent in Nervous Activity}, 33976 journal = {Bulletin of Mathematical Biophysics}, 33977 year = {1943}, 33978 volume = {7}, 33979 pages = {115--133} 33980} 33981 33982@TechReport{ mckenna.zenios:optimal, 33983 author = {M. McKenna and S. A. Zenios}, 33984 title = {An Optimal Parallel Implementation of a Quadratic Transportation Algorithm}, 33985 institution = {Thinking Machines Corporation}, 33986 year = {1990}, 33987 type = {Working Paper}, 33988 address = {Cambridge, MA} 33989} 33990 33991@Article{ mckinnon:convergence, 33992 author = {K. I. M. McKinnon}, 33993 title = {Convergence of the {N}elder-{M}ead Simplex Method to a Nonstationary Point}, 33994 journal = {SIAM Journal on Optimization}, 33995 year = {1998}, 33996 volume = {9}, 33997 pages = {148--158} 33998} 33999 34000@Article{ mcshane.monma.ea:implementation, 34001 author = {K. A. McShane and C. L. Monma and D. F. Shanno}, 34002 title = {An implementation of a primal-dual interior point method for linear programming}, 34003 journal = {ORSA Journal of Computing}, 34004 year = {1989}, 34005 volume = {1}, 34006 pages = {70--83} 34007} 34008 34009@PhDThesis{ medhi:decomposition, 34010 author = {D. Medhi}, 34011 title = {Decomposition of Structured Large--Scale Optimization Problems and Parallel 34012 Optimization}, 34013 school = {Computer Sciences Department, University of Wisconsin}, 34014 year = {1987}, 34015 address = {Madison, Wisconsin}, 34016 note = {Technical Report 718} 34017} 34018 34019@Article{ medhi:parallel, 34020 author = {D. Medhi}, 34021 title = {Parallel Bundle-Based Decomposition for Large-Scale Structured Mathematical 34022 Programming Problems}, 34023 journal = {Annals of Operations Research}, 34024 year = {1990}, 34025 volume = {22}, 34026 pages = {101--127} 34027} 34028 34029@Article{ megiddo:complexity, 34030 author = {N. Megiddo}, 34031 title = {On the complexity of polyhedral separability}, 34032 journal = {Discrete and Computational Geometry}, 34033 year = {1988}, 34034 volume = {3}, 34035 pages = {325--337} 34036} 34037 34038@Article{ megiddo:finding, 34039 author = {N. Megiddo}, 34040 title = {On Finding Primal-- and Dual--Optimal Bases}, 34041 journal = {ORSA Journal on Computing}, 34042 year = {1991}, 34043 volume = {3}, 34044 pages = {63--65} 34045} 34046 34047@Article{ mehrotra:implementation, 34048 author = {S. Mehrotra}, 34049 title = {On the implementation of a primal-dual interior point method}, 34050 journal = {SIAM Journal on Optimization}, 34051 year = {1992}, 34052 volume = {2}, 34053 pages = {575--601} 34054} 34055 34056@PhDThesis{ merrill:applications, 34057 author = {O. H. Merrill}, 34058 title = {Application and Extensions of an Algorithm that Computes Fixed Points of Upper 34059 Semicontinuous Point to Set Mappings}, 34060 year = {1972}, 34061 school = {University of Michigan} 34062} 34063 34064@Article{ merten.muller:variance, 34065 author = {A. G. Merten and M. E. Muller}, 34066 title = {Variance Minimization in Single Machine Sequencing Problems}, 34067 journal = {Management Science}, 34068 year = {1972}, 34069 volume = {18}, 34070 pages = {518--528} 34071} 34072 34073@TechReport{ meyer:continuity, 34074 author = {R. R. Meyer}, 34075 title = {Continuity Properties of Linear Programs}, 34076 institution = {Computer Sciences Department, University of Wisconsin}, 34077 year = {1979}, 34078 address = {Madison, Wisconsin}, 34079 number = {373} 34080} 34081 34082@Article{ miersemann.mittelmann:continuation, 34083 author = {E. Miersemann and H. D. Mittelmann}, 34084 title = {Continuation for Parametrized Nonlinear Variational Inequalities}, 34085 journal = {Journal of Computational and Applied Mathematics}, 34086 year = {1989}, 34087 volume = {26}, 34088 pages = {23--34} 34089} 34090 34091@Article{ mifflin:semismooth, 34092 author = {R. Mifflin}, 34093 title = {Semismooth and semiconvex functions in constrained optimization}, 34094 journal = {SIAM Journal on Control and Optimization}, 34095 year = {1977}, 34096 volume = {15}, 34097 pages = {957--972} 34098} 34099 34100@Article{ mifflin:stable, 34101 author = {R. Mifflin}, 34102 title = {A Stable Method for Solving Certain Constrained Least Squares Problems}, 34103 journal = {Mathematical Programming}, 34104 vol = {16}, 34105 pages = {141--158}, 34106 year = {1979} 34107} 34108 34109@Book{ miller:survival, 34110 author = {Jr. R. G. Miller}, 34111 title = {Survival Analysis}, 34112 year = {1981}, 34113 publisher = {John Wiley \& Sons}, 34114 address = {New York} 34115} 34116 34117@Book{ minsky.papert:perceptrons, 34118 author = {M. Minsky and S. Papert}, 34119 title = {Perceptrons: An Introduction to Computational Geometry}, 34120 year = {1969}, 34121 publisher = {MIT Press}, 34122 address = {Cambridge, Massachusetts} 34123} 34124 34125@Article{ minty:monotone, 34126 author = {G. J. Minty}, 34127 title = {Monotone (Nonlinear) Operators in {H}ilbert Space}, 34128 journal = {Duke Mathematics Journal}, 34129 year = {1962}, 34130 volume = {29}, 34131 pages = {341--346} 34132} 34133 34134@Article{ minty:monotonicity, 34135 author = {G. J. Minty}, 34136 title = {On the Monotonicity of the Gradient of a Convex Function}, 34137 journal = {Pacific Journal of Mathematics}, 34138 year = {1964}, 34139 volume = {14}, 34140 pages = {243--247} 34141} 34142 34143@TechReport{ mizuno.jarre.ea:unified, 34144 author = {S. Mizuno and F. Jarre and J. Stoer}, 34145 title = {A Unified approach to infeasible--interior--point algorithms via geometrical 34146 linear complementarity problems}, 34147 institution = {Mathematische Institut der Universit{\"{a}}t W{\"{u}}rzburg}, 34148 address = {W{\"{u}}rzburg, Germany}, 34149 year = {1994}, 34150 number = {Nr. 213}, 34151 type = {Preprint} 34152} 34153 34154@TechReport{ mizuno:polynomiality, 34155 author = {S. Mizuno}, 34156 title = {Polynomiality of {K}ojima-{M}egiddo-{M}izuno infeasible-interior-point algorithm 34157 for linear programming}, 34158 institution = {School of Operations Research and Industrial Engineering, Cornell University}, 34159 year = {1993}, 34160 number = {1006}, 34161 address = {Ithaca, New York}, 34162 month = jan 34163} 34164 34165@Article{ mohan.mageras.ea:clinically, 34166 author = {R. Mohan and G. S. Mageras and B. Baldwin and L. J. Brewster and G. J. Kutcher 34167 and S. Leibel and C. M. Burman and C. C. Ling and Z. Fuks}, 34168 title = {Clinically Relevant Optimization of 3-{D} Conformal Treatments}, 34169 journal = {Medical Physics}, 34170 year = {1992}, 34171 volume = {19}, 34172 number = {4}, 34173 pages = {933--944} 34174} 34175 34176@Article{ mohan:field, 34177 author = {R. Mohan}, 34178 title = {Field Shaping for Three-Dimensional Conformal Radiation Therapy and Multileaf 34179 Collimation}, 34180 journal = {Seminars in Radiation Oncology}, 34181 year = {1995}, 34182 volume = {5}, 34183 number = {2}, 34184 pages = {86--99} 34185} 34186 34187@Article{ monteiro.pang.ea:positive, 34188 author = {R. D. C. Monteiro and J. S. Pang and T. Wang}, 34189 title = {A Positive Algorithm for the Nonlinear Complementarity Problem}, 34190 journal = {SIAM Journal on Optimization}, 34191 year = {1995}, 34192 volume = {5}, 34193 pages = {129--148} 34194} 34195 34196@Article{ monteiro.tsuchiya:limiting, 34197 author = {R. D. C. Monteiro and T. Tsuchiya}, 34198 title = {Limiting Behavior of the Derivatives of Certain Trajectories Associated with a 34199 Monotone Horizontal Linear Complementarity Problem}, 34200 year = {1996}, 34201 journal = {Mathematics of Operations Research}, 34202 pages = {793--814}, 34203 volume = {21} 34204} 34205 34206@Article{ monteiro.wright:local, 34207 author = {R. D. C. Monteiro and S. J. Wright}, 34208 title = {Local Convergence of Interior--Point Algorithms for Degenerate {LCP}}, 34209 journal = {Computational Optimization and Applications}, 34210 year = {1994}, 34211 volume = {3}, 34212 pages = {131--155} 34213} 34214 34215@Article{ monteiro.wright:superlinear, 34216 author = {R. D. C. Monteiro and S. J. Wright}, 34217 title = {A Superlinear Infeasible-Interior-Point Affine Scaling Algorithm for {LCP}}, 34218 year = {1996}, 34219 journal = {SIAM Journal on Optimization}, 34220 volume = {6}, 34221 pages = {1--18} 34222} 34223 34224@Article{ monteiro.wright:superlinear*1, 34225 author = {R. D. C. Monteiro and S. J. Wright}, 34226 title = {Superlinear Primal-Dual Affine Scaling Algorithms for {LCP}}, 34227 journal = {Mathematical Programming}, 34228 year = {1995}, 34229 volume = {69}, 34230 pages = {311--333} 34231} 34232 34233@Article{ more.garbow.ea:testing, 34234 author = {J. J. Mor\'{e} and B. S. Garbow and K. E. Hillstrom}, 34235 title = {Testing Unconstrained Optimization Software}, 34236 journal = {ACM Transactions on Mathematical Software}, 34237 year = {1981}, 34238 volume = {7}, 34239 pages = {17--41} 34240} 34241 34242@Article{ more.rheinboldt:p, 34243 author = {J. J. Mor\'{e} and W. C. Rheinboldt}, 34244 title = {On {P}-- and {S}--functions and Related Classes of {N}--Dimensional Nonlinear 34245 Mappings}, 34246 journal = {Linear Algebra and Its Applications}, 34247 year = {1973}, 34248 volume = {6}, 34249 pages = {45--68} 34250} 34251 34252@Article{ more.sorensen:use, 34253 author = {J. J. Mor\'{e} and D. C. Sorensen}, 34254 title = {On the use of Directions of Negative Curvature in a Modified {N}ewton Method}, 34255 journal = {Mathematical Programming}, 34256 year = {1979}, 34257 volume = {16}, 34258 pages = {1--20} 34259} 34260 34261@Article{ more.sorensen:computing, 34262 author = {J. J. Mor\'{e} and D. C. Sorensen}, 34263 title = {Computing a Trust Region Step}, 34264 journal = {SIAM Journal on Scientific and Statistical Computing}, 34265 year = {1983}, 34266 volume = {4}, 34267 pages = {553--572} 34268} 34269 34270@Article{ more.toraldo:solution, 34271 author = {J. J. Mor\'e and G. Toraldo}, 34272 title = {On the Solution of Large Quadratic Programming Problems with Bound Constraints}, 34273 journal = {SIAM Journal on Optimization}, 34274 year = {1991}, 34275 volume = {1}, 34276 pages = {93--113} 34277} 34278 34279@TechReport{ more.vavasis:solution, 34280 author = {J. J. Mor\'{e} and S. A. Vavasis}, 34281 title = {On the Solution of Concave Knapsack Problems}, 34282 institution = {Argonne National Laboratory}, 34283 year = {1988}, 34284 address = {Argonne, Illinois}, 34285 number = {ANL/MCS--P40--1288}, 34286 type = {Mathematics and Computer Science Division Report} 34287} 34288 34289@Book{ more.wright:optimization, 34290 author = {J. J. Mor\'{e} and S. J. Wright}, 34291 title = {Optimization Software Guide}, 34292 publisher = {SIAM}, 34293 address = {Philadelphia, Pennsylvania}, 34294 series = {Frontiers in Applied Mathematics}, 34295 number = {14}, 34296 year = {1993} 34297} 34298 34299@TechReport{ more.wu:global, 34300 author = {J. J. Mor\'{e} and Z. Wu}, 34301 title = {Global Continuation for Distance Geometry Problems}, 34302 institution = {Argonne National Laboratory}, 34303 year = {1995}, 34304 type = {Preprint}, 34305 number = {MCS-P505-0395}, 34306 address = {Argonne, Illinois} 34307} 34308 34309@TechReport{ more.wu:issues, 34310 author = {J. J. Mor\'{e} and Z. Wu}, 34311 title = {Issues in Large-Scale Global Molecular Optimization}, 34312 institution = {Argonne National Laboratory}, 34313 year = {1995}, 34314 type = {Preprint}, 34315 number = {MCS-P539-1095}, 34316 address = {Argonne, Illinois} 34317} 34318 34319@TechReport{ more:collection, 34320 author = {J. J. Mor\'e}, 34321 title = {A Collection of Nonlinear Model Problems}, 34322 institution = {Argonne National Laboratory}, 34323 year = {1989}, 34324 type = {Preprint}, 34325 address = {Argonne, Illinois}, 34326 number = {MCS-P60-0289} 34327} 34328 34329@Article{ more:global, 34330 author = {J. J. Mor\'e}, 34331 title = {Global Methods for Nonlinear Complementarity Problems}, 34332 year = {1996}, 34333 journal = {Mathematics of Operations Research}, 34334 pages = {589--614}, 34335 volume = {21} 34336} 34337 34338@Article{ moreau:proximite, 34339 author = {J.--J. Moreau}, 34340 title = {Proximit\'{e} et Dualit\'{e} dans un Espace {H}ilbertien}, 34341 journal = {Bulletin de la Soci\'{e}t\'{e} Math\'{e}matique de France}, 34342 year = {1965}, 34343 volume = {93}, 34344 pages = {273--299} 34345} 34346 34347@Article{ morrill.lane.ea:dose-volume, 34348 author = {S. Morrill and R. Lane and J. Wong and I. Rosen}, 34349 title = {Dose-volume considerations with linear programming}, 34350 journal = {Medical Physics}, 34351 year = {1991}, 34352 volume = {18}, 34353 number = {6}, 34354 pages = {1201--1210} 34355} 34356 34357@Article{ morrill:very, 34358 author = {S. M. Morrill and K. S. Lam and R. G. Lane and M. Langer and I. I. Rosen}, 34359 title = {Very Fast Simulated Annealing in Radiation Therapy Treatment Plan Optimization}, 34360 journal = {International Journal of Radiation Oncology, Biology and Physics}, 34361 year = {1995}, 34362 volume = {31}, 34363 pages = {179--188} 34364} 34365 34366@TechReport{ morshedi.tapia:karmarkar, 34367 author = {A. M. Morshedi and R. A. Tapia}, 34368 title = {Karmarkar as a Classical Method}, 34369 institution = {Department of Mathematical Sciences, Rice University}, 34370 year = {1987}, 34371 number = {87--7}, 34372 type = {Technical Report} 34373} 34374 34375@Article{ mosco:dual, 34376 author = {U. Mosco}, 34377 title = {Dual Variational Inequalities}, 34378 journal = {Journal of Mathematical Analysis and its Applications}, 34379 year = {1972}, 34380 volume = {40}, 34381 pages = {202--206} 34382} 34383 34384@Article{ motzkin.schoenberg:relaxation, 34385 author = {T. S. Motzkin and I. J. Schoenberg}, 34386 title = {The relaxation method for linear inequalities}, 34387 journal = {Canadian Journal of Mathematics}, 34388 year = {1954}, 34389 volume = {6}, 34390 pages = {393--404} 34391} 34392 34393@InProceedings{ muhlenbein:parallel, 34394 crossref = {schaeffer:third}, 34395 author = {H. M{\"{}u}hlenbein}, 34396 title = {Parallel Genetic Algorithms, Population Genetics and Combinatorial Optimization}, 34397 pages = {416--421} 34398} 34399 34400@Article{ mukhopadhyay.roy.ea:polynomial, 34401 author = {S. Mukhopadhyay and A. Roy and S. Govil}, 34402 title = {A polynomial time algorithm for generating neural networks for pattern 34403 classification: Its stability properties and some test results}, 34404 journal = {Neural Computation}, 34405 year = {1993}, 34406 volume = {5}, 34407 pages = {317--330} 34408} 34409 34410@Article{ mulvey.ruszczynski:diagonal, 34411 author = {J. M. Mulvey and A. Ruszczynski}, 34412 title = {A Diagonal Quadratic Approximation Methods for Large Scale Linear Programs}, 34413 journal = {Operations Research Letters}, 34414 year = {1992}, 34415 volume = {12}, 34416 pages = {205--215} 34417} 34418 34419@TechReport{ mulvey.ruszczynski:scenario, 34420 author = {J. M. Mulvey and A. Ruszczynski}, 34421 title = {A New Scenario Decomposition Method for Large--Scale Stochastic Optimization}, 34422 institution = {Department of Civil Engineering and Operations Research, Princeton University}, 34423 year = {1991}, 34424 address = {Princeton, New Jersey}, 34425 number = {SOR 91-19}, 34426 type = {Technical Report} 34427} 34428 34429@PhDThesis{ munson:algorithms, 34430 author = {T. S. Munson}, 34431 title = {Algorithms and Environments for Complementarity}, 34432 school = {University of Wisconsin--Madison}, 34433 year = {2000}, 34434 address = {Madison, Wisconsin}, 34435 month = aug, 34436 url = {ftp: //ftp.cs.wisc.edu/math-prog/tech-reports/00-02.ps} 34437} 34438 34439@Article{ munson.facchinei.ea:semismooth, 34440 author = {T. S. Munson and F. Facchinei and M. C. Ferris and A. Fischer and C. Kanzow}, 34441 title = {The Semismooth Algorithm for Large Scale Complementarity Problems}, 34442 journal = {INFORMS Journal on Computing}, 34443 year = {2001}, 34444 volume = {forthcoming} 34445} 34446 34447@Article{ murchland:braess, 34448 author = {J. D. Murchland}, 34449 title = {Braess' Paradox of Traffic Flow}, 34450 journal = {Transportation Research}, 34451 year = {1970}, 34452 volume = {4}, 34453 pages = {391--394} 34454} 34455 34456@Unpublished{ murphy.aha:uci, 34457 author = {P. M. Murphy and D. W. Aha}, 34458 title = {{UCI} Repository of Machine Learning Databases}, 34459 year = {1992}, 34460 note = {Department of Information and Computer Science, University of California, Irvine, 34461 California, http://www.ics.uci.edu/AI/ML/MLDBRepository.html} 34462} 34463 34464@Book{ murphy.lawrence.ea:american, 34465 editor = {G. P. Murphy and W. L. Lawrence and R. E. Lenhard}, 34466 title = {American Cancer Society Textbook of Clinical Oncology}, 34467 publisher = {The American Cancer Society, Inc.}, 34468 address = {Atlanta, Georgia}, 34469 year = {1995} 34470} 34471 34472@Article{ murphy.sherali.ea:mathematical, 34473 author = {Frederic H. Murphy and Hanif D. Sherali and Allen L. Soyster}, 34474 title = {A Mathematical Programming Approach for Determining Oligopolistic Market 34475 Equilibrium}, 34476 journal = {Mathematical Programming}, 34477 year = {1982}, 34478 volume = {24}, 34479 pages = {92--106} 34480} 34481 34482@TechReport{ murtagh.saunders:minos, 34483 author = {B. A. Murtagh and M. A. Saunders}, 34484 title = {{MINOS} 5.0 User's Guide}, 34485 institution = {Stanford University}, 34486 address = {Stanford, California}, 34487 year = {1983}, 34488 number = {{SOL} 83.20}, 34489 type = {Technical Report} 34490} 34491 34492@InProceedings{ murthy.kasif.ea:oc1, 34493 author = {S. Murthy and S. Kasif and S. Salzberg and R. Beigel}, 34494 title = {{OC1}: Randomized Induction of Oblique Decision Trees}, 34495 booktitle = {Proceedings of the Eleventh National Conference on Artificial Intelligence}, 34496 year = {1993}, 34497 publisher = {The AAAI Press/The MIT Press}, 34498 address = {Cambridge, MA 02142}, 34499 pages = {322--327} 34500} 34501 34502@Book{ murty:linear, 34503 author = {K. G. Murty}, 34504 title = {Linear Complementarity, Linear and Nonlinear Programming}, 34505 year = {1988}, 34506 publisher = {Helderman-Verlag}, 34507 address = {Berlin} 34508} 34509 34510@Book{ murty:linear*1, 34511 author = {K. G. Murty}, 34512 title = {Linear Programming}, 34513 year = {1983}, 34514 publisher = {John Wiley \& Sons}, 34515 address = {New York} 34516} 34517 34518@Article{ murty:number, 34519 author = {K. G. Murty}, 34520 title = {On the number of solutions of the complementarity problem and spanning properties 34521 of cones}, 34522 journal = {Linear Algebra and Its Applications}, 34523 year = {1972}, 34524 volume = {5}, 34525 pages = {65--108} 34526} 34527 34528@Book{ murty:linear*2, 34529 author = {K. G. Murty}, 34530 title = {Linear and Combinatorial Programming}, 34531 year = {1976}, 34532 publisher = {John Wiley \& Sons}, 34533 address = {New York} 34534} 34535 34536@Book{ nagurney:network, 34537 author = {A. Nagurney}, 34538 title = {Network Economics -- {A} Variational Inequality Approach}, 34539 publisher = {Kluwer Academic Publishers}, 34540 year = {1993}, 34541 address = {Dordrecht, The Netherlands} 34542} 34543 34544@Article{ nash.nocedal:numerical, 34545 author = {S. G. Nash and J. Nocedal}, 34546 title = {A Numerical Study of the Limited Memory {BFGS} Method and the Truncated-{N}ewton 34547 Method for Large Scale Optimization}, 34548 journal = {SIAM Journal on Optimization}, 34549 year = {1991}, 34550 volume = {3}, 34551 pages = {358--372} 34552} 34553 34554@Article{ nash:equilibrium, 34555 author = {J. F. Nash}, 34556 title = {Equilibrium Points in {N}--Person Games}, 34557 journal = {Proceedings of the National Academy of Sciences}, 34558 year = {1950}, 34559 volume = {36}, 34560 pages = {48--49} 34561} 34562 34563@Article{ nash:non-cooperative, 34564 author = {J. F. Nash}, 34565 title = {Non-cooperative games}, 34566 journal = {Annals of Mathematics}, 34567 year = {1951}, 34568 volume = {54}, 34569 pages = {286--295} 34570} 34571 34572@Article{ nash:newton-type, 34573 author = {S. G. Nash}, 34574 title = {{N}ewton--Type Minimization via {L}anczos Method}, 34575 journal = {SIAM Journal on Numerical Analysis}, 34576 year = {1984}, 34577 volume = {21}, 34578 pages = {770--788} 34579} 34580 34581@Article{ nauss:efficient, 34582 author = {R. M. Nauss}, 34583 title = {An Efficient Algorithm for the 0--1 Knapsack Problem}, 34584 journal = {Management Science}, 34585 year = {1976}, 34586 volume = {23}, 34587 pages = {27--31} 34588} 34589 34590@Book{ nazareth:computer, 34591 author = {J. L. Nazareth}, 34592 title = {Computer Solution of Linear Programs}, 34593 year = {1987}, 34594 publisher = {Oxford University Press}, 34595 address = {Oxford} 34596} 34597 34598@Article{ nelder.mead:simplex, 34599 title = {A Simplex Method for Function Minimization}, 34600 author = {J. A. Nelder and R. Mead}, 34601 journal = {Computer Journal}, 34602 volume = {7}, 34603 pages = {308--313}, 34604 year = {1965} 34605} 34606 34607@Article{ nemhauser.savelsbergh.ea:minto, 34608 author = {G. L. Nemhauser and M. W. P. Savelsbergh and G. S. Sigismondi}, 34609 title = {{MINTO}, {A} Mixed Integer Optimizer}, 34610 journal = {Operations Research Letters}, 34611 year = {1994}, 34612 optkey = {}, 34613 optvolume = {15}, 34614 optnumber = {}, 34615 optpages = {47--58}, 34616 optmonth = {}, 34617 optnote = {}, 34618 optannote = {} 34619} 34620 34621@Book{ nemhauser.wolsey:integer, 34622 author = {G. L. Nemhauser and L. A. Wolsey}, 34623 title = {Integer and Combinatorial Optimization}, 34624 publisher = {John Wiley \& Sons}, 34625 year = {1988}, 34626 address = {New York, NY} 34627} 34628 34629@Article{ nestor.pasurka:alternative, 34630 author = {D. Vaughn Nestor and C. Pasurka}, 34631 title = {Alternative Specifications for Environmental Control Costs in a General 34632 Equilibrium Framework}, 34633 journal = {Economics Letters}, 34634 year = {1995}, 34635 volume = {48}, 34636 pages = {273--280} 34637} 34638 34639@Article{ nestor.pasurka:cge, 34640 author = {D. Vaughn Nestor and C. Pasurka}, 34641 title = {{CGE} Model of Pollution Abatement Processes for Assessing the Economic Effects 34642 of Environmental Policy}, 34643 journal = {Economic Modelling}, 34644 year = {1995}, 34645 volume = {12}, 34646 pages = {53--59} 34647} 34648 34649@Article{ newman.shapiro:theorems, 34650 author = {D. J. Newman and H. S. Shapiro}, 34651 title = {Some Theorems on \v{C}eby\v{s}ev Approximation}, 34652 journal = {Duke Mathematical Journal}, 34653 year = {1963}, 34654 volume = {30}, 34655 pages = {673--682} 34656} 34657 34658@Article{ ng.peyton:block, 34659 author = {E. Ng and B. Peyton}, 34660 title = {Block Sparse Cholesky Algorithms on Advanced Uniprocessor Computers}, 34661 journal = {SIAM Journal on Scientific and Statistical Computing}, 34662 year = {1993}, 34663 volume = {14}, 34664 pages = {1034--1056} 34665} 34666 34667@TechReport{ nielsen.zenios:solving, 34668 author = {S. S. Nielsen and S. A. Zenios}, 34669 title = {Solving Linear Stochastic Network Programs using Massively Parallel Proximal 34670 Algorithms}, 34671 institution = {Decision Sciences Department, The Wharton School, University of Pennsylvania}, 34672 year = {1992}, 34673 address = {Philadelphia}, 34674 number = {92-01-05} 34675} 34676 34677@Article{ niemierko:optimization, 34678 author = {A. Niemierko}, 34679 title = {Optimization of 3{D} Radiation Therapy With Both Physical and Biological End 34680 Points and Constraints}, 34681 journal = {International Journal of Radiation Oncology, Biology and Physics}, 34682 year = {1992}, 34683 volume = {23}, 34684 pages = {99--108} 34685} 34686 34687@InCollection{ niemierko:treatment, 34688 author = {A. Niemierko}, 34689 title = {Treatment Plan Optimization}, 34690 booktitle = {3-D Radiation Treatment Planning and Conformal Therapy}, 34691 editor = {J. A. Purdy and B. Emami}, 34692 publisher = {Medical Physics Publishing}, 34693 year = {1993}, 34694 pages = {49--55}, 34695 address = {St. Louis, Missouri} 34696} 34697 34698@Article{ niemireko:optimization, 34699 author = {A. Niemierko}, 34700 title = {Optimization of intensity modulated beams: Local or global optimum?}, 34701 journal = {Medical Physics}, 34702 year = {1996}, 34703 optvolume = {23}, 34704 optpages = {1072} 34705} 34706 34707@Manual{ nih:radiation, 34708 title = {Radiation Therapy and You - {A} Guide to Self-Help During Treatment}, 34709 author = {N. C. I. National Institutes of Health}, 34710 organization = {NIH Publication}, 34711 address = {Bethesda, Maryland}, 34712 edition = {97-2227}, 34713 year = {1997} 34714} 34715 34716@Book{ nilsson:learning, 34717 author = {N. J. Nilsson}, 34718 title = {Learning Machines}, 34719 year = {1966}, 34720 publisher = {MIT Press}, 34721 address = {Cambridge, Massachusetts} 34722} 34723 34724@Article{ nocedal:theory, 34725 author = {J. Nocedal}, 34726 title = {Theory of Algorithms for Unconstrained Optimization}, 34727 journal = {Acta Numerica}, 34728 year = {1992}, 34729 pages = {199--242} 34730} 34731 34732@InProceedings{ noyes:neural, 34733 author = {J. L. Noyes}, 34734 title = {Neural Network Optimization Methods}, 34735 booktitle = {Proceedings of the Fourth Conference on Neural Networks and Parallel Distributed 34736 Processing}, 34737 year = {1991}, 34738 publisher = {Indiana-Purdue University}, 34739 address = {Fort Wayne, Indiana}, 34740 pages = {1--12} 34741} 34742 34743@Article{ nygard.juell.ea:neural, 34744 author = {K. E. Nygard and P. Juell and N. Kadaba}, 34745 title = {Neural Networks for Selecting Vehicle Routing Heuristics}, 34746 journal = {ORSA Journal on Computing}, 34747 year = {1990}, 34748 volume = {4}, 34749 pages = {353--364} 34750} 34751 34752@Article{ oh.goenka:elastohydrodynamic, 34753 author = {K. P. Oh and P. K. Goenka}, 34754 title = {The Elastohydrodynamic Solution of Journal Bearings under Dynamic Loading}, 34755 journal = {Transactions of the {ASME}, Journal of Tribology}, 34756 volume = {107}, 34757 year = {1985}, 34758 pages = {389--395} 34759} 34760 34761@Article{ oh.li.ea:elastohydrodynamic, 34762 author = {K. P. Oh and C. H. Li and P. K. Goenka}, 34763 title = {Elastohydrodynamic Lubrication of Piston Skirts}, 34764 journal = {Transactions of the {ASME}, Journal of Tribology}, 34765 volume = {109}, 34766 pages = {356--362}, 34767 year = {1987} 34768} 34769 34770@Article{ oh:analysis, 34771 author = {K. P. Oh}, 34772 title = {Analysis of a Needle Bearing}, 34773 journal = {Transactions of the {ASME}, Journal of Tribology}, 34774 volume = {106}, 34775 pages = {78--87}, 34776 year = {1984} 34777} 34778 34779@Article{ oh:formulation, 34780 author = {K. P. Oh}, 34781 title = {The Formulation of the Mixed Lubrication Problem as a Generalized Nonlinear 34782 Complementarity Problem}, 34783 journal = {Transactions of the {ASME}, Journal of Tribology}, 34784 volume = {108}, 34785 year = {1986}, 34786 pages = {598--604} 34787} 34788 34789@Article{ oh:numerical, 34790 author = {K. P. Oh}, 34791 title = {The Numerical Solution of Dynamically Loaded Elastohydrodynamic Contact as a 34792 Nonlinear Complementarity Problem}, 34793 journal = {Transactions of the {ASME}, Journal of Tribology}, 34794 volume = {106}, 34795 year = {1984}, 34796 pages = {88--95} 34797} 34798 34799@Article{ olivera.shepard.ea:maximum, 34800 author = {G. H. Olivera and D. M. Shepard and P. J. Reckwerdt and K. Ruchala and J. Zachman 34801 and E. E. Fitchard and T. R. Mackie}, 34802 title = {Maximum Likelihood as a Common Computational Framework in Tomotherapy}, 34803 journal = {Physics in Medicine and Biology}, 34804 year = {1998}, 34805 pages = {3277--3294} 34806} 34807 34808@Article{ opial:weak, 34809 author = {Z. Opial}, 34810 title = {Weak Convergence of the Sequence of Successive Approximations for Nonexpansive 34811 Mappings}, 34812 journal = {Bulletin of the American Mathematical Society}, 34813 year = {1967}, 34814 volume = {73}, 34815 pages = {591--597} 34816} 34817 34818@Book{ orchard-hays:advanced, 34819 author = {W. Orchard--Hays}, 34820 title = {Advanced Linear Programming Computing Techniques}, 34821 year = {1968}, 34822 publisher = {McGraw--Hill}, 34823 address = {New York} 34824} 34825 34826@Article{ orourke.taylor.ea:factor, 34827 author = {K. O'Rourke and A. M. Taylor and J. G. Williamson}, 34828 title = {Factor price convergence in the late nineteenth century}, 34829 journal = {International Economic Review}, 34830 year = {1996} 34831} 34832 34833@Article{ orourke.williamson:open, 34834 author = {K. O'Rourke and J. G. Williamson}, 34835 title = {Open economy forces and late 19th century {S}wedish catch-up: a quantitative 34836 accounting}, 34837 journal = {Scandinavian Economic and Social History}, 34838 year = {1995}, 34839 volume = {XLIII}, 34840 pages = {171--203} 34841} 34842 34843@Article{ orourke:costs, 34844 author = {K. O'Rourke}, 34845 title = {The costs of international economic disintegration: {I}reland in the 1930's}, 34846 journal = {Research in Economic History}, 34847 year = {1995}, 34848 volume = {15}, 34849 pages = {215--259} 34850} 34851 34852@Article{ orourke:industrial, 34853 author = {K. O'Rourke}, 34854 title = {Industrial policy, employment policy and the non-traded sector}, 34855 journal = {Journal of the Statistical and Social Inquiry Society of Ireland}, 34856 year = {1996} 34857} 34858 34859@Article{ orourke:measuring, 34860 author = {K. O'Rourke}, 34861 title = {Measuring protection: a cautionary tale}, 34862 journal = {Journal of Development Economics}, 34863 year = {1996} 34864} 34865 34866@Book{ ortega.rheinboldt:iterative, 34867 author = {J. M. Ortega and W. C. Rheinboldt}, 34868 title = {Iterative Solution of Nonlinear Equations in Several Variables}, 34869 year = {1970}, 34870 publisher = {Academic Press}, 34871 address = {San Diego, California} 34872} 34873 34874@Book{ ortega:introduction, 34875 author = {J. M. Ortega}, 34876 title = {Introduction to Parallel and Vector Solution of Linear Systems}, 34877 year = {1988}, 34878 publisher = {Plenum Press}, 34879 address = {New York} 34880} 34881 34882@Book{ ortega:numerical, 34883 author = {J. M. Ortega}, 34884 title = {Numerical Analysis, {A} Second Course}, 34885 year = {1972}, 34886 publisher = {Academic Press} 34887} 34888 34889@Article{ osborne.womersley:strong, 34890 author = {M. R. Osborne and R. S. Womersley}, 34891 title = {Strong uniqueness in sequential linear programming}, 34892 journal = {Journal of the Australian Mathematical Society, Series B}, 34893 year = {1990}, 34894 volume = {31}, 34895 pages = {379--384} 34896} 34897 34898@InCollection{ osborne:strong, 34899 author = {M. R. Osborne}, 34900 title = {Strong uniqueness in nonlinear approximation}, 34901 booktitle = {The numerical solution of nonlinear problems}, 34902 year = {1981}, 34903 editor = {C. T. H. Baker and C. Phillips}, 34904 publisher = {Clarendon Press}, 34905 address = {Oxford} 34906} 34907 34908@Book{ outrata.kocvara.ea:nonsmooth, 34909 author = {J. Outrata and M. Ko\v{c}vara and J. Zowe}, 34910 title = {Nonsmooth Approach to Optimization Problems with Equilibrium Constraints}, 34911 publisher = {Kluwer Academic Publishers}, 34912 year = {1998}, 34913 address = {Dordrecht, The Netherlands} 34914} 34915 34916@Article{ outrata.zowe:numerical, 34917 author = {J. V. Outrata and J. Zowe}, 34918 title = {A Numerical Approach to Optimization Problems with Variational Inequality 34919 Constraints}, 34920 journal = {Mathematical Programming}, 34921 year = {1995}, 34922 volume = {68}, 34923 pages = {105--130} 34924} 34925 34926@Article{ outrata:necessary, 34927 author = {J. V. Outrata}, 34928 title = {On Necessary Optimality Conditions for {S}tackelberg Problems}, 34929 journal = {Journal of Optimization Theory and Applications}, 34930 volume = {76}, 34931 year = {1993}, 34932 pages = {305--320} 34933} 34934 34935@Article{ outrata:numerical, 34936 author = {J. V. Outrata}, 34937 title = {On the Numerical Solution of a Class of {S}tackelberg Problems}, 34938 journal = {Zeitschrift f{\"{u}}r Operations Research}, 34939 volume = {4}, 34940 year = {1990}, 34941 pages = {255--278} 34942} 34943 34944@Article{ outrata:optimization, 34945 author = {J. V. Outrata}, 34946 title = {On Optimization Problems with Variational Inequality Constraints}, 34947 journal = {SIAM Journal on Optimization}, 34948 volume = {4}, 34949 year = {1994}, 34950 pages = {340--357} 34951} 34952 34953@Article{ paige.saunders:lsqr, 34954 author = {C. C. Paige and M. A. Saunders}, 34955 title = {{LSQR}: An Algorithm for Sparse Linear Equations and Sparse Least Squares}, 34956 journal = {{ACM} Transactions on Mathematical Software}, 34957 year = {1982}, 34958 volume = {8}, 34959 pages = {43--71} 34960} 34961 34962@Article{ paige.saunders:solution, 34963 author = {C. C. Paige and M. A. Saunders}, 34964 title = {Solution of Sparse Indefinite Systems of Linear Equations}, 34965 journal = {SIAM Journal on Numerical Analysis}, 34966 year = {1975}, 34967 volume = {12}, 34968 pages = {617--629} 34969} 34970 34971@Article{ palacios-gomez.lasdon.ea:nonlinear, 34972 author = {F. Palacios--Gomez and L. Lasdon and M. Engquist}, 34973 title = {Nonlinear Optimization by Successive Linear Programming}, 34974 journal = {Management Science}, 34975 year = {1982}, 34976 volume = {28}, 34977 pages = {1106--1120} 34978} 34979 34980@Article{ palomares.mangasarian:superlinearly, 34981 author = {U. M. Garcia Palomares and O. L. Mangasarian}, 34982 title = {Superlinearly Convergent {Q}uasi--{N}ewton Algorithms for Nonlinearly Constrained 34983 Optimization Problems}, 34984 journal = {Mathematical Programming}, 34985 year = {1976}, 34986 volume = {11}, 34987 pages = {1--13} 34988} 34989 34990@Article{ panagiotopoulos.al-fahed:robot, 34991 author = {P. D. Panagiotopoulos and A. M. Al-Fahed}, 34992 title = {Robot Hand Grasping and Related Problems: Optimal Contol and Identification}, 34993 journal = {The International Journal of Robotics Research}, 34994 year = {1994}, 34995 volume = {13}, 34996 pages = {127--136} 34997} 34998 34999@Book{ panagiotopoulos:hemivariational, 35000 author = {P. D. Panagiotopoulos}, 35001 title = {Hemivariational Inequalities}, 35002 publisher = {Springer-Verlag}, 35003 address = {Berlin}, 35004 year = {1993} 35005} 35006 35007@Book{ panagiotopoulos:inequality, 35008 author = {P. D. Panagiotopoulos}, 35009 title = {Inequality Problems in Mechanics and Applications}, 35010 publisher = {Birkh{\"{a}}user}, 35011 address = {Boston}, 35012 year = {1985} 35013} 35014 35015@Article{ pang.chan:iterative, 35016 author = {J. S. Pang and D. Chan}, 35017 title = {Iterative Methods for Variational and Complementarity Problems}, 35018 journal = {Mathematical Programming}, 35019 year = {1982}, 35020 volume = {24}, 35021 pages = {284--313} 35022} 35023 35024@Article{ pang.gabriel:nesqp, 35025 author = {J. S. Pang and S. A. Gabriel}, 35026 title = {{NE/SQP}: {A} Robust Algorithm for the Nonlinear Complementarity Problem}, 35027 journal = {Mathematical Programming}, 35028 year = {1993}, 35029 volume = {60}, 35030 pages = {295--338} 35031} 35032 35033@Article{ pang.han.ea:minimization, 35034 author = {J. S. Pang and S.--P. Han and N. Rangaraj}, 35035 title = {Minimization of Locally {L}ipschitzian Functions}, 35036 journal = {SIAM Journal on Optimization}, 35037 year = {1991}, 35038 volume = {1}, 35039 pages = {57--82} 35040} 35041 35042@Article{ pang.qi:nonsmooth, 35043 author = {J. S. Pang and L. Qi}, 35044 title = {Nonsmooth Equations: Motivation and Algorithms}, 35045 journal = {SIAM Journal on Optimization}, 35046 year = {1993}, 35047 volume = {3}, 35048 pages = {443--465} 35049} 35050 35051@Article{ pang.trinkle.ea:complementarity, 35052 author = {J. S. Pang and J. C. Trinkle and G. Lo}, 35053 title = {A Complementarity Approach to a Quasistatic Multi-Rigid-Body Contact Problem}, 35054 journal = {Computational Optimization and Applications}, 35055 volume = {5}, 35056 pages = {97--138}, 35057 year = {1996} 35058} 35059 35060@Article{ pang.trinkle:complementarity, 35061 author = {J. S. Pang and J. C. Trinkle}, 35062 title = {Complementarity Formulations and Existence of Solutions of Multi-Rigid-Body 35063 Contact Problems with {C}oulomb Friction}, 35064 year = {1996}, 35065 journal = {Mathematical Programming}, 35066 volume = {73}, 35067 pages = {199--226} 35068} 35069 35070@TechReport{ pang.wang:embedding, 35071 author = {J. S. Pang and Z. P. Wang}, 35072 title = {Embedding Methods for Variational Inequality and Nonlinear Complementarity 35073 Problems}, 35074 institution = {Department of Mathematical Sciences, The Johns Hopkins University}, 35075 year = {1990}, 35076 address = {Baltimore, Maryland} 35077} 35078 35079@TechReport{ pang.yang:parallel, 35080 author = {J. S. Pang and J. M. Yang}, 35081 title = {Parallel {N}ewton Methods for the Nonlinear Complementarity Problem}, 35082 institution = {Department of Mathematical Sciences, The Johns Hopkins University}, 35083 year = {1987}, 35084 address = {Baltimore, Maryland}, 35085 type = {Manuscript} 35086} 35087 35088@Article{ pang.yu:linearized, 35089 author = {J. S. Pang and C. S. Yu}, 35090 title = {Linearized Simplicial Decomposition Methods for Computing Traffic Equilibria on 35091 Networks}, 35092 journal = {Networks}, 35093 volume = {14}, 35094 pages = {427--438}, 35095 year = {1984} 35096} 35097 35098@Article{ pang:b-differentiable, 35099 author = {J. S. Pang}, 35100 title = {A {B}--Differentiable Equation Based, Globally and Locally Quadratically 35101 Convergent Algorithm for Nonlinear Programs, Complementarity and Variational 35102 Inequality Problems}, 35103 journal = {Mathematical Programming}, 35104 year = {1991}, 35105 volume = {51}, 35106 pages = {101--132} 35107} 35108 35109@InCollection{ pang:complementarity, 35110 author = {J. S. Pang}, 35111 title = {Complementarity Problems}, 35112 booktitle = {Handbook in Global Optimization}, 35113 publisher = {Kluwer Academic Publishers}, 35114 year = {1994}, 35115 editor = {R. Horst and P. Pardalos}, 35116 address = {Boston} 35117} 35118 35119@Article{ pang:convergence, 35120 author = {J. S. Pang}, 35121 title = {On the Convergence of a Basic Iterative Method for the Implicit Complementarity 35122 Problem}, 35123 journal = {Journal of Optimization Theory and Applications}, 35124 year = {1982}, 35125 volume = {37}, 35126 pages = {149--162} 35127} 35128 35129@Article{ pang:convergence*1, 35130 author = {J. S. Pang}, 35131 title = {Convergence of Splitting and {N}ewton Methods for Complementarity Problems: An 35132 Application of some Sensitivity Results}, 35133 journal = {Mathematical Programming}, 35134 year = {1993}, 35135 volume = {58}, 35136 pages = {149--160} 35137} 35138 35139@Article{ pang:inexact, 35140 author = {J. S. Pang}, 35141 title = {Inexact {N}ewton Methods for the Nonlinear Complementarity Problem}, 35142 journal = {Mathematical Programming}, 35143 year = {1986}, 35144 volume = {36}, 35145 pages = {54--71} 35146} 35147 35148@Article{ pang:more, 35149 author = {J. S. Pang}, 35150 title = {More Results on the Convergence of Iterative Methods for the Symmetric Linear 35151 Complementarity Problem}, 35152 journal = {Journal of Optimization Theory and Applications}, 35153 year = {1986}, 35154 volume = {49}, 35155 pages = {107--134} 35156} 35157 35158@Article{ pang:more*1, 35159 author = {J. S. Pang}, 35160 title = {More Results on the Convergence of Iterative Methods for Symmetric Linear 35161 Complementarity Problems}, 35162 journal = {Journal of Optimization Theory and Applications}, 35163 year = {1986}, 35164 volume = {49}, 35165 pages = {107--134} 35166} 35167 35168@Article{ pang:necessary, 35169 author = {J. S. Pang}, 35170 title = {Necessary and Sufficient Conditions for the Convergence of Iterative Methods for 35171 the Linear Complementarity Problem}, 35172 journal = {Journal of Optimization Theory and Applications}, 35173 year = {1984}, 35174 volume = {42}, 35175 pages = {1--17} 35176} 35177 35178@Article{ pang:newtons, 35179 author = {J. S. Pang}, 35180 title = {{N}ewton's Method for {B}--Differentiable Equations}, 35181 journal = {Mathematics of Operations Research}, 35182 year = {1990}, 35183 volume = {15}, 35184 pages = {311--341} 35185} 35186 35187@Article{ pang:posteriori, 35188 author = {J. S. Pang}, 35189 title = {A Posteriori Error Bound for the Linearly--Constrained Variational Inequality 35190 Problem}, 35191 journal = {Mathematics of Operations Research}, 35192 year = {1987}, 35193 volume = {12}, 35194 pages = {474--484} 35195} 35196 35197@Article{ pantoja.mayne:sequential, 35198 author = {J. F. A. D. Pantoja and D. Q. Mayne}, 35199 title = {Sequential Quadratic Programming Algorithm for Discrete Optimal Control Problems 35200 with Control Inequality Constraints}, 35201 journal = {International Journal on Control}, 35202 year = {1991}, 35203 volume = {53}, 35204 pages = {823--836} 35205} 35206 35207@Book{ papadimitriou.steiglitz:combinatorial, 35208 author = {C. H. Papadimitriou and K. Steiglitz}, 35209 title = {Combinatorial Optimization: Algorithms and Complexity}, 35210 year = {1982}, 35211 publisher = {Prentice-Hall, Inc}, 35212 address = {Englewood Cliffs, New Jersey} 35213} 35214 35215@Article{ papanikolau.mackie.ea:investigation, 35216 author = {N. Papanikolaou and T. R. Mackie and C. Meger-Wells and M. Gehring and P. 35217 Reckwerdt}, 35218 title = {Investigation of the convolution method for polyenergetic spectra}, 35219 journal = {Medical Physics}, 35220 year = {1993}, 35221 volume = {20}, 35222 number = {5}, 35223 pages = {1327--1336} 35224} 35225 35226@Article{ parisot:resolution, 35227 author = {G. R. Parisot}, 35228 title = {{R}\'{e}solution Num\'{e}rique Approach\'{e}e du Probl\`{e}me de Programmation 35229 Lin\'{e}aire par Application de la Programmation Logarithmique}, 35230 journal = {Revue Fran\c{c}aise Recherche Op\'{e}rationnelle}, 35231 year = {1961}, 35232 volume = {20}, 35233 pages = {227--259} 35234} 35235 35236@Article{ parker.cave.ea:comparison, 35237 author = {L. R. Parker and M. R. Cave and R. M. Barnes}, 35238 title = {Comparison of Simplex Algorithms}, 35239 journal = {Analytica Chimica Acta}, 35240 year = {1985}, 35241 volume = {175}, 35242 pages = {231--237} 35243} 35244 35245@InProceedings{ parker:optimal, 35246 author = {D. Parker}, 35247 title = {Optimal Algorithms for Adaptive Networks: Second Order Direct Propagation, and 35248 Second Order Hebbian Learning}, 35249 booktitle = {Proceedings of the IEEE First International Conference on Neural Networks: Volume 35250 II}, 35251 year = {1987}, 35252 address = {San Diego:IEEE}, 35253 pages = {593--600} 35254} 35255 35256@Book{ pascali.sburlan:nonlinear, 35257 author = {D. Pascali and S. Sburlan}, 35258 title = {Nonlinear Mappings of Monotone Type}, 35259 publisher = {Editura Academeie}, 35260 year = {1978} 35261} 35262 35263@Article{ passty:ergodic, 35264 author = {G. B. Passty}, 35265 title = {Ergodic convergence to a zero of the sum of monotone operators in {H}ilbert 35266 space}, 35267 journal = {Journal of Mathematical Analysis and Applications}, 35268 year = {1979}, 35269 volume = {72}, 35270 pages = {383--390} 35271} 35272 35273@Article{ peaceman.rachford:numerical, 35274 author = {D. W. Peaceman and H. H. Rachford}, 35275 title = {The numerical solution of parabolic and elliptic differential equations}, 35276 journal = {SIAM Journal}, 35277 year = {1955}, 35278 volume = {3}, 35279 pages = {28--41} 35280} 35281 35282@Book{ peck.tiesberg:global, 35283 author = {S. Peck and T. Tiesberg}, 35284 title = {Global Warming Uncertainties and the Value of Information: An Analysis Using 35285 {CETA}}, 35286 publisher = {The Electric Power Institute}, 35287 year = {1992}, 35288 address = {Paolo Alto CA} 35289} 35290 35291@TechReport{ peng:convexity, 35292 author = {J. -M. Peng}, 35293 title = {The Convexity of the Implicit {L}agrangian}, 35294 institution = {State Key Laboratory of Scientific and Engineering Computing, Academic Sinica}, 35295 year = {1995}, 35296 type = {Technical Report}, 35297 address = {Beijing} 35298} 35299 35300@Article{ peng:equivalence, 35301 author = {J. -M. Peng}, 35302 title = {Equivalence of Variational Inequality Problems to Unconstrained Optimization}, 35303 journal = {Mathematical Programming}, 35304 year = {1997}, 35305 volume = {78}, 35306 pages = {347--356} 35307} 35308 35309@Article{ pennisi:taking, 35310 author = {E. Pennisi}, 35311 title = {Taking a structured approach to understanding proteins}, 35312 journal = {Science}, 35313 year = {1998}, 35314 volume = {279}, 35315 pages = {978--979} 35316} 35317 35318@Article{ penot:regularity, 35319 author = {J. P. Penot}, 35320 title = {On regularity conditions in mathematical programming}, 35321 journal = {Mathematical Programming Study}, 35322 year = {1982}, 35323 volume = {17}, 35324 pages = {28--66} 35325} 35326 35327@Book{ perez:principles, 35328 author = {C. A. Perez and L. W. Brady}, 35329 title = {Principles and practice of radiotherapy}, 35330 publisher = {Lippincott-Raven}, 35331 year = {1998}, 35332 address = {Philadelphia}, 35333 edition = {3rd} 35334} 35335 35336@Article{ perroni.rutherford:international, 35337 author = {C. Perroni and T. Rutherford}, 35338 title = {International Trade in Carbon Emission Rights and Basic Materials: General 35339 Equilibrium Calculations for 2020}, 35340 journal = {Scandinavian Journal of Economics}, 35341 year = {1993} 35342} 35343 35344@Article{ perroni.rutherford:regular, 35345 author = {C. Perroni and T. Rutherford}, 35346 title = {Regular Flexibility of Nested {CES} Functions}, 35347 journal = {European Economic Review}, 35348 year = {1995}, 35349 volume = {39}, 35350 pages = {335--343} 35351} 35352 35353@InCollection{ perroni.wigle:environmental, 35354 author = {C. Perroni and R. M. Wigle}, 35355 title = {Environmental Policy Modeling}, 35356 booktitle = {Global Trade Analysis: Modeling and Applications}, 35357 publisher = {Cambridge University Press}, 35358 year = {1996}, 35359 editor = {T. Hertel} 35360} 35361 35362@Article{ peterson:review, 35363 author = {D. W. Peterson}, 35364 title = {A Review of Constraint Qualifications in Finite--Dimensional Spaces}, 35365 journal = {SIAM Review}, 35366 year = {1973}, 35367 volume = {15}, 35368 pages = {639--654} 35369} 35370 35371@PhDThesis{ petersson:optimization, 35372 author = {J. Petersson}, 35373 title = {Optimization of Structures in Unilateral Contact}, 35374 type = {{L}ink{\"o}ping Studies in Science and Technology, Dissertations}, 35375 number = {397}, 35376 school = {Division of Mechanics, Department of Mechanical Engineering, Link{\"o}ping 35377 University}, 35378 address = {Link{\"o}ping, Sweden}, 35379 year = {1995} 35380} 35381 35382@Book{ petri:modelling, 35383 author = {P. Petri}, 35384 title = {Modelling {J}apanese--{A}merican Trade, {A} Study of Asymmetric Interdependence}, 35385 publisher = {Harvard University Press}, 35386 year = {1984} 35387} 35388 35389@InProceedings{ petrzykowski:application, 35390 author = {T. Petrzykowski}, 35391 title = {Application of the Steepest Ascent Method to Concave Programming}, 35392 booktitle = {Proceedings of the {IFIPS} Congress, Munich, 1962}, 35393 year = {1962}, 35394 publisher = {North--Holland}, 35395 address = {Amsterdam}, 35396 pages = {185--189} 35397} 35398 35399@InProceedings{ pettey.leuze.ea:parallel, 35400 crossref = {grefenstette:genetic}, 35401 author = {C. C. Pettey and M. R. Leuze and J. J. Grefenstette}, 35402 title = {A Parallel Genetic Algorithm}, 35403 pages = {155--161} 35404} 35405 35406@InProceedings{ pettey.leuze:theoretical, 35407 crossref = {schaeffer:third}, 35408 author = {C. C. Pettey and M. R. Leuze}, 35409 title = {A Theoretical Investigation of a Parallel Genetic Algorithm}, 35410 pages = {398--405} 35411} 35412 35413@Book{ pfeiffer.glocker:multibody, 35414 author = {F. Pfeiffer and C. Glocker}, 35415 title = {Multibody Dynamics with Unilateral Contact}, 35416 year = {1996}, 35417 publisher = {John Wiley \& Sons} 35418} 35419 35420@TechReport{ pierro.iusem:convergence, 35421 author = {A. R. de Pierro and A. N. Iusem}, 35422 title = {Convergence Properties of Iterative Methods for Symmetric Positive Semidefinite 35423 Linear Complementarity Problems}, 35424 institution = {Instituto de Matematica, Elasticita e Ciencia da Computacao}, 35425 year = {1990}, 35426 address = {Universidade Estadual de Campinas, CP 6065, Campinas, 13081, SP, Brazil} 35427} 35428 35429@InCollection{ pillo.grippo.ea:class, 35430 author = {G. Di Pillo and L. Grippo and F. Lampariello}, 35431 title = {A Class of Methods for the Solution of Optimization Problems with Inequalities}, 35432 booktitle = {System Modelling and Optimization}, 35433 year = {1981}, 35434 editor = {R. F. Drenick and F. Kozin}, 35435 publisher = {Springer-Verlag}, 35436 address = {Berlin} 35437} 35438 35439@Article{ pillo.grippo:augmented, 35440 author = {G. Di Pillo and L. Grippo}, 35441 title = {An Augmented {L}agrangian for Inequality Constraints in Nonlinear Programming 35442 Problems}, 35443 journal = {Journal of Optimization Theory and Applications}, 35444 year = {1982}, 35445 volume = {36}, 35446 pages = {495--519} 35447} 35448 35449@Article{ pillo.grippo:class, 35450 author = {G. Di Pillo and L. Grippo}, 35451 title = {A New Class of Augmented {L}agrangians in Nonlinear Programming}, 35452 journal = {SIAM Journal on Control and Optimization}, 35453 year = {1979}, 35454 volume = {17}, 35455 pages = {618--628} 35456} 35457 35458@Article{ pillo.grippo:continuously, 35459 author = {G. Di Pillo and L. Grippo}, 35460 title = {A Continuously Differentiable Exact Penalty Function for Nonlinear Programming 35461 Problems with Inequality Constraints}, 35462 journal = {SIAM Journal on Control and Optimization}, 35463 year = {1985}, 35464 volume = {23}, 35465 pages = {72--84} 35466} 35467 35468@Article{ pillo.grippo:exact, 35469 author = {G. Di Pillo and L. Grippo}, 35470 title = {An Exact Penalty Method with Global Convergence Properties for Nonlinear 35471 Programming Problems}, 35472 journal = {Mathematical Programming}, 35473 year = {1986}, 35474 volume = {36}, 35475 pages = {1--18} 35476} 35477 35478@InProceedings{ plambeck.fu.ea:throughput, 35479 author = {E. L. Plambeck and B. --R. Fu and S.M. Robinson and R. Suri}, 35480 title = {Throughput Optimization in Tandem Production Lines via Nonsmooth Programming}, 35481 booktitle = {Proceedings of the 1993 Summer Computer Simulation Conference}, 35482 editor = {J. Schoen}, 35483 year = {1993}, 35484 publisher = {Society for Computer Simulation}, 35485 address = {San Diego, CA}, 35486 pages = {70--75} 35487} 35488 35489@Article{ plambeck.fu.ea:sample-path, 35490 author = {E. L. Plambeck and B. --R. Fu and S.M. Robinson and R. Suri}, 35491 title = {Sample-Path Optimization of Convex Stochastic Performance Functions}, 35492 journal = {Mathematical Programming}, 35493 year = {1996}, 35494 volume = {75}, 35495 pages = {137--176} 35496} 35497 35498@InProceedings{ platt:sequential, 35499 author = {J. Platt}, 35500 title = {Sequential Minimal Optimization: A Fast Algorithm for Training Support Vector 35501 Machines}, 35502 editor = {Bernhard {Sch\"olkopf} and Christopher J. C. Burges and Alexander J. Smola}, 35503 booktitle = {Advances in Kernel Methods {-} Support Vector Learning}, 35504 publisher = {MIT Press}, 35505 pages = {185-208}, 35506 year = {1999} 35507} 35508 35509@Book{ poincare:sur, 35510 author = {H. Poincar\'{e}}, 35511 title = {Sur les Courbes {D}\'{e}fin\'{e}es par une \'{E}quation Differentielle {I}}, 35512 year = {1881}, 35513 publisher = {Oeuvres I}, 35514 address = {Gauthier--Villars, Paris} 35515} 35516 35517@Article{ polak.ribiere:note, 35518 author = {E. Polak and G. Ribi\`{e}re}, 35519 title = {Note sur la convergence de m\'{e}thodes de directions conjug\'{e}es}, 35520 journal = {Revue Francaise Informatique et Recherche Op\'{e}rationelle}, 35521 year = {1969}, 35522 volume = {16-R1}, 35523 pages = {35--43} 35524} 35525 35526@Book{ polak:computational, 35527 author = {E. Polak}, 35528 title = {Computational Methods in Optimization; {A} Unified Approach}, 35529 year = {1971}, 35530 publisher = {Academic Press}, 35531 address = {New York} 35532} 35533 35534@Article{ polak:global, 35535 author = {E. Polak}, 35536 title = {On the Global Stabilization of Locally Convergent Algorithms}, 35537 journal = {Automatica}, 35538 year = {1976}, 35539 volume = {12}, 35540 pages = {337--349} 35541} 35542 35543@Article{ polyak.tretiyakov:concerning, 35544 author = {B. T. Polyak and N. V. Tretiyakov}, 35545 title = {Concerning an Iterative Method for Linear Programming and its Economic 35546 Interpretation}, 35547 journal = {Economics and Mathematical Methods}, 35548 year = {1972}, 35549 volume = {8}, 35550 pages = {740--751}, 35551 note = {(Russian)} 35552} 35553 35554@Article{ polyak.tretiyakov:method, 35555 author = {B. T. Polyak and N. V. Tretiyakov}, 35556 title = {The Method of Penalty Estimates for Conditional Extremeum Problems}, 35557 journal = {U.S.S.R. Computational Mathematics and Mathematical Physics}, 35558 year = {1973}, 35559 volume = {13}, 35560 pages = {42--58} 35561} 35562 35563@Article{ polyak:conjugate, 35564 author = {B. T. Polyak}, 35565 title = {The conjugate gradient method in extremal problems}, 35566 journal = {USSR Computational Mathematics and Mathematical Physics}, 35567 year = {1969}, 35568 volume = {9}, 35569 pages = {94--112}, 35570 note = {Translated from Russian} 35571} 35572 35573@Book{ polyak:introduction, 35574 author = {B. T. Polyak}, 35575 title = {Introduction to Optimization}, 35576 year = {1987}, 35577 publisher = {Optimization Software, Inc.}, 35578 address = {Publications Division, New York} 35579} 35580 35581@Unpublished{ polyak:methods, 35582 author = {R. A. Polyak}, 35583 title = {On the Methods of Centers}, 35584 year = {1988}, 35585 note = {Unpublished manuscript} 35586} 35587 35588@Unpublished{ polyak:sharp, 35589 author = {B. T. Polyak}, 35590 title = {Sharp Minima}, 35591 year = {1979}, 35592 note = {A Talk given at the {IIASA} Workshop on Generalized {L}agrangians and their 35593 Applications, {IIASA}, Laxenburg, Austria} 35594} 35595 35596@InProceedings{ polyak:smooth, 35597 author = {R. A. Polyak}, 35598 title = {Smooth Optimization Methods for Solving Nonlinear Extremal and Equilibrium 35599 Problems with Constraints}, 35600 booktitle = {Abstracts of the Papers of the 11th International Symposium on Mathematical 35601 Programming}, 35602 year = {1982}, 35603 address = {Bonn} 35604} 35605 35606@Article{ polychronopoulos.tsitsiklis:analysis, 35607 author = {G. H. Polychronopoulos and J. N. Tsitsiklis}, 35608 title = {Stochastic Shortest Path Problems with Recourse}, 35609 journal = {Networks}, 35610 year = {1996}, 35611 volume = {27}, 35612 pages = {133--143} 35613} 35614 35615@TechReport{ potra.bonnans:infeasible, 35616 author = {F. A. Potra and J. F. Bonnans}, 35617 title = {Infeasible path following algorithms for linear complementarity problems}, 35618 institution = {INRIA}, 35619 year = {1994}, 35620 month = dec, 35621 number = {RR--2445}, 35622 type = {Research Report} 35623} 35624 35625@Article{ potra.sheng:large-step, 35626 author = {F. A. Potra and R. Sheng}, 35627 title = {A Large--Step Infeasible--Interior--Point Method for the ${P}_*$--Matrix {LCP}}, 35628 year = {1997}, 35629 journal = {SIAM Journal on Optimization}, 35630 volume = {7}, 35631 pages = {318--335} 35632} 35633 35634@Article{ potra:infeasible, 35635 author = {F. A. Potra}, 35636 title = {An infeasible interior-point predictor-corrector algorithm for linear 35637 programming}, 35638 journal = {SIAM Journal on Optimization}, 35639 year = {1996}, 35640 volume = {6}, 35641 pages = {19--32} 35642} 35643 35644@TechReport{ potra:onl, 35645 author = {F. A. Potra}, 35646 title = {An ${O}(n{L})$ infeasible--interior--point algorithm for {LCP} with quadratic 35647 convergence.}, 35648 institution = {Department of Mathematics, The University of Iowa}, 35649 address = {Iowa City, Iowa}, 35650 year = {1994}, 35651 number = {50}, 35652 type = {Reports on Computational Mathematics} 35653} 35654 35655@TechReport{ potra:predictor-corrector, 35656 author = {F. A. Potra}, 35657 title = {On a predictor-corrector method for solving linear programs from infeasible 35658 starting points}, 35659 institution = {Department of Mathematics, University of Iowa}, 35660 address = {Iowa City, Iowa}, 35661 year = {1992}, 35662 number = {34}, 35663 type = {Reports on Computational Mathematics} 35664} 35665 35666@TechReport{ potra:quadratically, 35667 author = {F. A. Potra}, 35668 title = {A quadratically convergent infeasible interior-point algorithm for linear 35669 programming}, 35670 institution = {Department of Mathematics, University of Iowa}, 35671 year = {1992}, 35672 number = {28}, 35673 address = {Iowa City, Iowa}, 35674 month = jul 35675} 35676 35677@InCollection{ powell:convergence, 35678 author = {M. J. D. Powell}, 35679 title = {The Convergence of Variable Metric Methods for Nonlinearly Constrained 35680 Optimization Calculations}, 35681 crossref = {mangasarian.meyer.ea:nonlinear*3}, 35682 pages = {27--63} 35683} 35684 35685@InProceedings{ powell:direct, 35686 author = {M. J. D. Powell}, 35687 title = {A Direct Search Optimization Method that Models the Objective and Constraint 35688 Functions by Linear Interpolation}, 35689 booktitle = {Advances in Optimization and Numerical Analysis, Proceedings of the Sixth 35690 Workshop on Optimization and Numerical Analysis, Oaxaca, Mexico}, 35691 volume = {275}, 35692 year = {1994}, 35693 publisher = {Kluwer Academic Publishers}, 35694 pages = {51--67}, 35695 address = {Dordrecht, The Netherlands} 35696} 35697 35698@Article{ powell:efficient, 35699 author = {M. J. D. Powell}, 35700 title = {An Efficient Method for Finding the Minimum of a Function of Several Variables 35701 without Calculating Derivatives}, 35702 journal = {Computer Journal}, 35703 year = {1964}, 35704 volume = {17}, 35705 pages = {155--162} 35706} 35707 35708@InCollection{ powell:general, 35709 author = {M. J. D. Powell}, 35710 title = {General Algorithm for Discrete Nonlinear Approximation Calculations}, 35711 booktitle = {Approximation Theory IV}, 35712 year = {1983}, 35713 editor = {L. L. Schumaker C. K. Chui and J. D. Ward}, 35714 publisher = {Academic Press}, 35715 address = {New York}, 35716 pages = {187--218} 35717} 35718 35719@InCollection{ powell:hybrid, 35720 author = {M. J. D. Powell}, 35721 title = {A hybrid method for nonlinear equations}, 35722 booktitle = {Numerical Methods for Nonlinear Algebraic Equations}, 35723 publisher = {Gordon and Breach}, 35724 year = {1970}, 35725 editor = {P. Rabinowitz} 35726} 35727 35728@TechReport{ powell:karmarkars, 35729 author = {M. J. D. Powell}, 35730 title = {{K}armarkar's algorithm: a view from nonlinear programming}, 35731 institution = {Department of Applied Mathematics and Theoretical Physics, University of 35732 Cambridge}, 35733 year = {1989}, 35734 month = nov, 35735 address = {Cambridge, CB3 9EW, England} 35736} 35737 35738@InCollection{ powell:method, 35739 author = {M. J. D. Powell}, 35740 title = {A Method for Nonlinear Constraints in Minimization Problems}, 35741 booktitle = {Optimization}, 35742 year = {1969}, 35743 editor = {R. Fletcher}, 35744 publisher = {Academic Press}, 35745 address = {London}, 35746 pages = {283--298} 35747} 35748 35749@Book{ prekopa:stochastic, 35750 author = {A. Pr{\'{e}}kopa}, 35751 title = {Stochastic Programming}, 35752 publisher = {Kluwer Academic Publishers}, 35753 year = {1995}, 35754 address = {Dordrecht, The Netherlands} 35755} 35756 35757@Book{ press.flannery.ea:numerical, 35758 author = {William H. Press and Brian P. Flannery and Saul A. Teukolsky and William T. 35759 Vetterling}, 35760 title = {Numerical Recipes : the Art of Scientific Computing}, 35761 publisher = {Cambridge University Press}, 35762 year = {1988} 35763} 35764 35765@Article{ pruyne.livny:interfacing, 35766 author = {J. Pruyne and M. Livny}, 35767 title = {Interfacing {C}ondor and {PVM} to Harness the Cycles of Workstation Clusters}, 35768 journal = {Journal on Future Generations of Computer Systems}, 35769 volume = {12}, 35770 year = {1996}, 35771 pages = {67--85} 35772} 35773 35774@InCollection{ pruyne.livny:parallel, 35775 author = {J. Pruyne and M. Livny}, 35776 title = {Parallel Processing on Dynamic Resources using {CARMI}}, 35777 booktitle = {Job Scheduling Strategies for Parallel Processing}, 35778 publisher = {Springer-Verlag}, 35779 year = {1995}, 35780 editor = {D. G. Feitelson and L. Rudolph}, 35781 volume = {949}, 35782 series = {Lecture Notes in Computer Science} 35783} 35784 35785@PhDThesis{ pruyne:resource, 35786 author = {J. C. Pruyne}, 35787 title = {Resource Management Services for Parallel Applications}, 35788 school = {University of Wisconsin--Madison}, 35789 year = {1996}, 35790 address = {Madison, Wisconsin} 35791} 35792 35793@Book{ pshenichny.danilin:numerical, 35794 author = {B. N. Pshenichny and Yu. M. Danilin}, 35795 title = {Numerical Methods in Extremal Problems}, 35796 year = {1978}, 35797 publisher = {MIR Publishers}, 35798 address = {Moscow} 35799} 35800 35801@TechReport{ qi.chen:globally, 35802 author = {L. Qi and X. Chen}, 35803 title = {A Globally Convergent Successive Approximation Method for Nonsmooth Equations}, 35804 institution = {School of Mathematics, University of New South Wales}, 35805 year = {1993}, 35806 annote = {revised}, 35807 address = {Sydney} 35808} 35809 35810@Article{ qi.jiang:semismooth, 35811 author = {L. Qi and H. Jiang}, 35812 title = {Semismooth {K}arush--{K}uhn--{T}ucker Equations and Convergence Analysis of 35813 {N}ewton Methods and Quasi--{N}ewton Methods for Solving these Equations}, 35814 journal = {Mathematics of Operations Research}, 35815 volume = {22}, 35816 pages = {301--325}, 35817 year = {1997} 35818} 35819 35820@TechReport{ qi.peng:unconstrained, 35821 author = {H. -D. Qi and J. -M. Peng}, 35822 title = {A New Unconstrained Optimization Approach for Nonlinear Complementarity 35823 Problems}, 35824 institution = {State Key Laboratory of Scientific and Engineering Computing, Academic Sinica}, 35825 year = {1996}, 35826 type = {Technical Report}, 35827 address = {Beijing} 35828} 35829 35830@InCollection{ qi.sun:survey, 35831 author = {L. Qi and D. Sun}, 35832 title = {A Survey of Some Nonsmooth Equations and Smoothing {N}ewton Methods}, 35833 year = {1999}, 35834 editor = {A. Eberhard and B. Glover and R. Hill and D. Ralph}, 35835 booktitle = {Progress in Optimization}, 35836 pages = {121--146}, 35837 series = {Applied Optimization}, 35838 volume = {30}, 35839 publisher = {Kluwer Academic Publishers}, 35840 address = {Dordrecht} 35841} 35842 35843@Article{ qi.sun:nonsmooth, 35844 author = {L. Qi and J. Sun}, 35845 title = {A Nonsmooth Version of {N}ewton's Method}, 35846 journal = {Mathematical Programming}, 35847 year = {1993}, 35848 volume = {58}, 35849 pages = {353--368} 35850} 35851 35852@Article{ qi:convergence, 35853 author = {L. Qi}, 35854 title = {Convergence Analysis of Some Algorithms for Solving Nonsmooth Equations}, 35855 journal = {Mathematics of Operations Research}, 35856 year = {1993}, 35857 volume = {18}, 35858 pages = {227--244} 35859} 35860 35861@TechReport{ qi:regular, 35862 author = {L. Qi}, 35863 title = {Regular pseudo-smooth {NCP} and {BVIP} functions and globally and quadratically 35864 convergent generalized {N}ewton methods for complementarity and variational 35865 inequality problems}, 35866 institution = {School of Mathematics, University of New South Wales}, 35867 year = {1997}, 35868 type = {Applied Mathematics Report}, 35869 number = {AMR 97/14}, 35870 address = {Sydney, Australia} 35871} 35872 35873@Article{ radner:competitive, 35874 author = {R. Radner}, 35875 title = {Competitive Equilibrium under Uncertainty}, 35876 journal = {Econometrica}, 35877 year = {1968}, 35878 volume = {36}, 35879 pages = {31--58} 35880} 35881 35882@Article{ radstrom:embedding, 35883 author = {H. R{\aa}dstr{\"{o}}m}, 35884 title = {An embedding theorem for spaces of convex sets}, 35885 journal = {Proc. Amer. Math. Soc.}, 35886 year = {1952}, 35887 volume = {3}, 35888 pages = {165--169} 35889} 35890 35891@Article{ raghavachari:connections, 35892 author = {M. Raghavachari}, 35893 title = {On Connections between Zero--One Integer Programming and Concave Programming 35894 Under Linear Constraints}, 35895 journal = {Operations Research}, 35896 year = {1969}, 35897 volume = {17}, 35898 pages = {680--684} 35899} 35900 35901@Article{ rajan.burridge.ea:dynamics, 35902 author = {V. T. Rajan and R. Burridge and J. T. Schwartz}, 35903 title = {Dynamics of a rigid body in frictional contact with rigid walls}, 35904 journal = {IEEE International Conference on Robotics and Automation, Raleigh NC}, 35905 month = mar, 35906 year = {1987}, 35907 pages = {671--677} 35908} 35909 35910@Article{ ralph:branching, 35911 author = {D. Ralph}, 35912 title = {On Branching Numbers of Normal Manifolds}, 35913 journal = {Nonlinear Analysis, Theory, Methods and Applications}, 35914 volume = {22}, 35915 pages = {1041--1050}, 35916 year = {1994} 35917} 35918 35919@Article{ ralph:global, 35920 author = {D. Ralph}, 35921 title = {Global Convergence of Damped {N}ewton's Method for Nonsmooth Equations, via the 35922 Path Search}, 35923 journal = {Mathematics of Operations Research}, 35924 year = {1994}, 35925 volume = {19}, 35926 pages = {352--389} 35927} 35928 35929@InProceedings{ ralph:piecewise, 35930 author = {D. Ralph}, 35931 title = {A Piecewise Sequential Quadratic Programming Method for Mathematical Programs 35932 with Linear Complementarity Constraints}, 35933 booktitle = {Proceedings of the Seventh Conference on Computational Techniques and 35934 Applications (CTAC95)}, 35935 year = {1996} 35936} 35937 35938@PhDThesis{ raman:integration, 35939 author = {R. Raman}, 35940 title = {Integration of logic and heuristic knowledge in discrete optimization techniques 35941 for process systems.}, 35942 address = {Pittsburgh, Pennsylvania}, 35943 year = {1993}, 35944 school = {Department of Chemical Engineering, Carnegie Mellon University} 35945} 35946 35947@PhDThesis{ rangaraj:nonsmooth, 35948 author = {Narayan Rangaraj}, 35949 title = {Nonsmooth Optimization: Algorithms and Applications}, 35950 year = {1990}, 35951 address = {Baltimore, MD}, 35952 school = {Department of Mathematical Sciences, The Johns Hopkins University} 35953} 35954 35955@InProceedings{ reckwerdt.mackie.ea:three-dimensional, 35956 author = {P. J. Reckwerdt and T. R. Mackie and J. P. Balog and T. R. McNutt}, 35957 title = {Three-Dimensional Inverse Treatment Optimization for Tomotherapy}, 35958 booktitle = {Proceedings of the XII International Conference on the Use of Computers in 35959 Radiation Therapy, Salt Lake City}, 35960 year = {1997}, 35961 editor = {D. D. Leavitt and G. Starkshall}, 35962 publisher = {Medical Physics Publishing}, 35963 address = {St. Louis, Missouri}, 35964 pages = {420--422} 35965} 35966 35967@Article{ reid:sparsity-exploiting, 35968 author = {J. K. Reid}, 35969 title = {A Sparsity-Exploiting Variant of the {B}artels-{G}olub Decomposition for Linear 35970 Programming Bases}, 35971 journal = {Mathematical Programming}, 35972 year = {1982}, 35973 volume = {24}, 35974 pages = {55--69} 35975} 35976 35977@Book{ reingold.nievergelt.ea:combinatorial, 35978 author = {E. Reingold and J. Nievergelt and N. Deo}, 35979 title = {Combinatorial Algorithms: Theory and Practice}, 35980 publisher = {Prentice-Hall, Inc}, 35981 address = {Englewood Cliffs, New Jersey} 35982} 35983 35984@PhDThesis{ reinoza:degree, 35985 author = {J. A. Reinoza}, 35986 title = {A Degree for Generalized Equations}, 35987 year = {1979}, 35988 address = {Madison, Wisconsin}, 35989 school = {University of Wisconsin} 35990} 35991 35992@Article{ reinoza:solving, 35993 author = {A. Reinoza}, 35994 title = {Solving Generalized Equations via Homotopies}, 35995 journal = {Mathematical Programming}, 35996 year = {1985}, 35997 volume = {31}, 35998 pages = {307--320} 35999} 36000 36001@PhDThesis{ ren:computable, 36002 author = {J. Ren}, 36003 title = {Computable Error Bounds in Mathematical Programming}, 36004 school = {Computer Sciences Department, University of Wisconsin}, 36005 year = {1993}, 36006 address = {Madison, Wisconsin}, 36007 note = {Technical Report 1173} 36008} 36009 36010@Article{ renegar:polynomial-time, 36011 author = {J. Renegar}, 36012 title = {A Polynomial--Time Algorithm, based on {N}ewton's method, for Linear 36013 Programming}, 36014 journal = {Mathematical Programming}, 36015 year = {1988}, 36016 volume = {40}, 36017 pages = {59--94} 36018} 36019 36020@Article{ robbins.monro:stochastic, 36021 author = {H. Robbins and S. Monro}, 36022 title = {A Stochastic Approximation Method}, 36023 journal = {Annals of Mathematical Statistics}, 36024 year = {1951}, 36025 volume = {22}, 36026 pages = {400--407} 36027} 36028 36029@Article{ robinson:analysis, 36030 author = {S. M. Robinson}, 36031 title = {Analysis of Sample-Path Optimization}, 36032 journal = {Mathematics of Operations Research}, 36033 year = {1996}, 36034 volume = {21}, 36035 pages = {513--528} 36036} 36037 36038@InCollection{ robinson:bundle-based, 36039 author = {S. M. Robinson}, 36040 title = {Bundle-Based Decomposition: Conditions for Convergence}, 36041 booktitle = {Analyse Non Lin\'{e}aire}, 36042 year = {1989}, 36043 editor = {H. Attouch and J. P. Aubin and F. Clarke and I. Ekeland}, 36044 publisher = {Gauthier-Villaars}, 36045 address = {Paris}, 36046 pages = {435--447} 36047} 36048 36049@InCollection{ robinson:bundle-based*1, 36050 author = {S. M. Robinson}, 36051 title = {Bundle-Based Decomposition: Description and Preliminary Results}, 36052 booktitle = {System Modeling and Optimization}, 36053 year = {1986}, 36054 editor = {A Pr\'{e}kopa and J. Szelezc\'{a}n and B. Straazicky}, 36055 publisher = {Springer-Verlag}, 36056 address = {Berlin}, 36057 pages = {751--756}, 36058 volume = {84}, 36059 series = {Lecture Notes in Control and Information Sciences} 36060} 36061 36062@Article{ robinson:continuity, 36063 author = {S. M. Robinson}, 36064 title = {Some Continuity Properties of Polyhedral Multifunctions}, 36065 journal = {Mathematical Programming Study}, 36066 year = {1981}, 36067 volume = {14}, 36068 pages = {206--214} 36069} 36070 36071@Article{ robinson:extension, 36072 author = {S. M. Robinson}, 36073 title = {Extension of {N}ewton's Method to Nonlinear Functions with Values in a Cone}, 36074 journal = {Numerische Mathematik}, 36075 year = {1972}, 36076 volume = {19}, 36077 pages = {341--347} 36078} 36079 36080@InCollection{ robinson:generalized, 36081 crossref = {bachem.grotschel.ea:mathematical}, 36082 author = {S. M. Robinson}, 36083 title = {Generalized Equations}, 36084 pages = {346--367} 36085} 36086 36087@Article{ robinson:generalized*1, 36088 author = {S. M. Robinson}, 36089 title = {Generalized Equations and their Solution: {P}art {I}: Basic Theory}, 36090 journal = {Mathematical Programming Study}, 36091 year = {1979}, 36092 volume = {10}, 36093 pages = {128--141} 36094} 36095 36096@InCollection{ robinson:homeomorphism, 36097 author = {S. M. Robinson}, 36098 title = {Homeomorphism Conditions for Normal Maps of Polyhedra}, 36099 booktitle = {Optimization and Nonlinear Analysis}, 36100 year = {1992}, 36101 editor = {A. Ioffe and M. Marcus and S. Reich}, 36102 publisher = {Longman}, 36103 address = {Harlow, Essex, England}, 36104 pages = {240--248}, 36105 series = {Pitman Research Notes in Mathematics Series No. 244} 36106} 36107 36108@Article{ robinson:implicit-function, 36109 author = {S. M. Robinson}, 36110 title = {An Implicit--Function Theorem for a Class of Nonsmooth Functions}, 36111 journal = {Mathematics of Operations Research}, 36112 year = {1991}, 36113 volume = {16}, 36114 pages = {292--309} 36115} 36116 36117@Article{ robinson:local*1, 36118 author = {S. M. Robinson}, 36119 title = {Local Epi--Continuity and Local Optimization}, 36120 journal = {Mathematical Programming}, 36121 year = {1987}, 36122 volume = {37}, 36123 pages = {208--222} 36124} 36125 36126@Article{ robinson:local*2, 36127 author = {S. M. Robinson}, 36128 title = {Local Structure of Feasible Sets in Nonlinear Programming, {P}art~{II}: 36129 Nondegeneracy}, 36130 journal = {Mathematical Programming Study}, 36131 year = {1984}, 36132 volume = {22}, 36133 pages = {217--230} 36134} 36135 36136@Article{ robinson:local*3, 36137 author = {S. M. Robinson}, 36138 title = {Local Structure of Feasible Sets in Nonlinear Programming, {P}art~{III}: 36139 Stability and Sensitivity}, 36140 journal = {Mathematical Programming Study}, 36141 year = {1987}, 36142 volume = {30}, 36143 pages = {45--66} 36144} 36145 36146@Article{ robinson:mathematical, 36147 author = {S. M. Robinson}, 36148 title = {Mathematical Foundations of Nonsmooth Embedding Methods}, 36149 journal = {Mathematical Programming}, 36150 year = {1990}, 36151 volume = {48}, 36152 pages = {221--229} 36153} 36154 36155@Article{ robinson:newtons, 36156 author = {S. M. Robinson}, 36157 title = {{N}ewton's Method for a Class of Nonsmooth Functions}, 36158 journal = {Set Valued Analysis}, 36159 year = {1994}, 36160 volume = {2}, 36161 pages = {291--305} 36162} 36163 36164@Article{ robinson:nonsingularity, 36165 author = {S. M. Robinson}, 36166 title = {Nonsingularity and Symmetry for Linear Normal Maps}, 36167 journal = {Mathematical Programming}, 36168 year = {1993}, 36169 volume = {62}, 36170 pages = {415--425} 36171} 36172 36173@InCollection{ robinson:nonsmooth, 36174 author = {S. M. Robinson}, 36175 title = {Nonsmooth Continuation for Generalized Equations}, 36176 year = {1997}, 36177 pages = {282--291}, 36178 editors = {P. Gritzmann and R. Horst and E. Sachs and R. Tichatschke}, 36179 booktitle = {Recent Advances in Optimization}, 36180 series = {Lecture Notes in Economics and Mathematical Systems}, 36181 volume = {452}, 36182 publisher = {Springer-Verlag}, 36183 address = {Heidelberg} 36184} 36185 36186@Article{ robinson:normal, 36187 author = {S. M. Robinson}, 36188 title = {Normal Maps Induced by Linear Transformations}, 36189 journal = {Mathematics of Operations Research}, 36190 year = {1992}, 36191 volume = {17}, 36192 pages = {691--714} 36193} 36194 36195@Article{ robinson:normed, 36196 author = {S. M. Robinson}, 36197 title = {Normed Convex Processes}, 36198 journal = {Transactions of the American Mathematical Society}, 36199 year = {1972}, 36200 volume = {174}, 36201 pages = {127--140} 36202} 36203 36204@Article{ robinson:reduction, 36205 author = {S. M. Robinson}, 36206 title = {A reduction method for variational inequalities}, 36207 journal = {Mathematical Programming}, 36208 year = {1998}, 36209 volume = {80}, 36210 pages = {161--169} 36211} 36212 36213@Article{ robinson:regularity, 36214 author = {S. M. Robinson}, 36215 title = {Regularity and stability for convex multivalued functions}, 36216 journal = {Mathematics of Operations Research}, 36217 year = {1976}, 36218 volume = {1}, 36219 pages = {130--143} 36220} 36221 36222@Unpublished{ robinson:shadow, 36223 author = {S. M. Robinson}, 36224 title = {Shadow {JUNK} for biblio file}, 36225 year = {1800} 36226} 36227 36228@Article{ robinson:shadow*1, 36229 author = {S. M. Robinson}, 36230 title = {Shadow Prices for Measures of Effectiveness {I}: Linear Model}, 36231 journal = {Operations Research}, 36232 year = {1993}, 36233 volume = {41}, 36234 pages = {518--535} 36235} 36236 36237@Article{ robinson:shadow*2, 36238 author = {S. M. Robinson}, 36239 title = {Shadow Prices for Measures of Effectiveness {II}: General Model}, 36240 journal = {Operations Research}, 36241 year = {1993}, 36242 volume = {41}, 36243 pages = {536--548} 36244} 36245 36246@Unpublished{ robinson:stability, 36247 author = {S. M. Robinson}, 36248 title = {Stability {JUNK} for biblio file}, 36249 year = {1800} 36250} 36251 36252@Article{ robinson:stability*1, 36253 author = {S. M. Robinson}, 36254 title = {Stability theory for systems of inequalities, {P}art {I}: linear systems}, 36255 journal = {SIAM Journal on Numerical Analysis}, 36256 year = {1975}, 36257 volume = {12}, 36258 pages = {754--769} 36259} 36260 36261@Article{ robinson:stability*2, 36262 author = {S. M. Robinson}, 36263 title = {Stability theory for systems of inequalities, {P}art {II}: Differentiable 36264 Nonlinear Systems}, 36265 journal = {SIAM Journal on Numerical Analysis}, 36266 year = {1976}, 36267 volume = {13}, 36268 pages = {497--513} 36269} 36270 36271@Article{ robinson:strongly, 36272 author = {S. M. Robinson}, 36273 title = {Strongly Regular Generalized Equations}, 36274 journal = {Mathematics of Operations Research}, 36275 year = {1980}, 36276 volume = {5}, 36277 pages = {43--62} 36278} 36279 36280@Article{ rockafellar.wets:generalized, 36281 author = {R. T. Rockafellar and R. J.--B. Wets}, 36282 title = {Generalized Linear-Quadratic Problems of Deterministic and Stochastic Optimal 36283 Control in Discrete Time}, 36284 journal = {SIAM Journal on Control and Optimization}, 36285 year = {1990}, 36286 volume = {28}, 36287 pages = {810--822} 36288} 36289 36290@Article{ rockafellar.wets:lagrangian, 36291 author = {R. T. Rockafellar and R. J.--B. Wets}, 36292 title = {A {L}agrangian Finite Generation Technique for Solving Linear-Quadratic Problems 36293 in Stochastic Programming}, 36294 journal = {Mathematical Programming Study}, 36295 year = {1986}, 36296 volume = {28}, 36297 pages = {63--93} 36298} 36299 36300@InCollection{ rockafellar.wets:linear-quadratic, 36301 author = {R. T. Rockafellar and R. J.--B. Wets}, 36302 title = {Linear-Quadratic Programming Problems with Stochastic Penalties: the Finite 36303 Generation Algorithm}, 36304 booktitle = {Stochastic Optimization}, 36305 publisher = {Springer-Verlag}, 36306 year = {1987}, 36307 editor = {V. I. Arkin and A. Shiraer and R. J.--B. Wets}, 36308 series = {Lecture Notes in Control and Information Sciences, IIASA Series No. 81}, 36309 pages = {545--560}, 36310 address = {New York, Berlin} 36311} 36312 36313@Article{ rockafellar.wets:scenarios, 36314 author = {R. T. Rockafellar and R. J.--B. Wets}, 36315 title = {Scenarios and Policy Aggregation in Optimization under Uncertainty}, 36316 journal = {Mathematics of Operations Research}, 36317 year = {1991}, 36318 volume = {10}, 36319 pages = {119--147} 36320} 36321 36322@InProceedings{ rockafellar:applications, 36323 author = {R. T. Rockafellar}, 36324 title = {New Applications of Duality in Convex Programming}, 36325 booktitle = {Proceedings of the Fourth Conference on Probability}, 36326 year = {1971}, 36327 address = {Brasov, Romania} 36328} 36329 36330@Article{ rockafellar:augmented, 36331 author = {R. T. Rockafellar}, 36332 title = {Augmented {L}agrange Multiplier Functions and Duality in Nonconvex Programming}, 36333 journal = {SIAM Journal on Control and Optimization}, 36334 year = {1974}, 36335 volume = {12}, 36336 pages = {268--285} 36337} 36338 36339@Article{ rockafellar:augmented*1, 36340 author = {R. T. Rockafellar}, 36341 title = {Augmented {L}agrangians and Applications of the Proximal Point Algorithm in 36342 Convex Programming}, 36343 journal = {Mathematics of Operations Research}, 36344 year = {1976}, 36345 volume = {1}, 36346 pages = {97--116} 36347} 36348 36349@Article{ rockafellar:characterization, 36350 author = {R. T. Rockafellar}, 36351 title = {Characterization of the subdifferentials of convex functions}, 36352 journal = {Pacific Journal of Mathematics}, 36353 year = {1966}, 36354 volume = {17}, 36355 number = {3}, 36356 pages = {497--510} 36357} 36358 36359@Article{ rockafellar:computational, 36360 author = {R. T. Rockafellar}, 36361 title = {Computational Schemes for Large--Scale Problems in Extended Linear--Quadratic 36362 Programming}, 36363 journal = {Mathematical Programming}, 36364 year = {1990}, 36365 volume = {48}, 36366 pages = {447--474} 36367} 36368 36369@Book{ rockafellar:conjugate, 36370 author = {R. T. Rockafellar}, 36371 title = {Conjugate Duality and Optimization}, 36372 year = {1974}, 36373 publisher = {SIAM}, 36374 address = {Philadelphia, Pennsylvania}, 36375 volume = {16}, 36376 series = {Conference Board of the Mathematical Sciences} 36377} 36378 36379@Book{ rockafellar:convex, 36380 author = {R. T. Rockafellar}, 36381 title = {Convex Analysis}, 36382 year = {1970}, 36383 publisher = {Princeton University Press}, 36384 address = {Princeton, New Jersey} 36385} 36386 36387@Article{ rockafellar:first-, 36388 author = {R. T. Rockafellar}, 36389 title = {First-- and Second--Order Epi--Differentiabilty in Nonlinear Programming}, 36390 journal = {Transactions of the American Mathematical Society}, 36391 year = {1988}, 36392 volume = {307}, 36393 pages = {75--108} 36394} 36395 36396@InProceedings{ rockafellar:generalized, 36397 author = {R. T. Rockafellar}, 36398 title = {A Generalized Approach to Linear-Quadratic Programming}, 36399 booktitle = {Proceedings of the International Conference on Numerical Optimization and 36400 Applications}, 36401 year = {1986}, 36402 pages = {58--66}, 36403 note = {(Xi'an, China)} 36404} 36405 36406@InProceedings{ rockafellar:generalized*1, 36407 crossref = {bachem.grotschel.ea:mathematical}, 36408 author = {R. T. Rockafellar}, 36409 title = {Generalized Subgradients in Mathematical Programming}, 36410 pages = {368--390} 36411} 36412 36413@InCollection{ rockafellar:large-scale, 36414 author = {R. T. Rockafellar}, 36415 title = {Large-Scale Extended Linear-Quadratic Programming and Multistage Optimization}, 36416 booktitle = {Advances in Numerical Partial Differential Equations and Optimization}, 36417 chapter = {15}, 36418 year = {1991}, 36419 editor = {S. Gomez and J. P. Hennart and R. A. Tapia}, 36420 publisher = {SIAM Publications}, 36421 pages = {247--261} 36422} 36423 36424@Article{ rockafellar:linear-quadratic, 36425 author = {R. T. Rockafellar}, 36426 title = {Linear-Quadratic Programming and Optimal Control}, 36427 journal = {SIAM Journal on Control and Optimization}, 36428 year = {1987}, 36429 volume = {25}, 36430 pages = {781--814} 36431} 36432 36433@Article{ rockafellar:maximality, 36434 author = {R. T. Rockafellar}, 36435 title = {On the Maximality of Sums of Nonlinear Monotone Operators}, 36436 journal = {Transactions of the American Mathematical Society}, 36437 year = {1970}, 36438 volume = {149}, 36439 pages = {75--88} 36440} 36441 36442@InCollection{ rockafellar:monotone, 36443 author = {R. T. Rockafellar}, 36444 title = {Monotone Operators and Augmented {L}agrangian Methods in Nonlinear Programming}, 36445 crossref = {mangasarian.meyer.ea:nonlinear*3}, 36446 pages = {1--26} 36447} 36448 36449@Article{ rockafellar:monotone*1, 36450 author = {R. T. Rockafellar}, 36451 title = {Monotone Operators and the Proximal Point Algorithm}, 36452 journal = {SIAM Journal on Control and Optimization}, 36453 year = {1976}, 36454 volume = {14}, 36455 pages = {877--898} 36456} 36457 36458@Article{ rockafellar:multiplier, 36459 author = {R. T. Rockafellar}, 36460 title = {The Multiplier Method of {H}estenes and {P}owell Applied to Convex Programming}, 36461 journal = {Journal of Optimization Theory and Applications}, 36462 year = {1973}, 36463 volume = {12}, 36464 pages = {555--562} 36465} 36466 36467@Article{ rockafellar:multistage, 36468 author = {R. T. Rockafellar}, 36469 title = {Multistage Convex Programming and Discrete-Time Optimal Control}, 36470 journal = {Control and Cybernetics}, 36471 year = {1988}, 36472 volume = {17}, 36473 number = {2-3}, 36474 pages = {225--245} 36475} 36476 36477@Book{ rockafellar:network, 36478 author = {R. T. Rockafellar}, 36479 title = {Network Flows and Monotropic Optimization}, 36480 publisher = {John Wiley}, 36481 year = {1984}, 36482 address = {New York} 36483} 36484 36485@Article{ rodrigues:mixed, 36486 author = {H. C. Rodrigues}, 36487 title = {A mixed variational formulation for shape optimization of solids with contact 36488 conditions}, 36489 journal = {Structural Optimization}, 36490 volume = {6}, 36491 year = {1993}, 36492 pages = {19--28} 36493} 36494 36495@Book{ rodrigues:obstacle, 36496 author = {J. F. Rodrigues}, 36497 title = {Obstacle Problems in Mathematical Physics}, 36498 publisher = {Elsevier Publishing Company}, 36499 address = {Amsterdam}, 36500 year = {1987} 36501} 36502 36503@Book{ roos.terlaky.ea:theory, 36504 author = {C. Roos and T. Terlaky and J.--Ph. Vial}, 36505 title = {Theory and Algorithms for Linear Optimization: An Interior-Point Approach}, 36506 publisher = {John Wiley \& Sons}, 36507 year = {1997}, 36508 address = {Chichester} 36509} 36510 36511@TechReport{ rosa:decomposition, 36512 author = {C. H. Rosa}, 36513 title = {A Decomposition Technique for Equilibrium Programming under Uncertainty}, 36514 institution = {IIASA}, 36515 year = {1996}, 36516 number = {WP-96-013}, 36517 address = {A-2361 Laxenburg, Austria} 36518} 36519 36520@Article{ rosen.lane.ea:treatment, 36521 author = {I. Rosen and R. Lane and S. Morrill and J. Belli}, 36522 title = {Treatment Plan Optimization Using Linear Programming}, 36523 journal = {Medical Physics}, 36524 year = {1990}, 36525 volume = {18}, 36526 number = {2}, 36527 pages = {141--152} 36528} 36529 36530@TechReport{ rosenblatt:perceptron-a, 36531 author = {F. Rosenblatt}, 36532 title = {The perceptron--a perceiving and recognizing automaton}, 36533 institution = {Cornell Aeronautical Laboratory}, 36534 year = {1957}, 36535 month = jan, 36536 address = {Ithaca, New York}, 36537 number = {85-460-1} 36538} 36539 36540@Book{ rosenblatt:principles, 36541 author = {F. Rosenblatt}, 36542 title = {Principles of Neurodynamics}, 36543 year = {1962}, 36544 publisher = {Spartan Books}, 36545 address = {New York} 36546} 36547 36548@InProceedings{ rosenblatt:two, 36549 author = {F. Rosenblatt}, 36550 title = {Two theorems of statistical separability in the perceptron}, 36551 booktitle = {Proceedings of Symposium Held at National Physical Laboratory, November 1958}, 36552 year = {1959}, 36553 publisher = {{HMS} Stationery Office}, 36554 address = {London}, 36555 volume = {1} 36556} 36557 36558@Article{ rosenbrock:automatic, 36559 author = {H. H. Rosenbrock}, 36560 title = {Automatic Method for Finding the Greatest or Least Value of a Function}, 36561 journal = {Computer Journal}, 36562 year = {1960}, 36563 volume = {3}, 36564 pages = {175--184} 36565} 36566 36567@Article{ roy.mukhopadhyay:pattern, 36568 author = {A. Roy and S. Mukhopadhyay}, 36569 title = {Pattern Classification Using Linear Programming}, 36570 journal = {ORSA Journal on Computing}, 36571 year = {1990}, 36572 volume = {3}, 36573 pages = {66--80} 36574} 36575 36576@Book{ rubinstein:monte, 36577 author = {R. Rubinstein}, 36578 title = {Monte Carlo Optimization, Simulation, and Sensitivity Analysis of Queueing 36579 Networks}, 36580 publisher = {Wiley}, 36581 address = {New York, NY}, 36582 year = {1986} 36583} 36584 36585@Article{ ruchala.olivera.ea:comparison, 36586 author = {K. J. Ruchala and G. H. Olivera and T. R. Mackie}, 36587 title = {A Comparison of Maximum-Likelihood and Iterative Filtered Backprojection 36588 Reconstruction Algorithms for Megavoltage {CT} on a Tomotherapy System}, 36589 journal = {Physics in Medicine and Biology, forthcoming}, 36590 year = {1999} 36591} 36592 36593@Book{ rudin:principles, 36594 author = {W. Rudin}, 36595 title = {Principles of Mathematical Analysis}, 36596 year = {1976}, 36597 publisher = {McGraw--Hill}, 36598 address = {Tokyo, Japan}, 36599 edition = {Third} 36600} 36601 36602@Book{ rudin:real, 36603 author = {W. Rudin}, 36604 title = {Real and Complex Analysis}, 36605 year = {1974}, 36606 publisher = {McGraw--Hill}, 36607 address = {Tokyo, Japan}, 36608 edition = {Second} 36609} 36610 36611@InProceedings{ rumelhart.hinton.ea:learning, 36612 author = {D. E. Rumelhart and G. E. Hinton and R. J. Williams}, 36613 title = {Learning Internal Representations by Error Propagation}, 36614 booktitle = {Parallel Distributed Processing}, 36615 year = {1986}, 36616 editor = {D. E. Rumelhart and J. L. McClelland}, 36617 publisher = {MIT Press}, 36618 address = {Cambridge, Massachusetts}, 36619 pages = {318--362} 36620} 36621 36622@Book{ rumelhart.mcclelland:parallel, 36623 author = {D. E. Rumelhart and J. L. McClelland}, 36624 title = {Parallel Distributed Processing}, 36625 year = {1986}, 36626 publisher = {MIT Press}, 36627 address = {Cambridge, Massachusetts} 36628} 36629 36630@InCollection{ ruszczynski:regularized, 36631 author = {A. Ruszczynski}, 36632 title = {On the Regularized Decomposition for Stochastic Programming Problems}, 36633 year = {1995}, 36634 booktitle = {Stochastic Programming: Numerical Techniques and Engineering Applications}, 36635 editor = {K. Marti and P. Kall}, 36636 publisher = {Springer-Verlag}, 36637 address = {Berlin}, 36638 volume = {425}, 36639 series = {Lecture Notes in Control and Information Sciences}, 36640 pages = {93--108} 36641} 36642 36643@Article{ rutherford.rutstrom.ea:lacord, 36644 author = {T. F. Rutherford and E. E. Rutstrom and D. Tarr}, 36645 title = {{L}'accord de libre-echange entre le {M}aroc et la {CE}: une evaluation 36646 quantitative}, 36647 journal = {Revue d' Economie du developpement}, 36648 year = {1994} 36649} 36650 36651@InCollection{ rutherford.tarr:blueprints, 36652 author = {T. Rutherford and D. Tarr}, 36653 title = {Blueprints, Spillovers and the Dynamic Gains from Trade Liberalization in a Small 36654 Open Economy}, 36655 booktitle = {Dynamic Issues in Applied Commercial Policy Analysis}, 36656 publisher = {Cambridge University Press}, 36657 year = {1997}, 36658 editor = {R. Baldwin and J. Francois}, 36659 address = {New York} 36660} 36661 36662@Article{ rutherford:applied, 36663 author = {T. F. Rutherford}, 36664 title = {Applied General Equilibrium Modeling with {MPSGE} as a {GAMS} Subsystem: An 36665 Overview of the Modeling Framework and Syntax}, 36666 year = {1999}, 36667 volume = {14}, 36668 pages = {1--46}, 36669 journal = {Computational Economics} 36670} 36671 36672@PhDThesis{ rutherford:applied*1, 36673 author = {T. F. Rutherford}, 36674 title = {Applied General Equilibrium Modeling}, 36675 school = {Stanford University}, 36676 year = {1987} 36677} 36678 36679@Article{ rutherford:extensions, 36680 author = {T. F. Rutherford}, 36681 title = {Extensions of {GAMS} for Complementarity Problems Arising in Applied Economic 36682 Analysis}, 36683 journal = {Journal of Economic Dynamics and Control}, 36684 volume = {19}, 36685 pages = {1299--1324}, 36686 year = {1995} 36687} 36688 36689@Misc{ rutherford:gnuplot, 36690 author = {T. F. Rutherford}, 36691 title = {A Libinclude Interface to Gnuplot from {GAMS}}, 36692 organization = {Department of Economics, University of Colorado}, 36693 address = {Boulder, Colorado}, 36694 note = {http://robles.colorado.edu/~tomruth/gnuplot/gnuplot.htm} 36695} 36696 36697@Unpublished{ rutherford:miles, 36698 author = {T. F. Rutherford}, 36699 title = {{MILES}: {A} Mixed Inequality and nonLinear Equation Solver}, 36700 year = {1993}, 36701 note = {Working Paper, Department of Economics, University of Colorado, Boulder} 36702} 36703 36704@TechReport{ rutherford:modeling, 36705 author = {T. F. Rutherford}, 36706 title = {A Modeling System for Applied General Equilibrium Analysis}, 36707 type = {Cowles Foundation Discussion Paper}, 36708 number = {836}, 36709 institution = {Yale University}, 36710 year = {1987} 36711} 36712 36713@TechReport{ rutherford:mpsge, 36714 author = {T. F. Rutherford}, 36715 title = {{MPSGE}}, 36716 institution = {University of Western Ontario}, 36717 year = {1988}, 36718 address = {London, Ontario} 36719} 36720 36721@Article{ rykov:simplex, 36722 author = {A. S. Rykov}, 36723 title = {Simplex Direct Search Algorithms}, 36724 journal = {Automation and Remote Control}, 36725 year = {1980}, 36726 volume = {41}, 36727 pages = {784--793} 36728} 36729 36730@Article{ saad.schultz:gmres, 36731 author = {Y. Saad and M. Schultz}, 36732 title = {{GMRES}: {A} Generalized Minimal Residual Algorithm for Solving Nonsymmetric 36733 Linear Systems}, 36734 journal = {SIAM Journal on Scientific and Statistical Computing}, 36735 year = {1986}, 36736 volume = {44}, 36737 pages = {856--869} 36738} 36739 36740@Book{ saad:iterative, 36741 author = {Y. Saad}, 36742 title = {Iterative Methods for Sparse Linear Systems}, 36743 year = {1996}, 36744 publisher = {PWS Publishing Company}, 36745 address = {Boston, Massachusetts} 36746} 36747 36748@Article{ sahni:approximate, 36749 author = {S. Sahni}, 36750 title = {Approximate Algorithms for the 0/1 Knapsack Problem}, 36751 journal = {jacm}, 36752 year = {1975}, 36753 volume = {22}, 36754 pages = {115--124} 36755} 36756 36757@InProceedings{ sauer.shepard.ea:comparison, 36758 author = {O. A. Sauer and D. M. Shepard and L. Angelos and T. R. Mackie}, 36759 title = {A Comparison of Objective Functions for Use in Radiotherapy Optimization}, 36760 booktitle = {Proceedings of the XII International Conference on the Use of Computers in 36761 Radiation Therapy, Salt Lake City}, 36762 year = {1997}, 36763 editor = {D. D. Leavitt and G. Starkshall}, 36764 publisher = {Medical Physics Publishing}, 36765 address = {St. Louis, Missouri} 36766} 36767 36768@Article{ sauer.xu:multivariate, 36769 author = {Th. Sauer and Y. Xu}, 36770 title = {On Multivariate {L}agrange Interpolation}, 36771 journal = {Mathematics of Computation}, 36772 year = {1995}, 36773 volume = {64}, 36774 pages = {1147--1170} 36775} 36776 36777@Article{ savelsbergh:preprocessing, 36778 author = {M. W. P. Savelsbergh}, 36779 title = {Preprocessing and Probing Techniques for Mixed Integer Programming Problems}, 36780 journal = {ORSA Journal on Computing}, 36781 year = {1994}, 36782 volume = {6}, 36783 pages = {445--454} 36784} 36785 36786@Article{ scarf:approximation, 36787 author = {H. E. Scarf}, 36788 title = {The Approximation of Fixed Points of a Continuous Mapping}, 36789 journal = {SIAM Journal on Applied Mathematics}, 36790 year = {1967}, 36791 volume = {15}, 36792 pages = {1328--1343} 36793} 36794 36795@Book{ scarf:computation, 36796 author = {H. E. Scarf}, 36797 title = {The Computation of Economic Equilibria}, 36798 year = {1973}, 36799 publisher = {Yale University Press}, 36800 address = {New Haven, Connecticut} 36801} 36802 36803@TechReport{ scheel.scholtes:mathematical, 36804 author = {H. Scheel and S. Scholtes}, 36805 title = {Mathematical Programs with Complementarity Constraints: Stationarity, Optimality, 36806 and Sensitivity}, 36807 institution = {Judge Institute of Management Studies, University of Cambridge}, 36808 year = {1998}, 36809 type = {Technical Report}, 36810 address = {Cambridge, England} 36811} 36812 36813@Article{ schlick:modified, 36814 author = {T. Schlick}, 36815 title = {Modified {C}holesky Factorization for Sparse Preconditioners}, 36816 journal = {SIAM Journal on Scientific Computing}, 36817 year = {1993}, 36818 volume = {14}, 36819 pages = {424--445} 36820} 36821 36822@Article{ schnabel.eskow:modified, 36823 author = {R. B. Schnabel and E. Eskow}, 36824 title = {A New Modified {C}holesky Factorization}, 36825 journal = {SIAM Journal on Scientific and Statistical Computing}, 36826 year = {1991}, 36827 volume = {11}, 36828 pages = {1136--1158} 36829} 36830 36831@Article{ schneider.zenios:comparative, 36832 author = {M. H. Schneider and S. A. Zenios}, 36833 title = {A Comparative Study of Algorithms for Matrix Balancing}, 36834 journal = {Operations Research}, 36835 year = {1990}, 36836 volume = {38}, 36837 pages = {439--455} 36838} 36839 36840@Book{ scholkopf.burges.ea:advances, 36841 editor = {B. {Sch\"{o}lkopf} and C. Burges and A. Smola}, 36842 title = {Advances in Kernel Methods: Support Vector Machines}, 36843 publisher = {MIT Press}, 36844 address = {Cambridge, MA }, 36845 year = {1998}, 36846 isbn = {0-262-19416-3} 36847} 36848 36849@Article{ scholtes.stohr:exact, 36850 author = {S. Scholtes and M. St{\"{o}}hr}, 36851 title = {Exact Penalization of Mathematical Programs with Equilibrium Constraints}, 36852 journal = {SIAM Journal on Control and Optimization}, 36853 volume = {37}, 36854 pages = {617--652}, 36855 year = {1999} 36856} 36857 36858@TechReport{ scholtes:introduction, 36859 author = {S. Scholtes}, 36860 title = {Introduction to piecewise differentiable equations}, 36861 institution = {Institut f{\"{u}}r Statistik und Mathematische Wirtschaftstheorie, 36862 Universit{\"{a}}t Karlsruhe}, 36863 year = {1994}, 36864 type = {Preprint}, 36865 number = {No. 53/1994}, 36866 address = {Karlsruhe, Germany} 36867} 36868 36869@Article{ schramm.zowe:version, 36870 author = {H. Schramm and J. Zowe}, 36871 title = {A Version of the Bundle Idea for Minimizing a Nonsmooth Function: Conceptual 36872 Idea, Convergence Analysis, Numerical Results}, 36873 journal = {SIAM Journal on Optimization}, 36874 year = {1992}, 36875 volume = {2}, 36876 pages = {121--152} 36877} 36878 36879@Article{ schultz.meyer:interior, 36880 author = {G. L. Schultz and R. R. Meyer}, 36881 title = {An Interior Point Method for Block Angular Optimization}, 36882 journal = {SIAM Journal on Optimization}, 36883 year = {1991}, 36884 volume = {1}, 36885 pages = {583--602} 36886} 36887 36888@InProceedings{ sekiguchi.sato.ea:ninf, 36889 author = {S. Sekiguchi and M. Sato and S. Matsuoka and U. Nagashima}, 36890 title = {Ninf: Network based Information Library for Globally High Performance Computing}, 36891 booktitle = {Proceedings of the Parallel Object-Oriented Methods and Applications ({POOMA})}, 36892 year = {1996}, 36893 address = {Santa Fe} 36894} 36895 36896@InCollection{ sellami.robinson:homotopies, 36897 author = {H. Sellami and S. M. Robinson}, 36898 title = {Homotopies Based on Nonsmooth Equations for Solving Nonlinear Variational 36899 Inequalities}, 36900 booktitle = {Nonlinear Optimization and Applications}, 36901 editor = {G. Di Pillo and F. Giannessi}, 36902 year = {1996}, 36903 pages = {327--343}, 36904 publisher = {Plenum Press}, 36905 address = {New York} 36906} 36907 36908@Article{ sellami.robinson:implementation, 36909 author = {H. Sellami and S. M. Robinson}, 36910 title = {Implementation of a Continuation Method for Normal Maps}, 36911 journal = {Mathematical Programming}, 36912 year = {1997}, 36913 volume = {76}, 36914 pages = {563--578} 36915} 36916 36917@PhDThesis{ sellami:continuation, 36918 author = {H. Sellami}, 36919 title = {A Continuation Method for Normal Maps}, 36920 school = {University of Wisconsin -- Madison}, 36921 year = {1994}, 36922 address = {Madison, Wisconsin} 36923} 36924 36925@Article{ sellami:homotopy, 36926 author = {H. Sellami}, 36927 title = {A Homotopy Continuation Method for Normal Maps}, 36928 journal = {Mathematical Programming}, 36929 vol = {82}, 36930 year = {1998}, 36931 pages = {317--337} 36932} 36933 36934@Book{ seuss:one, 36935 author = {{Dr.} A. Seuss}, 36936 title = {One Fish, Two Fish, Red Fish, Blue Fish}, 36937 year = {1960}, 36938 publisher = {Beginner Books}, 36939 address = {New York}, 36940 series = {Beginner Books, B13}, 36941 note = {A story--poem about the activities of such unusual animals as the Nook, Wump, 36942 Yink, Yop, Gack, and the Zeds} 36943} 36944 36945@Article{ seyfferth.pfeiffer:dynamics, 36946 author = {W. Seyfferth and F. Pfeiffer}, 36947 title = {Dynamics of Assembly Processes With a Manipulator}, 36948 journal = {Proceedings of the 1992 IEEE/RSJ International Conference on Intelligent Robots 36949 and Systems}, 36950 year = {1992}, 36951 pages = {1303--1310} 36952} 36953 36954@Article{ shanno.simantiraki:infeasible, 36955 author = {D. Shanno and E. Simantiraki}, 36956 title = {An Infeasible Interior--Point Method for Linear Complementarity Problems}, 36957 year = {1997}, 36958 journal = {SIAM Journal on Optimization}, 36959 volume = {7}, 36960 pages = {620--640} 36961} 36962 36963@InProceedings{ shanno.simantiraki:interior, 36964 author = {D. Shanno and E. Simantiraki}, 36965 title = {Interior Point Methods for Linear and Nonlinear Programming}, 36966 booktitle = {State of the Art in Numerical Analysis}, 36967 year = {1997}, 36968 editor = {I. S. Duff and G. A. Watson}, 36969 publisher = {Oxford University Press}, 36970 address = {Oxford} 36971} 36972 36973@Article{ shannon:introduction, 36974 author = {R. E. Shannon}, 36975 title = {Introduction to the Art and Science of simulation}, 36976 journal = {WSC98 1998 Winter simulation conference proceedings}, 36977 year = {1998}, 36978 volume = {1}, 36979 pages = {7--14} 36980} 36981 36982@TechReport{ shapiro:concepts, 36983 author = {A. Shapiro}, 36984 title = {On Concepts of Directional Differentiability}, 36985 institution = {Department of Mathematics and Applied Mathematics, University of South Africa}, 36986 year = {1988}, 36987 address = {Pretoria, South Africa}, 36988 number = {73/88(18)}, 36989 type = {Research Report} 36990} 36991 36992@Book{ shavlik.editors:readings, 36993 author = {J. W. Shavlik and T. G. Dietterich {(editors)}}, 36994 title = {Readings in Machine Learning}, 36995 year = {1990}, 36996 publisher = {Morgan Kaufman}, 36997 address = {San Mateo, California} 36998} 36999 37000@Article{ shavlik.mooney.ea:symbolic, 37001 author = {J. W. Shavlik and R. J. Mooney and G. G. Towell}, 37002 title = {Symbolic and Neural Network Learning Algorithms: An Experimental Comparison}, 37003 journal = {Machine Learning}, 37004 year = {1991}, 37005 volume = {6}, 37006 pages = {111--143} 37007} 37008 37009@Book{ sheffi:urban, 37010 author = {Y. Sheffi}, 37011 title = {Urban Transportation Networks}, 37012 publisher = {Prentice-Hall, Inc}, 37013 year = {1985}, 37014 address = {Englewood Cliffs, New Jersey} 37015} 37016 37017@Article{ sheng.potra:quadratically, 37018 author = {R. Sheng and F. A. Potra}, 37019 title = {A Quadratically {CO}nvergent Infeasible-Interior-Point {AL}gorithm for {LCP} with 37020 Polynomial {CO}mplexity}, 37021 journal = {SIAM Journal on Optimization}, 37022 year = {1997}, 37023 volume = {7}, 37024 pages = {304--317} 37025} 37026 37027@InProceedings{ shepard.angelos.ea:simple, 37028 author = {D. M. Shepard and L. Angelos and O. A. Sauer and T. R. Mackie}, 37029 title = {A Simple Model for Examining Radiotherapy Optimization}, 37030 booktitle = {Proceedings of the XII International Conference on the Use of Computers in 37031 Radiation Therapy, Salt Lake City}, 37032 year = {1997}, 37033 editor = {D. D. Leavitt and G. Starkshall}, 37034 publisher = {Medical Physics Publishing}, 37035 address = {St. Louis, Missouri} 37036} 37037 37038@Article{ shepard.ferris.ea:inverse, 37039 author = {D. M. Shepard and M. C. Ferris and R. Ove and L. Ma}, 37040 title = {Inverse Treatment Planning for Gamma Knife Radiosurgery}, 37041 journal = {Medical Physics}, 37042 volume = {27}, 37043 pages = {12}, 37044 year = {2000}, 37045 key = {93} 37046} 37047 37048@Article{ shepard.ferris.ea:optimizing, 37049 author = {D. M. Shepard and M. C. Ferris and G. Olivera and T. R. Mackie}, 37050 title = {Optimizing the Delivery of Radiation to Cancer Patients}, 37051 journal = {SIAM Review}, 37052 volume = {41}, 37053 pages = {721--744}, 37054 year = {1999}, 37055 url = {ftp://ftp.cs.wisc.edu/math-prog/tech-reports/98-07.ps}, 37056 key = {68}, 37057 institution = {Computer Sciences Department, University of Wisconsin}, 37058 address = {Madison, Wisconsin}, 37059 number = {98-07}, 37060 type = {Mathematical Programming Technical Report} 37061} 37062 37063@Article{ sherali.shetty:finitely, 37064 author = {H. D. Sherali and C. M. Shetty}, 37065 title = {A Finitely Convergent Algorithm for Bilinear Programming Problems using Polar 37066 Cuts and Disjunctive Face Cuts}, 37067 journal = {Mathematical Programming}, 37068 year = {1980}, 37069 volume = {19}, 37070 pages = {14--31} 37071} 37072 37073@Article{ sherali.soyster.ea:stackelberg-nash-cournot, 37074 author = {H. D. Sherali and A. L. Soyster and F. H. Murphy}, 37075 title = {{S}tackelberg--{N}ash--{C}ournot Equilibria: Characterization and Computation}, 37076 journal = {Operations Research}, 37077 year = {1983}, 37078 volume = {31}, 37079 pages = {253--276} 37080} 37081 37082@Article{ shi.olafsson.ea:hybrid, 37083 author = {L. Shi and S. \'{O}lafsson and Q. Chen}, 37084 title = {A New Hybrid Optimization Algorithm}, 37085 journal = {Computers and Industrial Engineering}, 37086 year = {1999}, 37087 volume = {36}, 37088 pages = {409--426} 37089} 37090 37091@PhDThesis{ shiau:iterative, 37092 author = {T.--H. Shiau}, 37093 title = {Iterative Linear Programming for Linear Complementarity and Related Problems}, 37094 school = {Computer Sciences Department, University of Wisconsin}, 37095 year = {1983}, 37096 address = {Madison, Wisconsin}, 37097 note = {Technical Report 507} 37098} 37099 37100@InProceedings{ shor:generalized, 37101 crossref = {bachem.grotschel.ea:mathematical}, 37102 author = {N. Z. Shor}, 37103 title = {Generalized Gradient Methods of Nondifferentiable Optimization Employing Space 37104 Dilation Operations}, 37105 pages = {501--529} 37106} 37107 37108@Book{ shor:minimization, 37109 author = {N. Z. Shor}, 37110 title = {Minimization Methods for Nondifferentiable Functions}, 37111 year = {1985}, 37112 publisher = {Springer-Verlag}, 37113 address = {Berlin} 37114} 37115 37116@Article{ shoven.whalley:applied, 37117 author = {J. Shoven and J. Whalley}, 37118 title = {Applied General Equilibrium Models of Taxation and International Trade: 37119 Introduction and Survey}, 37120 journal = {Journal of Economic Literature}, 37121 year = {1984}, 37122 volume = {22}, 37123 pages = {1007--1051} 37124} 37125 37126@Article{ shultz.meyer:interior, 37127 author = {G. L. Shultz and R. R. Meyer}, 37128 title = {An Interior Point Method for Block Angular Optimization}, 37129 journal = {SIAM Journal on Optimization}, 37130 year = {1991}, 37131 volume = {1}, 37132 pages = {583--602} 37133} 37134 37135@Article{ shultz.schnabel.ea:family, 37136 author = {G. A. Shultz and R. B. Schnabel and R. H. Byrd}, 37137 title = {A Family of Trust--Region--Based Algorithms for Unconstrained Minimization}, 37138 journal = {SIAM Journal on Numerical Analysis}, 37139 year = {1985}, 37140 volume = {22}, 37141 pages = {44--67} 37142} 37143 37144@Article{ sibony:methodes, 37145 author = {M. Sibony}, 37146 title = {Methodes iteratives pur les equations et inequations aux derives partielles 37147 nonlineaires de type monotone}, 37148 journal = {Calcolo}, 37149 year = {1970}, 37150 volume = {7}, 37151 pages = {65--183} 37152} 37153 37154@Article{ sidney:optimal, 37155 author = {J. B. Sidney}, 37156 title = {Optimal Single--Machine Scheduling with Earliness and Tardiness Penalties}, 37157 journal = {Operations Research}, 37158 year = {1977}, 37159 volume = {25}, 37160 pages = {62--69} 37161} 37162 37163@Book{ siegel:corba, 37164 author = {J. Siegel}, 37165 title = {{CORBA} - Fundamentals and Programming}, 37166 publisher = {John Wiley \& Sons}, 37167 year = {1996}, 37168 address = {New York, New York} 37169} 37170 37171@TechReport{ simantiraki.shanno:infeasible-interior-point, 37172 author = {E. Simantiraki and D. F. Shanno}, 37173 title = {An infeasible-interior-point algorithm for linear complementarity problems}, 37174 type = {Research Report}, 37175 number = {7-95}, 37176 institution = {Rutgers Center for Operations Research, Rutgers University}, 37177 address = {New Brunswick, New Jersey}, 37178 year = {1995} 37179} 37180 37181@InProceedings{ simantiraki.shanno:infeasible-interior-point*1, 37182 author = {E. Simantiraki and D. F. Shanno}, 37183 title = {An Infeasible-Interior-Point Algorithm for Solving Mixed Complementarity 37184 Problems}, 37185 crossref = {ferris.pang:complementarity}, 37186 pages = {386--404} 37187} 37188 37189@Book{ simpson:artificial, 37190 author = {P. K. Simpson}, 37191 title = {Artificial Neural Systems}, 37192 year = {1990}, 37193 publisher = {Pergamon Press}, 37194 address = {New York} 37195} 37196 37197@Article{ smeers:computable, 37198 author = {Y. Smeers}, 37199 title = {Computable Equilibrium Models and the Restructuring of the {E}uropean Electricity 37200 and Gas Markets}, 37201 journal = {The Energy Journal}, 37202 year = {1997}, 37203 optkey = {}, 37204 optvolume = {18}, 37205 optnumber = {}, 37206 optmonth = {}, 37207 optpages = {1--32}, 37208 optnote = {}, 37209 optannote = {} 37210} 37211 37212@Article{ smith:design, 37213 author = {F. W. Smith}, 37214 title = {Design of Multicategory Pattern Classifiers with Two-Category Classifier Design 37215 Procedures}, 37216 journal = {IEEE Transactions on Computers}, 37217 year = {1969}, 37218 volume = {18}, 37219 pages = {367--372} 37220} 37221 37222@Article{ smith:existence, 37223 author = {M. J. Smith}, 37224 title = {The Existence, Uniqueness and Stability of Traffic Equilibria}, 37225 journal = {Transportation Research}, 37226 year = {1979}, 37227 volume = {13B}, 37228 pages = {295--304} 37229} 37230 37231@Article{ smith:existence*1, 37232 author = {M. J. Smith}, 37233 title = {The existence and calculation of traffic equilibria}, 37234 journal = {Transportation Research}, 37235 volume = {17B}, 37236 year = {1983}, 37237 pages = {291--303} 37238} 37239 37240@Article{ smith:pattern, 37241 author = {F. W. Smith}, 37242 title = {Pattern Classifier Design by Linear Programming}, 37243 journal = {IEEE Transactions on Computers}, 37244 year = {1968}, 37245 volume = {C-17}, 37246 pages = {367--372} 37247} 37248 37249@Article{ solodov.svaiter:projection, 37250 author = {M. V. Solodov and B. F. Svaiter}, 37251 title = {A New Projection Method for Variational Inequality Problems}, 37252 journal = {SIAM Journal on Control and Optimization}, 37253 volume = {37}, 37254 pages = {765--776}, 37255 year = {1999} 37256} 37257 37258@Article{ solodov.tseng:modified, 37259 author = {M. V. Solodov and P. Tseng}, 37260 title = {Modified Projection--Type Methods for Monotone Variational Inequalities}, 37261 year = {1996}, 37262 journal = {SIAM Journal on Control and Optimization}, 37263 pages = {1814--1830}, 37264 volume = {34} 37265} 37266 37267@Article{ solodov:stationary, 37268 author = {M. V. Solodov}, 37269 title = {Stationary Points of Bound Constrained Minimization Reformulations of 37270 Complementarity Problems}, 37271 journal = {Journal of Optimization Theory and Applications, forthcoming}, 37272 year = {1997} 37273} 37274 37275@Article{ spendley.hext.ea:sequential, 37276 author = {W. Spendley and G. R. Hext and F. R. Himsworth}, 37277 title = {Sequential Application of Simplex Designs in Optimization and Evolutionary 37278 Operation}, 37279 journal = {Technometrics}, 37280 year = {1962}, 37281 pages = {441--461}, 37282 volume = {4} 37283} 37284 37285@Article{ spingarn:applications, 37286 author = {J. E. Spingarn}, 37287 title = {Applications of the Method of Partial Inverses to Convex Programming}, 37288 journal = {Mathematical Programming}, 37289 year = {1985}, 37290 volume = {32}, 37291 pages = {199--223} 37292} 37293 37294@Book{ srinivasan.whalley:general, 37295 author = {T. Srinivasan and J. Whalley}, 37296 title = {General Equilibrium Trade Policy Modelling}, 37297 publisher = {MIT Press}, 37298 year = {1986}, 37299 address = {Boston} 37300} 37301 37302@Book{ stackelberg:theory, 37303 author = {H. Van Stackelberg}, 37304 title = {The Theory of Market Economy}, 37305 publisher = {Oxford University Press}, 37306 year = {1952} 37307} 37308 37309@Article{ stavroulakis.panagiotopoulos.ea:rigid, 37310 author = {G. E. Stavroulakis and P. D. Panagiotopoulos and A. M. Al-Fahed}, 37311 title = {On the Rigid Body Displacements and Rotations in Unilateral Contact Problems and 37312 Applications}, 37313 journal = {Computers \& Structures}, 37314 volume = {40}, 37315 year = {1991}, 37316 pages = {599--614} 37317} 37318 37319@Article{ stavroulakis:optimal, 37320 author = {G. E. Stavroulakis}, 37321 title = {Optimal prestress of cracked unilateral structures: finite element analysis of an 37322 optimal control problem for variational inequalities}, 37323 journal = {Computer Methods in Applied Mechanics and Engineering, forthcoming}, 37324 year = {1996} 37325} 37326 37327@Article{ stavroulakis:optimal*1, 37328 author = {G. E. Stavroulakis}, 37329 title = {Optimal prestress of structures with frictional unilateral contact interfaces}, 37330 journal = {Archives of Applied Mechanics, forthcoming}, 37331 year = {1996} 37332} 37333 37334@Book{ steenbrink:optimization, 37335 author = {P. A. Steenbrink}, 37336 title = {Optimization of Transport Networks}, 37337 publisher = {John Wiley \& Sons}, 37338 address = {London, England}, 37339 year = {1974} 37340} 37341 37342@Article{ stephens:asymptotic, 37343 author = {M. A. Stephens}, 37344 title = {Asymptotic Results for Goodness-of-Fit Statistics with Unknown Parameters}, 37345 journal = {Annals of Statistics}, 37346 year = {1976}, 37347 volume = {4}, 37348 pages = {357--369} 37349} 37350 37351@Article{ stephens:edf, 37352 author = {M. A. Stephens}, 37353 title = {{EDF} Statistics for Goodness of Fit and Some Comparisons}, 37354 journal = {Journal of the American Statistical Association}, 37355 year = {1974}, 37356 volume = {69}, 37357 pages = {730--737} 37358} 37359 37360@Article{ stevens:location, 37361 author = {B. H. Stevens}, 37362 title = {Location Theory and Programming Models: The Von Th{\"{u}}nen case}, 37363 journal = {Papers of the Regional Science Association}, 37364 year = {1968}, 37365 volume = {21}, 37366 pages = {19--34} 37367} 37368 37369@Article{ stewart.trinkle:implicit, 37370 author = {D. E. Stewart and J. C. Trinkle}, 37371 title = {An Implicit Time-Stepping Scheme for Rigid Body Dynamics with Inelastic 37372 Collisions and {C}oulomb Friction}, 37373 journal = {International Journal for Numerical Methods in Engineering}, 37374 year = {1996}, 37375 volume = {39}, 37376 pages = {2673--2691} 37377} 37378 37379@Book{ stoer.bulirsch:introduction, 37380 author = {J. Stoer and R. Bulirsch}, 37381 title = {Introduction to Numerical Analysis}, 37382 year = {1980}, 37383 publisher = {Springer-Verlag}, 37384 address = {New York} 37385} 37386 37387@Article{ stoer:complexity, 37388 author = {J. Stoer}, 37389 title = {The complexity of an infeasible interior--point path--following method for the 37390 solution of linear programs}, 37391 journal = {Optimization Methods and Software}, 37392 year = {1994}, 37393 volume = {3}, 37394 pages = {1--12} 37395} 37396 37397@Article{ stone:cross-validatory, 37398 author = {M. Stone}, 37399 title = {Cross-validatory choice and assessment of statistical predictions}, 37400 journal = {Journal of the Royal Statistical Society}, 37401 year = {1974}, 37402 volume = {36}, 37403 pages = {111--147} 37404} 37405 37406@Article{ stone.smith.ea:inverse, 37407 author = {R. A. Stone and V. Smith and L. Verhey}, 37408 title = {Inverse Planning for the {G}amma {K}nife}, 37409 journal = {Medical Physics}, 37410 year = {1993}, 37411 volume = {20}, 37412 pages = {865} 37413} 37414 37415@Book{ strang:linear, 37416 author = {G. Strang}, 37417 title = {Linear Algebra and its Applications}, 37418 year = {1980}, 37419 publisher = {Academic Press}, 37420 address = {New York}, 37421 edition = {Second} 37422} 37423 37424@InProceedings{ street.wolberg.ea:nuclear, 37425 author = {W. N. Street and W. H. Wolberg and O. L. Mangasarian}, 37426 title = {Nuclear Feature Extraction for Breast Tumor Diagnosis}, 37427 booktitle = {Biomedical Image Processing and Biomedical Visualization}, 37428 year = {1993}, 37429 publisher = {SPIE--The International Society for Optical Engineering}, 37430 address = {San Jose, California}, 37431 pages = {861--870}, 37432 volume = {1905} 37433} 37434 37435@Article{ subramanian:gauss-newton, 37436 author = {P. K. Subramanian}, 37437 title = {Gauss--{N}ewton Methods for the Complementarity Problem}, 37438 journal = {Journal of Optimization Theory and Applications}, 37439 year = {1993}, 37440 volume = {77}, 37441 pages = {467--482} 37442} 37443 37444@PhDThesis{ subramanian:iterative, 37445 author = {P. K. Subramanian}, 37446 title = {Iterative Methods of Solution for Complementarity Problems}, 37447 year = {1985}, 37448 address = {Madison, Wisconsin}, 37449 school = {Computer Sciences Department, University of Wisconsin} 37450} 37451 37452@TechReport{ subramanian:note, 37453 author = {P. K. Subramanian}, 37454 title = {A Note on Least Two Norm Solutions of Monotone Complementarity Problems}, 37455 institution = {Mathematics Research Center, University of Wisconsin--Madison}, 37456 year = {1985}, 37457 address = {Madison, Wisconsin}, 37458 number = {2844}, 37459 type = {Technical Summary Report} 37460} 37461 37462@TechReport{ suh.gucht:distributed, 37463 author = {J. Y. Suh and D. Van Gucht}, 37464 title = {Distributed Genetic Algorithms}, 37465 institution = {Computer Science Department, Indiana University}, 37466 year = {1987}, 37467 address = {Bloomington}, 37468 number = {225} 37469} 37470 37471@Article{ sun.natori.ea:computational, 37472 author = {S. M. Sun and M. C. Natori and K. C. Park}, 37473 title = {A Computational Procedure for Flexible Beams with Frictional Contact 37474 Constraints}, 37475 journal = {International Journal for Numerical Methods in Engineering}, 37476 volume = {36}, 37477 pages = {3781--3800}, 37478 year = {1993} 37479} 37480 37481@Article{ sun.qi:ncp-functions, 37482 author = {D. Sun and L. Qi}, 37483 title = {On {NCP}-Functions}, 37484 journal = {Computational Optimization and Applications, forthcoming}, 37485 year = {1998} 37486} 37487 37488@Article{ sun.womersley:unconstrained, 37489 author = {D. Sun and R. S. Womersley}, 37490 title = {A new unconstrained differentiable merit function for box constrained variational 37491 inequality problems and a damped {G}auss-{N}ewton method}, 37492 journal = {SIAM Journal on Optimization}, 37493 year = {1999}, 37494 volume = {9}, 37495 pages = {388--413} 37496} 37497 37498@Article{ sun:class, 37499 author = {D. Sun}, 37500 title = {A Class of Iterative Methods for Nonlinear Projection Equations}, 37501 journal = {Journal of Optimization Theory and Applications}, 37502 year = {1996}, 37503 volume = {91}, 37504 pages = {123--140} 37505} 37506 37507@PhDThesis{ sun:monotropic, 37508 author = {J. Sun}, 37509 title = {On Monotropic Piecewise Quadratic Programming}, 37510 school = {University of Washington}, 37511 year = {1986}, 37512 address = {Seattle, Washington} 37513} 37514 37515@Article{ sun:thermal, 37516 author = {D. C. Sun}, 37517 title = {A Thermal Elastic Theory of Piston-Ring and Cylinder-Bore Contact}, 37518 journal = {Journal of Applied Mechanics}, 37519 volume = {58}, 37520 pages = {141--153}, 37521 year = {1991} 37522} 37523 37524@Article{ sundararaghavan.ahmed:minimizing, 37525 author = {P. S. Sundararaghavan and M. U. Ahmed}, 37526 title = {Minimizing the Sum of Absolute Lateness in Single--Machine and Multimachine 37527 Scheduling}, 37528 journal = {Naval Research Logistics Quarterly}, 37529 year = {1984}, 37530 volume = {31}, 37531 pages = {325--333} 37532} 37533 37534@TechReport{ sznajder.gowda:generalizations, 37535 author = {R. Sznajder and M. S. Gowda}, 37536 title = {Generalizations of ${P}_0$-- and ${P}$-- properties; extended vertical and 37537 horizontal {LCP}s}, 37538 institution = {Department of Mathematics, University of Maryland--Baltimore County}, 37539 year = {1992}, 37540 address = {Catonsville, Maryland}, 37541 number = {92--16}, 37542 type = {Research Report} 37543} 37544 37545@Article{ sznajder.gowda:nondegeneracy, 37546 author = {R. Sznajder and M. S. Gowda}, 37547 title = {Nondegeneracy Concepts for Zeros of Piecewise Smooth Functions}, 37548 journal = {Mathematics of Operations Research}, 37549 year = {1998}, 37550 volume = {23}, 37551 pages = {221--238} 37552} 37553 37554@Article{ taji.fukushima.ea:globally, 37555 author = {K. Taji and M. Fukushima and T. Ibaraki}, 37556 title = {A Globally Convergent {N}ewton Method for Solving Strongly Monotone Variational 37557 Inequalities}, 37558 journal = {Mathematical Programming}, 37559 year = {1993}, 37560 volume = {58}, 37561 pages = {369--383} 37562} 37563 37564@Article{ taji.fukushima:optimization, 37565 author = {K. Taji and M. Fukushima}, 37566 title = {Optimization Based Globally Convergent Methods for the Nonlinear Complementarity 37567 Problem}, 37568 journal = {Journal of the Operations Research Society of Japan}, 37569 year = {1994}, 37570 volume = {37}, 37571 pages = {310--331} 37572} 37573 37574@Article{ talbot.patterson.ea:comparative, 37575 author = {F. B. Talbot and J. H. Patterson and W. V. Gehrlein}, 37576 title = {A Comparative Evaluation of Heuristic Line Balancing Techniques}, 37577 journal = {Management Science}, 37578 year = {1986}, 37579 volume = {32}, 37580 pages = {430--454} 37581} 37582 37583@Article{ talman.yamamoto:simplicial, 37584 author = {A. J. J. Talman and Y. Yamamoto}, 37585 title = {A {S}implicial Algorithm for Stationary Point Problems}, 37586 journal = {Mathematics of Operations Research}, 37587 year = {1989}, 37588 volume = {14}, 37589 pages = {383--399} 37590} 37591 37592@InProceedings{ tanese:distributed, 37593 crossref = {schaeffer:third}, 37594 author = {R. Tanese}, 37595 title = {Distributed Genetic Algorithms}, 37596 pages = {434--439} 37597} 37598 37599@InProceedings{ tanese:parallel, 37600 crossref = {grefenstette:genetic}, 37601 author = {R. Tanese}, 37602 title = {Parallel Genetic Algorithms for a Hypercube}, 37603 pages = {177--183} 37604} 37605 37606@Article{ teboulle:entropic, 37607 author = {M. Teboulle}, 37608 title = {Entropic Proximal Mappings with Applications to Nonlinear Programming}, 37609 year = {1992}, 37610 journal = {Mathematics of Operations Research}, 37611 volume = {17}, 37612 pages = {670--690} 37613} 37614 37615@Article{ thuente:duality, 37616 author = {D. J. Thuente}, 37617 title = {Duality Theory for Generalized Linear Programs with Computational Methods}, 37618 journal = {Operations Research}, 37619 year = {1980}, 37620 volume = {28}, 37621 pages = {1005--1011} 37622} 37623 37624@Book{ tikhonov.arsenin:solutions, 37625 author = {A. N. Tikhonov and V. Y. Arsenin}, 37626 title = {Solutions of Ill--Posed Problems}, 37627 year = {1977}, 37628 publisher = {John Wiley \& Sons}, 37629 address = {New York} 37630} 37631 37632@InProceedings{ tin-loi.ferris:complementarity, 37633 author = {F. Tin-Loi and M. C. Ferris}, 37634 title = {Complementarity Problems in Engineering and Mechanics: Models and Solution}, 37635 booktitle = {Computational Mechanics for the Next Millenium}, 37636 key = {79}, 37637 pages = {1029--1036}, 37638 year = {1999}, 37639 editor = {C. M. Wang and K. H. Lee and K. K. Ang}, 37640 volume = {2}, 37641 series = {Proceedings of APCOM '99, Fourth Asia-Pacific Conference on Computational 37642 Mechanics}, 37643 url = {ftp: //ftp.cs.wisc.edu/math-prog/tech-reports/99-02.ps}, 37644 publisher = {Elsevier Science Ltd}, 37645 type = {Mathematical Programming Technical Report}, 37646 institution = {Computer Sciences Department, University of Wisconsin}, 37647 address = {Madison, Wisconsin}, 37648 number = {99-02} 37649} 37650 37651@InProceedings{ tin-loi.ferris:holonomic, 37652 author = {F. Tin-Loi and M. C. Ferris}, 37653 title = {Holonomic Analysis of Quasibrittle Fracture with Nonlinear Softening}, 37654 booktitle = {Advances in Fracture Research}, 37655 year = {1997}, 37656 editor = {B. L. Karihaloo and Y. W. Mai and M. I. Ripley and R. O. Ritchie}, 37657 volume = {2}, 37658 publisher = {Pergamon Press}, 37659 pages = {2183--2190}, 37660 key = {53} 37661} 37662 37663@InProceedings{ tin-loi.ferris:simple, 37664 author = {F. Tin-Loi and M. C. Ferris}, 37665 title = {A Simple Mathematical Programming Method for a Structural Identification 37666 Problem}, 37667 booktitle = {Seventh International Conference on Computing in Civil and Building Engineering 37668 (ICCCBE-VII), Seoul, Korea, 19-21 August}, 37669 editors = {C. K. Choi and C. B. Yun and H. G. Kwak}, 37670 publisher = {Techno-Press}, 37671 address = {Korea}, 37672 year = {1997}, 37673 pages = {511--518}, 37674 key = {59} 37675} 37676 37677@Article{ tin-loi.misa:large, 37678 author = {F. Tin-Loi and J. S. Misa}, 37679 title = {Large displacement elastoplastic analysis of semirigid steel frames}, 37680 journal = {International Journal for Numerical Methods in Engineering}, 37681 volume = {39}, 37682 pages = {741--762}, 37683 year = {1996} 37684} 37685 37686@Article{ tin-loi.pang:elastoplastic, 37687 author = {F. Tin-Loi and J. S. Pang}, 37688 title = {Elastoplastic analysis of structures with nonlinear hardening}, 37689 journal = {Computer Methods in Applied Mechanics and Engineering}, 37690 volume = {107}, 37691 year = {1993}, 37692 pages = {299--312} 37693} 37694 37695@Article{ tin-loi.vimonsatit:nonlinear, 37696 author = {F. Tin-Loi and V. Vimonsatit}, 37697 title = {Nonlinear Analysis of Semi-Rigid Frames: a Parametric Complementarity Approach}, 37698 journal = {Engineering Structures}, 37699 volume = {18}, 37700 year = {1996}, 37701 pages = {115--124} 37702} 37703 37704@Article{ tobin:uniqueness, 37705 author = {R. L. Tobin}, 37706 title = {Uniqueness results and algorithm for Stackelberg-Cournot-Nash equilibria}, 37707 journal = {Annals of Operations Research}, 37708 volume = {34}, 37709 year = {1992}, 37710 pages = {21--36} 37711} 37712 37713@Article{ tobin:variable, 37714 author = {R. L. Tobin}, 37715 title = {A Variable Dimension Solution Approach for the General Spatial Equilibrium 37716 Problem}, 37717 journal = {Mathematical Programming}, 37718 year = {1988}, 37719 volume = {40}, 37720 pages = {33--51} 37721} 37722 37723@Article{ todd.burrell:extension, 37724 author = {M. J. Todd and B. P. Burrell}, 37725 title = {An Extension of {K}armarkar's Algorithm for Linear Programming Using Dual 37726 Variables}, 37727 journal = {Algorithmica}, 37728 year = {1986}, 37729 volume = {1}, 37730 pages = {409--424} 37731} 37732 37733@Book{ todd:computation, 37734 author = {M. J. Todd}, 37735 title = {Computation of Fixed Points and Applications}, 37736 publisher = {Springer-Verlag}, 37737 year = {1976}, 37738 volume = {124}, 37739 series = {Lecture Notes in Economics and Mathematical Systems}, 37740 address = {Heidelberg} 37741} 37742 37743@Article{ todd:note, 37744 author = {M. J. Todd}, 37745 title = {A Note on Computing Equilibria in Economies with Activity Analysis Models of 37746 Production}, 37747 journal = {Journal of Mathematical Economics}, 37748 year = {1976}, 37749 volume = {6}, 37750 pages = {135--144} 37751} 37752 37753@Article{ toint:assesment, 37754 author = {Ph. L. Toint}, 37755 title = {An Assesment of Non--Monotone Linesearch Techniques for Unconstrained 37756 Optimization}, 37757 year = {1996}, 37758 journal = {SIAM Journal on Scientific Computing}, 37759 volume = {17}, 37760 pages = {725=-739} 37761} 37762 37763@TechReport{ toint:assesment*1, 37764 author = {Ph. L. Toint}, 37765 title = {An Assesment of Non--Monotone Linesearch Techniques for Unconstrained 37766 Optimization: The Complete Numerical Results}, 37767 institution = {Department of Mathematics, FUNDP}, 37768 year = {1994}, 37769 number = {94/15}, 37770 address = {Namur, Belgium} 37771} 37772 37773@Article{ toint:global, 37774 author = {Ph. L. Toint}, 37775 title = {Global Convergence of a Class of Trust Region Methods for Nonconvex Minimization 37776 in a {H}ilbert Space}, 37777 journal = {IMA Journal of Numerical Analysis}, 37778 year = {1988}, 37779 volume = {8}, 37780 pages = {231--252} 37781} 37782 37783@Article{ toint:non-monotone, 37784 author = {Ph. L. Toint}, 37785 title = {A Non--Monotone Trust--Region Algorithm for Nonlinear Optimization subject to 37786 Convex Constraints}, 37787 year = {1997}, 37788 journal = {Mathematical Programming}, 37789 volume = {77}, 37790 pages = {69--94} 37791} 37792 37793@InCollection{ toint:transportation, 37794 author = {Ph. L. Toint}, 37795 title = {Transportation Modelling and Operations Research: {A} Fruitful Connection}, 37796 booktitle = {Operations Research and Decision Aid Methodologies in Traffic and Transportation 37797 Management}, 37798 publisher = {Springer-Verlag}, 37799 series = {NATO ASI Series F}, 37800 year = {1997}, 37801 editor = {Ph. L. Toint and M. Labbe and K. Tanczos and G. Laporte} 37802} 37803 37804@Article{ tomlin.welch:finding, 37805 author = {J. Tomlin and J. Welch}, 37806 title = {Finding Duplicate Rows in a Linear Programming Model}, 37807 journal = {Operations Research Letters}, 37808 year = {1986}, 37809 volume = {5}, 37810 number = {1}, 37811 pages = {7--11} 37812} 37813 37814@Article{ torczon:convergence, 37815 author = {V. Torczon}, 37816 title = {On the Convergence of the Multidirectional Search Algorithm}, 37817 journal = {SIAM Journal on Optimization}, 37818 year = {1991}, 37819 volume = {1}, 37820 pages = {123--145} 37821} 37822 37823@Article{ torczon:convergence*1, 37824 author = {V. Torczon}, 37825 title = {On the Convergence of Pattern Search Algorithms}, 37826 journal = {SIAM Journal on Optimization}, 37827 year = {1997}, 37828 volume = {7}, 37829 pages = {1--25} 37830} 37831 37832@Misc{ torma.rutherford:general, 37833 author = {H. Torma and T. Rutherford}, 37834 title = {A General Equilibrium Assessment of {F}inland's Grand Tax Reform}, 37835 year = {1992}, 37836 howpublished = {Working Paper 15/1992}, 37837 note = {Department of Economics and Management, University of Jyvaskyla, Finland} 37838} 37839 37840@Article{ trinkle.pang.ea:dynamic, 37841 author = {J. C. Trinkle and J. S. Pang and S. Sudarsky and G. Lo}, 37842 title = {On Dynamic Multi-Rigid-Body Contact Problems}, 37843 journal = {Zeitschrift f{\"{u}}r Angewandte Mathematik und Mechanik}, 37844 year = {1997}, 37845 pages = {267--279}, 37846 volume = {77} 37847} 37848 37849@InProceedings{ trinkle.pang:dynamic, 37850 author = {J. C. Trinkle and J. S. Pang}, 37851 title = {Dynamic multi-rigid-body systems with concurrent distributed contacts friction}, 37852 book = {{IEEE} International Conference on Robotics and Automation}, 37853 pages = {2276--2281}, 37854 year = {1997} 37855} 37856 37857@TechReport{ tseng.bertsekas:convergence, 37858 author = {P. Tseng and D. P. Bertsekas}, 37859 title = {On the Convergence of the Exponential Multiplier Method for Convex Programming}, 37860 institution = {Laboratory for Information and Decision Systems, Massachusetts Institute of 37861 Technology}, 37862 year = {1990}, 37863 type = {technical report}, 37864 number = {LIDS-P-1995}, 37865 address = {Cambridge, MA} 37866} 37867 37868@Article{ tseng.yamashita.ea:equivalence, 37869 author = {P. Tseng and N. Yamashita and M. Fukushima}, 37870 title = {Equivalence of Complementarity Problems to Differentiable Minimization: a Unified 37871 Approach}, 37872 year = {1996}, 37873 journal = {SIAM Journal on Optimization}, 37874 volume = {6}, 37875 pages = {446--460} 37876} 37877 37878@Article{ tseng:applications, 37879 author = {P. Tseng}, 37880 title = {Applications of a splitting algorithm to decomposition in convex programming and 37881 variational inequalities}, 37882 journal = {SIAM Journal on Control and Optimization}, 37883 year = {1991}, 37884 volume = {29}, 37885 pages = {119--138} 37886} 37887 37888@Article{ tseng:dual, 37889 author = {P. Tseng}, 37890 title = {Dual Ascent Methods for Problems with Strictly Convex Costs and Linear 37891 Constraints: a Unified Approach}, 37892 journal = {SIAM Journal on Control and Optimization}, 37893 year = {1990}, 37894 volume = {28}, 37895 pages = {214--242} 37896} 37897 37898@Article{ tseng:dual*1, 37899 author = {P. Tseng}, 37900 title = {Dual Ascent Methods with Strictly Convex Costs and Linear Constraints: {A} 37901 Unified Approach}, 37902 journal = {SIAM Journal on Control and Optimization}, 37903 year = {1990}, 37904 volume = {28}, 37905 pages = {214--242} 37906} 37907 37908@Article{ tseng:dual*2, 37909 author = {P. Tseng}, 37910 title = {Dual Coordinate Ascent Methods for Non--Strictly Convex Minimization}, 37911 journal = {Mathematical Programming}, 37912 year = {1993}, 37913 volume = {59}, 37914 pages = {231--248} 37915} 37916 37917@Article{ tseng:fortified-descent, 37918 author = {P. Tseng}, 37919 title = {Fortified-Descent Simplicial Search Method: a General Approach}, 37920 journal = {SIAM Journal on Optimization}, 37921 volume = {10}, 37922 pages = {269--288}, 37923 year = {2000} 37924} 37925 37926@Article{ tseng:growth, 37927 author = {P. Tseng}, 37928 title = {Growth Behavior of a Class of Merit Functions for the Nonlinear Complementarity 37929 Problem}, 37930 journal = {Journal of Optimization Theory and Applications}, 37931 volume = {89}, 37932 year = {1996}, 37933 pages = {17--37} 37934} 37935 37936@Unpublished{ tseng:matlab, 37937 author = {P. Tseng}, 37938 title = {Matlab Implementations of Complementarity Codes}, 37939 year = {1995}, 37940 note = {Private Communication} 37941} 37942 37943@Article{ ursescu:multifunctions, 37944 author = {C. Ursescu}, 37945 title = {Multifunctions with closed convex graph}, 37946 journal = {Czech. Math. J.}, 37947 year = {1975}, 37948 volume = {35}, 37949 pages = {438--441} 37950} 37951 37952@TechReport{ vaidya:algorithm, 37953 author = {P. M. Vaidya}, 37954 title = {An Algorithm for Linear Programming which Requires 37955 {O}($((m+n)n^2+(m+n)^{1.5})${L}) arithmetic operations}, 37956 institution = {AT\&T Bell Laboratories}, 37957 year = {1987}, 37958 address = {Murray Hill, New Jersey} 37959} 37960 37961@Article{ val:unloading, 37962 author = {P. Du Val}, 37963 title = {The Unloading Problem for Plane Curves}, 37964 journal = {American Journal of Mathematics}, 37965 year = {1940}, 37966 volume = {62}, 37967 pages = {307--311} 37968} 37969 37970@InCollection{ valentine:problem, 37971 author = {F. A. Valentine}, 37972 title = {The Problem of {L}agrange with Differential Inequalities as Added Side 37973 Conditions}, 37974 booktitle = {Contributions to the Calculus of Variations, 1933--1937}, 37975 year = {1937}, 37976 publisher = {University of Chicago Press}, 37977 address = {Chicago}, 37978 pages = {407--448} 37979} 37980 37981@Article{ valle.poch.ea:comparison, 37982 author = {M. del Valle and M. Poch and J. Alonso and J. Bartroli}, 37983 title = {Comparison of the {P}owell and Simplex Methods in the Optimization of 37984 Flow-Injection Systems}, 37985 journal = {Analytica Chimica Acta}, 37986 year = {1990}, 37987 volume = {241}, 37988 pages = {31--42} 37989} 37990 37991@Article{ vandenberghe.demoor.ea:generalized, 37992 author = {L. Vandenberghe and B. L. {De~Moor} and J. Vandewalle}, 37993 title = {The generalized linear complementarity problem applied to the complete analysis 37994 of resistive piecewise-linear circuits}, 37995 journal = {IEEE Transactions on Circuits and Systems}, 37996 volume = {36}, 37997 year = {1989}, 37998 pages = {1382--1391} 37999} 38000 38001@Article{ vanderbei.meketon.ea:modification, 38002 author = {R. J. Vanderbei and M. S. Meketon and B. A. Freedman}, 38003 title = {A Modification of {K}armarkar's Algorithm}, 38004 journal = {Algorithmica}, 38005 year = {1986}, 38006 volume = {1}, 38007 pages = {395--407} 38008} 38009 38010@Article{ vanderbei:affine-scaling, 38011 author = {R. J. Vanderbei}, 38012 title = {Affine--Scaling for Linear Programs with Free Variables}, 38013 journal = {Mathematical Programming}, 38014 year = {1989}, 38015 volume = {43}, 38016 pages = {31--44} 38017} 38018 38019@Article{ vanroy.wolsey:solving, 38020 author = {T. J. Van~Roy and L. A. Wolsey}, 38021 title = {Solving Mixed Integer 0-1 Programs by Automatic Reformulation}, 38022 journal = {Operations Research}, 38023 volume = {35}, 38024 pages = {45--57}, 38025 year = {1987} 38026} 38027 38028@Book{ vapnik:nature, 38029 author = {V. N. Vapnik}, 38030 title = {The Nature of Statistical Learning Theory}, 38031 publisher = {John Wiley \& Sons}, 38032 address = {New York}, 38033 year = {1996} 38034} 38035 38036@Book{ varian:microeconomic, 38037 author = {Hal R. Varian}, 38038 title = {Microeconomic Analysis}, 38039 year = {1978}, 38040 publisher = {W.W. Norton \& Company}, 38041 address = {New York, New York} 38042} 38043 38044@Article{ verhey:immobilizing, 38045 author = {L. J. Verhey}, 38046 title = {Immobilizing and Positioning Patients for Radiotherapy}, 38047 journal = {Seminars in Radiation Oncology}, 38048 year = {1995}, 38049 volume = {5}, 38050 number = {2}, 38051 pages = {100--113} 38052} 38053 38054@Article{ vinante.pintos:differentiable, 38055 author = {C. Vinante and S. Pintos}, 38056 title = {On Differentiable Exact Penalty Functions}, 38057 journal = {Journal of Optimization Theory and Applications}, 38058 year = {1986}, 38059 volume = {50}, 38060 pages = {479--493} 38061} 38062 38063@Article{ vlach:scheduling, 38064 author = {M. Vlach}, 38065 title = {On Scheduling with Earliness and Tardiness Penalties}, 38066 journal = {Methods of Operations Research}, 38067 year = {1983}, 38068 volume = {45}, 38069 pages = {367--375} 38070} 38071 38072@InCollection{ wacker:summary, 38073 author = {H.--J. Wacker}, 38074 title = {A Summary of the Developments on Imbedding Methods}, 38075 booktitle = {Continuation Methods}, 38076 year = {1978}, 38077 editor = {H.--J. Wacker}, 38078 publisher = {Academic Press}, 38079 address = {New York}, 38080 pages = {1--35} 38081} 38082 38083@Article{ wakefield.tin-loi:large, 38084 author = {R. R. Wakefield and F. Tin-Loi}, 38085 title = {Large Scale Nonholonomic Elastoplastic Analysis using a Linear Complementarity 38086 Formulation}, 38087 journal = {Computer Methods in Applied Mechanics and Engineering}, 38088 volume = {84}, 38089 year = {1990}, 38090 pages = {229--242} 38091} 38092 38093@Article{ wakefield.tin-loi:large*1, 38094 author = {R. R. Wakefield and F. Tin-Loi}, 38095 title = {Large Displacement Elastoplastic Analysis of Frames using an Iterative {LCP} 38096 Approach}, 38097 journal = {International Journal Mechanical Science}, 38098 volume = {33}, 38099 year = {1991}, 38100 pages = {379--391} 38101} 38102 38103@Article{ walker:implementation, 38104 author = {H. F. Walker}, 38105 title = {Implementation of the {GMRES} method using {H}ouseholder transformations}, 38106 journal = {SIAM Journal on Scientific Computing}, 38107 volume = {9}, 38108 year = {1988}, 38109 pages = {152--163} 38110} 38111 38112@Book{ wall.schwartz:programming, 38113 author = {L. Wall and R. L. Schwartz}, 38114 title = {Programming Perl}, 38115 publisher = {O'Reilly and Associates, Inc.}, 38116 address = {Sebastopol, CA}, 38117 year = {1991} 38118} 38119 38120@Book{ walras:elements, 38121 author = {L. Walras}, 38122 title = {Elements of Pure Economics}, 38123 publisher = {Allen and Unwin}, 38124 year = {1954}, 38125 address = {London} 38126} 38127 38128@Article{ wang.monteiro.ea:interior, 38129 author = {T. Wang and R. D. C. Monteiro and J. S. Pang}, 38130 title = {An Interior Point Potential Reduction Method for Constrained Equations}, 38131 journal = {Mathematical Programming}, 38132 volume = {74}, 38133 pages = {159--196}, 38134 year = {1996} 38135} 38136 38137@Article{ wardi:stochastic, 38138 author = {Y. Wardi}, 38139 title = {A Stochastic Steepest-Descent Algorithm}, 38140 journal = {Journal of Optimization Theory and Applications}, 38141 year = {1988}, 38142 volume = {59}, 38143 pages = {307--323} 38144} 38145 38146@Article{ wardi:stochastic*1, 38147 author = {Y. Wardi}, 38148 title = {Stochastic Algorithms for with {A}rmijo Stepsizes for Minimization of Functions}, 38149 journal = {Journal of Optimization Theory and Applications}, 38150 year = {1990}, 38151 volume = {64}, 38152 pages = {399--417} 38153} 38154 38155@Article{ wardrop:theoretical, 38156 author = {J. G. Wardrop}, 38157 title = {Some Theoretical Aspects of Road Traffic Research}, 38158 journal = {Proceeding of the Institute of Civil Engineers, Part {II}}, 38159 year = {1952}, 38160 pages = {325--378} 38161} 38162 38163@Article{ warga:minimizing, 38164 author = {J. Warga}, 38165 title = {Minimizing certain convex functions}, 38166 journal = {Journal of SIAM on Applied Mathematics}, 38167 year = {1963}, 38168 volume = {11}, 38169 pages = {588--593} 38170} 38171 38172@Article{ watson.billups.ea:hompack, 38173 author = {L. T. Watson and S. C. Billups and A. P. Morgan}, 38174 title = {Algorithm 652: {HOMPACK}: {A} Suite of Codes for Globally Convergent Homotopy 38175 Algorithms}, 38176 journal = {{ACM} Transactions on Mathematical Software}, 38177 year = {1987}, 38178 volume = {13}, 38179 pages = {281--310} 38180} 38181 38182@Article{ watson.billups.ea:slow, 38183 author = {L. T. Watson and S. C. Billups and C. Y. Wang}, 38184 title = {Slow Viscous Flow in a Syringe}, 38185 journal = {Journal of Biomechanical Engineering}, 38186 year = {1986}, 38187 volume = {108}, 38188 pages = {317--323} 38189} 38190 38191@Article{ watson:discrete, 38192 author = {G. A. Watson}, 38193 title = {Discrete $\ell_1$ approximation by rational functions}, 38194 journal = {IMA Journal of Numerical Analysis}, 38195 year = {1984}, 38196 volume = {4}, 38197 pages = {275--288} 38198} 38199 38200@Article{ watson:solving, 38201 author = {L. T. Watson}, 38202 title = {Solving the nonlinear complementarity problem by a homotopy method}, 38203 journal = {SIAM Journal on Control and Optimization}, 38204 year = {1979}, 38205 volume = {17}, 38206 pages = {36--46} 38207} 38208 38209@Article{ webb:optimum, 38210 author = {S. Webb}, 38211 title = {Optimum Parameters in a Model of Tumor Control Probability including Interpatient 38212 Heterogeneity}, 38213 journal = {Physics in Medicine and Biology}, 38214 year = {1994}, 38215 volume = {39}, 38216 pages = {1895--1914} 38217} 38218 38219@Book{ webb:physics, 38220 author = {S. Webb}, 38221 title = {The Physics of Conformal Radiotherapy: Advances in Technology}, 38222 publisher = {Institute of Physics Publishing Ltd.}, 38223 year = {1997}, 38224 optaddress = {Philadelphia} 38225} 38226 38227@InBook{ webb:theory, 38228 author = {S. Webb}, 38229 editor = {E. Sternick}, 38230 title = {The Theory and Practice of Intensity Modulated Radiation Therapy}, 38231 chapter = {Inverse Planning for IMRT: the Role of Simulated Annealing}, 38232 publisher = {Advanced Medical Publishing}, 38233 year = {1997} 38234} 38235 38236@Book{ weiss.kulikowski:computer, 38237 author = {S. M. Weiss and C. A. Kulikowski}, 38238 title = {Computer Systems that Learn}, 38239 year = {1991}, 38240 publisher = {Morgan Kaufmann Publishers, Inc}, 38241 address = {San Mateo, California} 38242} 38243 38244@PhDThesis{ werbos:beyond, 38245 author = {P. J. Werbos}, 38246 title = {Beyond Regression: New Tools for Prediction and Analysis in the Behaviorial 38247 Sciences}, 38248 year = {1974}, 38249 school = {Harvard University} 38250} 38251 38252@InCollection{ wets:convergence, 38253 author = {R. J.-B. Wets}, 38254 title = {Convergence of Convex Functions, Variational Inequalites, and Convex Optimization 38255 Problems}, 38256 booktitle = {Variational Inequalites and Complementarity Problems}, 38257 year = {1980}, 38258 editor = {R. W. Cottle and F. Giannessi and J.--L. Lions}, 38259 publisher = {John Wiley \& Sons}, 38260 address = {New York}, 38261 pages = {375--403} 38262} 38263 38264@InCollection{ wets:large, 38265 author = {R. J.-B. Wets}, 38266 title = {Large Scale Linear Programming Techniques in Stochastic Programming}, 38267 booktitle = {Numerical Techniques for Stochastic Optimization}, 38268 publisher = {Springer-Verlag}, 38269 year = {1988}, 38270 editor = {Yu. M. Ermoliev and R. J. -B. Wets}, 38271 address = {Berlin}, 38272 pages = {65--93} 38273} 38274 38275@Article{ white:asymptotic, 38276 author = {H. White}, 38277 title = {Some asymptotic results for learning in single hidden-layer feedforward network 38278 models}, 38279 journal = {Journal of the American Stattistical Association}, 38280 year = {1989}, 38281 volume = {84}, 38282 number = {408}, 38283 pages = {1003--1013} 38284} 38285 38286@Article{ white:learning, 38287 author = {H. White}, 38288 title = {Learning in artificial neural networks{:} {A} statistical perspective}, 38289 journal = {Neural Computation}, 38290 year = {1989}, 38291 volume = {1}, 38292 pages = {425--461} 38293} 38294 38295@InProceedings{ whitley.starkweather.ea:scheduling, 38296 crossref = {schaeffer:third}, 38297 author = {D. Whitley and T. Starkweather and D. Fuquay}, 38298 title = {Scheduling Problems and Travelling Salesmen: The Genetic Edge Recombination 38299 Operator}, 38300 pages = {133--140} 38301} 38302 38303@Book{ williams:model, 38304 author = {H. P. Williams}, 38305 title = {Model Building in Mathematical Programming}, 38306 publisher = {John Wiley \& Sons}, 38307 year = {1990}, 38308 edition = {Third} 38309} 38310 38311@Book{ wilmott.dewynne.ea:option, 38312 author = {P. Wilmott and J. Dewynne and S. Howison}, 38313 title = {Option Pricing}, 38314 publisher = {Oxford Financial Press}, 38315 year = {1993}, 38316 address = {Oxford, England} 38317} 38318 38319@PhDThesis{ wilson:simplicial, 38320 author = {R. B. Wilson}, 38321 title = {A Simplicial Algorithm for Concave Programming}, 38322 year = {1963}, 38323 address = {Boston, MA}, 38324 school = {Graduate School of Business Administration, Harvard University} 38325} 38326 38327@TechReport{ wolberg.bennett.ea:breast, 38328 author = {W. H. Wolberg and K. P. Bennett and O. L. Mangasarian}, 38329 title = {Breast Cancer Diagnosis and Prognostic Determination from Cell Analysis}, 38330 institution = {Departments of Surgery and Human Oncology and Computer Sciences, University of 38331 Wisconsin}, 38332 year = {1992}, 38333 address = {Madison, WI 53706}, 38334 type = {Manuscript} 38335} 38336 38337@Article{ wolberg.mangasarian:multisurface, 38338 author = {W. H. Wolberg and O. L. Mangasarian}, 38339 title = {Multisurface Method of Pattern Separation for Medical Diagnosis Applied to Breast 38340 Cytology}, 38341 journal = {Proceedings of the National Academy of Sciences,U.S.A.}, 38342 year = {1990}, 38343 volume = {87}, 38344 pages = {9193--9196} 38345} 38346 38347@Unpublished{ wolberg.mangasarian:wbcd, 38348 author = {W. H. Wolberg and O. L. Mangasarian}, 38349 title = {{WBCD: Wisconsin Breast Cancer Database}}, 38350 year = {1991}, 38351 note = {Computer Sciences Department, University of Wisconsin, Madison, ftp: //ftp. cs. 38352 wisc.edu/math-prog/cpo-dataset/machine-learn/cancer1/} 38353} 38354 38355@Article{ wolberg.street.ea:breast, 38356 author = {W. H. Wolberg and W. N. Street and O. L. Mangasarian}, 38357 title = {Breast Cytology Diagnosis via Digital Image Analysis}, 38358 journal = {Analytical and Quantitative Cytology and Histology}, 38359 year = {1993}, 38360 volume = {15}, 38361 number = {6}, 38362 pages = {396--404} 38363} 38364 38365@Unpublished{ wolberg.street.ea:wdbc, 38366 author = {W. H. Wolberg and W. N. Street and O. L. Mangasarian}, 38367 title = {{WDBC: Wisconsin Diagnostic Breast Cancer Database}}, 38368 year = {1995}, 38369 note = {Computer Sciences Department, University of Wisconsin, Madison, ftp: //ftp. 38370 cs.wisc.edu/math-prog/cpo-dataset/machine-learn/WDBC/} 38371} 38372 38373@Unpublished{ wolberg.street.ea:wpbc, 38374 author = {W. H. Wolberg and W. N. Street and O. L. Mangasarian}, 38375 title = {{WPBC: Wisconsin Prognostic Breast Cancer Database}}, 38376 year = {1995}, 38377 note = {Computer Sciences Department, University of Wisconsin, Madison, ftp: //ftp. 38378 cs.wisc.edu/math-prog/cpo-dataset/machine-learn/WPBC/} 38379} 38380 38381@Book{ wolsey:integer, 38382 author = {L. A. Wolsey}, 38383 title = {Integer Programming}, 38384 publisher = {John Wiley \& Sons}, 38385 year = {1998}, 38386 address = {New York, NY} 38387} 38388 38389@Article{ womersley:local, 38390 author = {R. S. Womersley}, 38391 title = {Local Properties of Algorithms for Minimizing Composite Functions}, 38392 journal = {Mathematical Programming}, 38393 year = {1985}, 38394 volume = {32}, 38395 pages = {69--89} 38396} 38397 38398@Article{ woo.sanders.ea:peacock, 38399 author = {S. Y. Woo and M. Sanders and W. Grant and E. B. Butler}, 38400 title = {Does the ``peacock'' have anything to do with radiotherapy?}, 38401 journal = {International Journal of Radiation Oncology, Biology and Physics}, 38402 year = {1994}, 38403 volume = {29}, 38404 number = {1}, 38405 pages = {213--214} 38406} 38407 38408@Article{ wright.ralph:superlinear, 38409 author = {S. J. Wright and D. Ralph}, 38410 title = {A Superlinear Infeasible--Interior--Point Algorithm for Monotone Complementarity 38411 Problems}, 38412 year = {1996}, 38413 journal = {Mathematics of Operations Research}, 38414 volume = {21}, 38415 pages = {815--838} 38416} 38417 38418@TechReport{ wright.zhang:superquadratic, 38419 author = {S. J. Wright and Y. Zhang}, 38420 title = {A Superquadratic Infeasible--Interior--Point Method for linear complementarity 38421 problems}, 38422 institution = {Argonne National Laboratory}, 38423 year = {1994}, 38424 annote = {revised}, 38425 number = {MCS--P418--0294}, 38426 address = {Argonne, Illinois}, 38427 type = {Preprint} 38428} 38429 38430@TechReport{ wright:dynfgm, 38431 author = {S. E. Wright}, 38432 title = {{DYNFGM}: Dynamic Finite Generation Method}, 38433 institution = {Department of Mathematics, University of Washington}, 38434 year = {1989}, 38435 address = {Seattle, Washington} 38436} 38437 38438@Article{ wright:infeasible-interior-point, 38439 author = {S. J. Wright}, 38440 title = {An Infeasible--Interior--Point Algorithm for Linear Complementarity Problems}, 38441 journal = {Mathematical Programming}, 38442 volume = {67}, 38443 pages = {29--51}, 38444 year = {1994} 38445} 38446 38447@Article{ wright:path-following, 38448 author = {S. J. Wright}, 38449 title = {A Path--Following Infeasible--Interior--Point Algorithm for Linear 38450 Complementarity Problems}, 38451 journal = {Optimization Methods and Software}, 38452 year = {1993}, 38453 volume = {2}, 38454 pages = {79--106} 38455} 38456 38457@TechReport{ wright:path-following*1, 38458 author = {S. J. Wright}, 38459 title = {A Path--Following Infeasible--Interior--Point Algorithm for Linear and Quadratic 38460 Problems}, 38461 institution = {Argonne National Laboratory}, 38462 year = {1993}, 38463 number = {MCS--P401--1293}, 38464 address = {Argonne, Illinois} 38465} 38466 38467@Book{ wright:primal-dual, 38468 author = {S. J. Wright}, 38469 title = {Primal--Dual Interior--Point Methods}, 38470 year = {1997}, 38471 publisher = {SIAM}, 38472 address = {Philadelphia, Pennsylvania} 38473} 38474 38475@TechReport{ wright:reduced, 38476 author = {S. J. Wright}, 38477 title = {On Reduced Convex QP Formulations of Monotone LCP Problems}, 38478 institution = {Argonne National Laboratory}, 38479 year = {2000}, 38480 number = {MCS--P808--0400}, 38481 address = {Argonne, Illinois} 38482} 38483 38484@Article{ wright:solution, 38485 author = {S. J. Wright}, 38486 title = {Solution of Discrete--Time Optimal Control Problems on Parallel Computers}, 38487 journal = {Parallel Computing}, 38488 year = {1990}, 38489 volume = {16}, 38490 pages = {221--238} 38491} 38492 38493@Article{ wu.bourland:morphology, 38494 author = {Q. J. Wu and J. D. Bourland}, 38495 title = {Morphology-guided radiosurgery treatment planning and optimization for multiple 38496 isocenters}, 38497 journal = {Medical Physics}, 38498 year = {1999}, 38499 volume = {26}, 38500 number = {10}, 38501 pages = {2151--2160} 38502} 38503 38504@Misc{ wunderling:soplex, 38505 author = {R. Wunderling}, 38506 title = {{SOPLEX}: The Sequential Object-Oriented Simplex Class Library}, 38507 howpublished = {http://www.zib.de/Optimization/Software/Soplex/} 38508} 38509 38510@Article{ xiao.harker:nonsmooth, 38511 author = {B. Xiao and P. T. Harker}, 38512 title = {A Nonsmooth {N}ewton Method for Variational Inequalities: {I}: Theory}, 38513 journal = {Mathematical Programming}, 38514 year = {1994}, 38515 volume = {65}, 38516 pages = {151--194} 38517} 38518 38519@Article{ xiao.harker:nonsmooth*1, 38520 author = {B. Xiao and P. T. Harker}, 38521 title = {A Nonsmooth {N}ewton Method for Variational Inequalities: {II}: Numerical 38522 Results}, 38523 journal = {Mathematical Programming}, 38524 year = {1994}, 38525 volume = {65}, 38526 pages = {195--216} 38527} 38528 38529@Article{ xiao.zhou:nonmonotone, 38530 author = {Y. Xiao and F. J. Zhou}, 38531 title = {Nonmonotone Trust Region Methods with Curvilinear Paths in Unconstrained 38532 Minimization}, 38533 journal = {Computing}, 38534 year = {1992}, 38535 volume = {48}, 38536 pages = {303--317} 38537} 38538 38539@TechReport{ xiao:global, 38540 author = {B. Xiao}, 38541 title = {Global {N}ewton methods for nonlinear problems and variational inequalities: a 38542 {B}-differentiable equation approach}, 38543 type = {{Ph.D. Thesis}}, 38544 year = {1990}, 38545 institution = {Department of Decision Sciences, The Warton School, University of Pennsylvania}, 38546 address = {Philadelphia, PA} 38547} 38548 38549@Article{ xu.burke:polynomial, 38550 author = {S. Xu and J. V. Burke}, 38551 title = {A Polynomial Time Interior-Point Path-Following Algorithm for {LCP} based on 38552 {C}hen-{H}arker-{K}anzow Smoothing Techniques}, 38553 year = {1999}, 38554 journal = {Mathematical Programming}, 38555 volume = {86}, 38556 pages = {91--104} 38557} 38558 38559@TechReport{ xu:global, 38560 author = {S. Xu}, 38561 title = {The Global Linear Convergence of an Infeasible Non-Interior Path-Following 38562 Algorithm for Complementarity Problems with Uniform {P}-Functions}, 38563 institution = {Department of Mathematics, University of Washington}, 38564 year = {1996}, 38565 type = {Technical Report}, 38566 address = {Seattle, WA} 38567} 38568 38569@Article{ yajima.konno:efficient, 38570 author = {Y. Yajima and H. Konno}, 38571 title = {Efficient Algorithms for Solving Rank Two and Rank Three Bilinear Programming 38572 Problems}, 38573 journal = {Journal of Global Optimization}, 38574 year = {1991}, 38575 volume = {1:1}, 38576 pages = {155--171} 38577} 38578 38579@Article{ yamamoto:path-following, 38580 author = {Y. Yamamoto}, 38581 title = {A Path--Following Algorithm for Stationary Point Problems}, 38582 journal = {Journal of Operations Society of Japan}, 38583 year = {1987}, 38584 volume = {30}, 38585 pages = {181--198} 38586} 38587 38588@Article{ yamashita.fukushima:modified, 38589 author = {N. Yamashita and M. Fukushima}, 38590 title = {Modified {N}ewton Methods for Solving a Semismooth Reformulation of Monotone 38591 Complementarity Problems}, 38592 journal = {Mathematical Programming}, 38593 year = {1997}, 38594 volume = {76}, 38595 pages = {469--492} 38596} 38597 38598@Article{ yamashita.fukushima:stationary, 38599 author = {N. Yamashita and M. Fukushima}, 38600 title = {On Stationary Points of the Implicit Lagrangian for Nonlinear Complementarity 38601 Problems}, 38602 journal = {Journal of Optimization Theory and Applications}, 38603 volume = {84}, 38604 pages = {653--663}, 38605 year = {1995} 38606} 38607 38608@Article{ yamashita.taji.ea:unconstrained, 38609 author = {N. Yamashita and K. Taji and M. Fukushima}, 38610 title = {Unconstrained Optimization Reformulations of Variational Inequality Problems}, 38611 journal = {Journal of Optimization Theory and Applications}, 38612 year = {1997}, 38613 volume = {92}, 38614 pages = {439--456} 38615} 38616 38617@TechReport{ yamashita:properties, 38618 author = {N. Yamashita}, 38619 title = {Some Properties of the Restricted {NCP}-Functions for the Nonlinear 38620 Complementarity Problem}, 38621 institution = {Department of Applied Mathematics and Physics, Kyoto University}, 38622 year = {1996}, 38623 type = {Technical Report}, 38624 address = {Kyoto, Japan} 38625} 38626 38627@Article{ yang.mackie.ea:investigation, 38628 author = {J. N. Yang and T. R. Mackie and P. Reckwerdt and J. O. Deasy and B. R. 38629 Thomadsen}, 38630 title = {An investigation of tomotherapy beam delivery}, 38631 journal = {Medical Physics}, 38632 year = {1997}, 38633 volume = {24}, 38634 number = {3}, 38635 pages = {425--436} 38636} 38637 38638@Article{ yan.shu.ea:clinical, 38639 author = {Y. Yan and H. Shu and X. Bao}, 38640 title = {Clinical Treatment Planning Optimization by {P}owell's method for {G}amma Unit 38641 Treatmen System}, 38642 journal = {International Journal of Radiation Oncology, Biology and Physics}, 38643 year = {1997}, 38644 volume = {39}, 38645 pages = {247--254} 38646} 38647 38648@Article{ yau.gao:obstacle, 38649 author = {S. T. Yau and Y. Gao}, 38650 title = {Obstacle problem for von {K}arm\'an equations}, 38651 journal = {Advances in Applied Mathematics}, 38652 volume = {13}, 38653 year = {1992}, 38654 pages = {123--141} 38655} 38656 38657@Article{ ye.tse:extension, 38658 author = {Y. Ye and E. Tse}, 38659 title = {An Extension of {K}armarkar's Projective Algorithm for Convex Quadratic 38660 Programming}, 38661 journal = {Mathematical Programming}, 38662 year = {1989}, 38663 volume = {44} 38664} 38665 38666@Article{ ye:affine, 38667 author = {Y. Ye}, 38668 title = {On affine scaling algorithms for nonconvex quadratic programming}, 38669 journal = {Mathematical Programming}, 38670 year = {1992}, 38671 volume = {56}, 38672 pages = {285--300} 38673} 38674 38675@PhDThesis{ ye:interior, 38676 author = {Y. Ye}, 38677 title = {Interior Algorithms for Linear, Quadratic, and Linearly Constrained Convex 38678 Programming}, 38679 year = {1987}, 38680 address = {Stanford, California}, 38681 school = {Department of Engineering--Economic Systems, Stanford University} 38682} 38683 38684@Book{ ye:interior*1, 38685 author = {Y. Ye}, 38686 title = {Interior-Point Algorithms: Theory and Analysis}, 38687 publisher = {John Wiley \& Sons}, 38688 year = {1997}, 38689 address = {New York, NY} 38690} 38691 38692@Article{ yu:convergence, 38693 author = {W. --C. Yu}, 38694 title = {The Convergence Property of the Simplex Evolutionary Techniques}, 38695 journal = {Scientia Sinica, Special issue of Mathematics}, 38696 year = {1979}, 38697 volume = {1}, 38698 pages = {68--77} 38699} 38700 38701@Article{ yu.schell:genetic, 38702 author = {Y. Yu and M. C. Schell}, 38703 title = {A Genetic Algorithm for the Optimization of Prostate Implants}, 38704 journal = {Medical Physics}, 38705 year = {1996}, 38706 volume = {23}, 38707 pages = {2085--2091} 38708} 38709 38710@Article{ yuan:superlinear, 38711 author = {Y. Yuan}, 38712 title = {On the Superlinear Convergence of a Trust Region Algorithm for Nonmooth 38713 Optimization}, 38714 journal = {Mathematical Programming}, 38715 year = {1985}, 38716 volume = {31}, 38717 pages = {269--285} 38718} 38719 38720@Book{ zangwill:nonlinear, 38721 author = {W. I. Zangwill}, 38722 title = {Nonlinear Programming: {A} Unified Approach}, 38723 year = {1969}, 38724 publisher = {Prentice-Hall, Inc}, 38725 address = {Englewood Cliffs, New Jersey} 38726} 38727 38728@TechReport{ zangwill:nonlinear*1, 38729 author = {W. I. Zangwill}, 38730 title = {Nonlinear Programming by Sequential Unconstrained Maximization}, 38731 institution = {Center for Research in Management Science, University of California}, 38732 year = {1965}, 38733 address = {Berkeley}, 38734 number = {131}, 38735 type = {Working Paper} 38736} 38737 38738@Article{ zangwill:nonlinear*2, 38739 author = {W. I. Zangwill}, 38740 title = {Nonlinear Programming via Penalty Functions}, 38741 journal = {Management Science}, 38742 year = {1967}, 38743 volume = {13}, 38744 pages = {344--358} 38745} 38746 38747@TechReport{ zenios.censor:massively, 38748 author = {S. A. Zenios and Y. Censor}, 38749 title = {Massively Parallel Row-Action Algorithms for some Nonlinear Transportation 38750 Problems}, 38751 institution = {decision sciences department, Wharton School, University of Pennsylvania}, 38752 year = {1990}, 38753 type = {report}, 38754 number = {89-09-10}, 38755 address = {Philadelphia, PA} 38756} 38757 38758@Article{ zenios.lasken:nonlinear, 38759 author = {S. A. Zenios and R. A. Lasken}, 38760 title = {Nonlinear Network Optimization on a Massively Parallel {C}onnection {M}achine}, 38761 journal = {Annals of Operations Research}, 38762 year = {1988}, 38763 volume = {14}, 38764 pages = {147--163} 38765} 38766 38767@Article{ zenios.mulvey:distributed, 38768 author = {S. A. Zenios and J. M. Mulvey}, 38769 title = {A Distributed Algorithm for Convex Network Optimization Problems}, 38770 journal = {Parallel Computing}, 38771 year = {1988}, 38772 volume = {6}, 38773 pages = {43--56} 38774} 38775 38776@TechReport{ zenios.neilsen:massively, 38777 author = {S. A. Zenios and S. Neilsen}, 38778 title = {Massively Parallel Algorithms for Singly Constrained Nonlinear Programs}, 38779 institution = {Decision Sciences Department, Wharton School, University of Pennsylvania}, 38780 year = {1990}, 38781 type = {report}, 38782 number = {90-03-01}, 38783 address = {Philadelphia, PA} 38784} 38785 38786@TechReport{ zenios.qi.ea:comparative, 38787 author = {S. A. Zenios and R. Qi and E. D. Chajakis}, 38788 title = {A Comparative Study of Parallel Dual Coordinate Ascent Implementations for 38789 Nonlinear Network Optimization}, 38790 institution = {Decision Sciences Department, Wharton School, University of Pennsylvania}, 38791 year = {1990}, 38792 type = {report}, 38793 number = {89-10-02}, 38794 address = {Philadelphia, PA} 38795} 38796 38797@Article{ zhang.kim.ea:improved, 38798 author = {J. Zhang and N.--H. Kim and L. Lasdon}, 38799 title = {An Improved Successive Linear Programming Algorithm}, 38800 year = {1985}, 38801 journal = {Management Science}, 38802 volume = {31}, 38803 pages = {1312--1331} 38804} 38805 38806@Article{ zhang.tapia.ea:superlinear, 38807 author = {Y. Zhang and R. A. Tapia and F. Potra}, 38808 title = {On the Superlinear Convergence of Interior Points Algorithms for a general class 38809 of problems}, 38810 journal = {SIAM Journal on Optimization}, 38811 year = {1993}, 38812 volume = {3}, 38813 number = {?}, 38814 pages = {413--422}, 38815} 38816 38817@Article{ zhang.tapia:superlinearly, 38818 author = {Y. Zhang and R. A. Tapia}, 38819 title = {A superlinearly convergent polynomial primal-dual interior-point algorirthm for 38820 linear programming}, 38821 journal = {SIAM Journal on Optimization}, 38822 year = {1993}, 38823 volume = {3}, 38824 pages = {118--133} 38825} 38826 38827@TechReport{ zhang.zhang:superlinear, 38828 author = {Y. Zhang and D. Zhang}, 38829 title = {Superlinear convergence of infeasible interior-point methods for linear 38830 programming}, 38831 institution = {Department of Mathematics and Statistics, University of Maryland}, 38832 year = {1992}, 38833 number = {92-15}, 38834 address = {Baltimore County, Maryland} 38835} 38836 38837@Article{ zhang:convergence, 38838 author = {Yin Zhang}, 38839 title = {On the Convergence of a Class of Infeasible Interior--Point Methods for the 38840 Horizontal Linear Complementarity Problem}, 38841 journal = {SIAM Journal on Optimization}, 38842 year = {1994}, 38843 volume = {4}, 38844 pages = {208--227} 38845} 38846 38847@Article{ zhang:convergence*1, 38848 author = {Y. Zhang}, 38849 title = {On the convergence of a class of infeasible interior-point methods for the 38850 horizontal linear complementarity problem}, 38851 journal = {SIAM Journal on Optimization}, 38852 year = {1994}, 38853 volume = {4}, 38854 pages = {208--227} 38855} 38856 38857@Article{ zhu.rockafellar:primal-dual, 38858 author = {C. Y. Zhu and R. T. Rockafellar}, 38859 title = {Primal-Dual Projected Gradient Algorithms for Extended Linear-Quadratic 38860 Programming}, 38861 journal = {SIAM Journal on Optimization}, 38862 year = {1993}, 38863 volume = {3}, 38864 pages = {751--783} 38865} 38866 38867@Article{ zhu:modified, 38868 author = {C. Y. Zhu}, 38869 title = {Modified Proximal Point Algorithm for Extended Linear--Quadratic Programming}, 38870 journal = {Computational Optimization and Applications}, 38871 year = {1992}, 38872 volume = {2}, 38873 pages = {182--205} 38874} 38875 38876@Article{ zhu:primal-dual, 38877 author = {C. Y. Zhu}, 38878 title = {On the Primal--Dual Steepest Descent Algorithm for Extended Linear--Quadratic 38879 Programming}, 38880 journal = {SIAM Journal on Optimization}, 38881 year = {1995}, 38882 volume = {5}, 38883 pages = {114--128} 38884} 38885 38886@Book{ zoutendijk:methods, 38887 author = {G. Zoutendijk}, 38888 title = {Methods of Feasible Directions}, 38889 year = {1960}, 38890 publisher = {Elsevier Publishing Company}, 38891 address = {Amsterdam} 38892} 38893 38894@Article{ zowe.kurcyusz:regularity, 38895 author = {J. Zowe and S. Kurcyusz}, 38896 title = {Regularity and Stability for Mathematical Programming in {B}anach Spaces}, 38897 journal = {Applied Mathematics and Optimization}, 38898 year = {1979}, 38899 volume = {5}, 38900 pages = {49--62} 38901} 38902 38903@InProceedings{ zowe:nondifferentiable, 38904 author = {J. Zowe}, 38905 title = {Nondifferentiable Optimization}, 38906 booktitle = {Computational Mathematical Programming}, 38907 year = {1985}, 38908 editor = {K. Schittkowski}, 38909 publisher = {Springer-Verlag}, 38910 address = {Berlin} 38911} 38912 38913@Proceedings{ bachem.grotschel.ea:mathematical, 38914 booktitle = {Mathematical Programming: The State of the Art, Bonn 1982}, 38915 title = {Mathematical Programming: The State of the Art, Bonn 1982}, 38916 year = {1983}, 38917 editor = {A. Bachem and M. Gr{\"{o}}tchel and B. Korte}, 38918 publisher = {Springer Verlag}, 38919 address = {Berlin} 38920} 38921 38922@Proceedings{ belew.booker:fourth, 38923 year = {1991}, 38924 editor = {R. K. Belew and L. B. Booker}, 38925 publisher = {Morgan Kaufmann Publishers, Inc}, 38926 address = {San Mateo, California}, 38927 booktitle = {Proceedings of the Fourth International Conference on Genetic Algorithms} 38928} 38929 38930@Proceedings{ coleman.li:large-scale, 38931 year = {1990}, 38932 editor = {T. F. Coleman and Y. Li}, 38933 publisher = {SIAM}, 38934 address = {Philadelphia, Pennsylvania}, 38935 note = {Proceedings of the Workshop on Large-Scale Numerical Optimization, Cornell 38936 University, Ithaca, New York, October 19-20, 1989}, 38937 booktitle = {Large-Scale Numerical Optimization} 38938} 38939 38940@Book{ davis:genetic, 38941 title = {Genetic Algorithms and Simulated Annealing}, 38942 year = {1987}, 38943 editor = {L. D. Davis}, 38944 publisher = {Pitman}, 38945 address = {London}, 38946 booktitle = {Genetic Algorithms and Simulated Annealing} 38947} 38948 38949@Proceedings{ ferris.pang:complementarity, 38950 title = {Complementarity and Variational Problems: State of the Art}, 38951 booktitle = {Complementarity and Variational Problems: State of the Art}, 38952 year = {1997}, 38953 key = {57}, 38954 editor = {M. C. Ferris and J. S. Pang}, 38955 publisher = {SIAM Publications}, 38956 address = {Philadelphia, Pennsylvania} 38957} 38958 38959@Proceedings{ ferris.mangasarian.ea:complementarity, 38960 title = {Complementarity: Applications, Algorithms and Extensions}, 38961 booktitle = {Complementarity: Applications, Algorithms and Extensions}, 38962 year = {2001}, 38963 key = {95}, 38964 editor = {M. C. Ferris and O.L. Mangasarian and J. S. Pang}, 38965 publisher = {Kluwer Academic Publishers}, 38966 address = {Dordrecht, The Netherlands} 38967} 38968 38969@Proceedings{ florian:traffic, 38970 title = {Traffic Equilibrium Methods}, 38971 year = {1976}, 38972 editor = {M. Florian}, 38973 publisher = {Springer-Verlag}, 38974 address = {Berlin} 38975} 38976 38977@Proceedings{ grefenstette:genetic, 38978 title = {Genetic Algorithms and their Applications: Proceedings of the Second 38979 International Conference on Genetic Algorithms}, 38980 year = {1987}, 38981 editor = {J. J. Grefenstette}, 38982 publisher = {Lawrence Erlbaum Associates}, 38983 address = {Hillsdale, New Jersey}, 38984 booktitle = {Genetic Algorithms and their Applications: Proceedings of the Second 38985 International Conference on Genetic Algorithms} 38986} 38987 38988@Proceedings{ mangasarian.meyer.ea:nonlinear*2, 38989 booktitle = {Nonlinear Programming}, 38990 volume = {2}, 38991 editor = {O. L. Mangasarian and R. R. Meyer and S. M. Robinson}, 38992 publisher = {Academic Press}, 38993 address = {New York}, 38994 year = {1975} 38995} 38996 38997@Proceedings{ mangasarian.meyer.ea:nonlinear*3, 38998 booktitle = {Nonlinear Programming}, 38999 volume = {3}, 39000 editor = {O. L. Mangasarian and R. R. Meyer and S. M. Robinson}, 39001 publisher = {Academic Press}, 39002 address = {London}, 39003 year = {1978} 39004} 39005 39006@Proceedings{ robinson:local, 39007 title = {Local Structure of Feasible Sets in Nonlinear Programming, {P}art~{I}: 39008 Regularity}, 39009 year = {1983}, 39010 editor = {V. Pereyra and A. Reinoza}, 39011 publisher = {Springer-Verlag}, 39012 address = {Berlin}, 39013 author = {S. M. Robinson}, 39014 pages = {240--251}, 39015 series = {Numerical Methods: Proceedings, Caracas 1982} 39016} 39017 39018@Proceedings{ schaeffer:third, 39019 year = {1989}, 39020 editor = {J. D. Schaeffer}, 39021 publisher = {Morgan Kaufmann Publishers, Inc}, 39022 address = {San Mateo, California}, 39023 booktitle = {Proceedings of the Third International Conference on Genetic Algorithms} 39024} 39025 39026@Book{ vanderbei:linear, 39027 author = {R. J. Vanderbei}, 39028 title = {Linear Programming: Foundations and Extensions}, 39029 year = {1997}, 39030 publisher = {Kluwer Academic Publishers}, 39031 address = {Boston, Massachusetts} 39032} 39033 39034@Book{ dfobook, 39035 title = {Introduction to Derivative-Free Optimization}, 39036 publisher = {Society for Industrial and Applied Mathematics}, 39037 year = {2009}, 39038 author = {Andrew R. Conn and Katya Scheinberg and Lu\'is N. Vicente}, 39039 series = {MPS/SIAM Series on Optimization}, 39040 address = {Philadelphia, PA, USA}, 39041 isbn = {0-89871-460-5} 39042} 39043 39044@Article{ unedf0, 39045 author = {{Kortelainen}, M. and {Lesinski}, T. and {Mor{\'e}}, J. and {Nazarewicz}, W. and 39046 {Sarich}, J. and {Schunck}, N. and {Stoitsov}, M.~V. and {Wild}, S.~M.}, 39047 title = {Nuclear Energy Density Optimization}, 39048 journal = {Physical Review C}, 39049 year = {2010}, 39050 volume = {82}, 39051 number = {2}, 39052 pages = {024313}, 39053 doi = {10.1103/PhysRevC.82.024313} 39054} 39055 39056@Article{ hestenes1969multiplier, 39057 title = {Multiplier and gradient methods}, 39058 author = {Hestenes, Magnus R}, 39059 journal = {Journal of optimization theory and applications}, 39060 volume = {4}, 39061 number = {5}, 39062 pages = {303--320}, 39063 year = {1969}, 39064 publisher = {Springer} 39065} 39066 39067@Article{ powell1969method, 39068 title = {A method for nonlinear constraints in minimization problems}, 39069 author = {Powell, Michael JD}, 39070 journal = {Optimization}, 39071 pages = {283--298}, 39072 year = {1969}, 39073 publisher = {Academic Press} 39074} 39075 39076@Book{ nocedal2006numerical, 39077 title = {Numerical optimization}, 39078 author = {Jorge Nocedal and Stephen Wright}, 39079 year = {2006}, 39080 publisher = {Springer Science \& Business Media} 39081} 39082 39083@Article{ rockafellar1974augmented, 39084 title = {Augmented Lagrange multiplier functions and duality in nonconvex programming}, 39085 author = {Rockafellar, R Tyrrell}, 39086 journal = {SIAM Journal on Control}, 39087 volume = {12}, 39088 number = {2}, 39089 pages = {268--285}, 39090 year = {1974}, 39091 publisher = {SIAM} 39092} 39093 39094@Article{ bacuta2006, 39095 title = {A unified approach for Uzawa algorithms}, 39096 author = {Constantin Bacuta}, 39097 journal = {SIAM Journal on Numerical Analysis}, 39098 volume = {44}, 39099 number = {6}, 39100 pages = {2633--2649}, 39101 year = {2006} 39102} 39103 39104@Article{ manteuffelrugesouthworth2018, 39105 title = {Nonsymmetric algebraic multigrid based on local approximate ideal restriction 39106 (AIR)}, 39107 author = {Thomas A Manteuffel and John Ruge and Ben S Southworth}, 39108 journal = {SIAM Journal on Scientific Computing}, 39109 volume = {40}, 39110 number = {6}, 39111 pages = {A4105--A4130}, 39112 year = {2018} 39113} 39114 39115@Article{ manteuffelmunzenmaierrugesouthworth2019, 39116 title = {Nonsymmetric reduction-based algebraic multigrid}, 39117 author = {Thomas A Manteuffel and Steffen M\"unzenmaier and John Ruge and Ben S Southworth}, 39118 journal = {SIAM Journal on Scientific Computing}, 39119 volume = {41}, 39120 number = {5}, 39121 pages = {S242--S268}, 39122 year = {2019} 39123} 39124 39125@PhDThesis{ sivas2021, 39126 title = {Preconditioning of HDG for the Navier–Stokes Equations}, 39127 author = {Abdullah Ali Sivas}, 39128 department = {Applied Mathematics}, 39129 institution = {University of Waterloo}, 39130 year = {2021} 39131} 39132 39133@Article{ brookshughes1982, 39134 title = {Streamline upwind/{Petrov-Galerkin} formulations for convection dominated flows 39135 with particular emphasis on the incompressible {Navier-Stokes} equations}, 39136 author = {Alexander N Brooks and Thomas JR Hughes}, 39137 journal = {Computer methods in applied mechanics and engineering}, 39138 volume = {32}, 39139 number = {1-3}, 39140 pages = {199--259}, 39141 year = {1982}, 39142 publisher = {Elsevier} 39143} 39144 39145@InProceedings{ suhisaac2020, 39146 title = {Evaluation of a minimally synchronous algorithm for 2: 1 octree balance}, 39147 author = {Hansol Suh and Tobin Isaac}, 39148 booktitle = {SC20: International Conference for High Performance Computing, Networking, 39149 Storage and Analysis}, 39150 pages = {1--12}, 39151 year = {2020}, 39152 organization = {IEEE} 39153} 39154 39155@Misc{ alauzet2010, 39156 title = {Metric-Based Anisotropic Mesh Adaptation}, 39157 author = {Fr\'{e}d\'{e}ric Alauzet}, 39158 howpublished = {\url{https://pages.saclay.inria.fr/frederic.alauzet/cours/cea2010_V3.pdf}}, 39159 year = {2010} 39160} 39161 39162@Article{ chan1994qmrcgs, 39163 title = {A quasi-minimal residual variant of the {Bi-CGSTAB} algorithm for nonsymmetric 39164 systems}, 39165 author = {Chan, Tony F and Gallopoulos, Efstratios and Simoncini, Valeria and Szeto, Tedd 39166 and Tong, Charles H}, 39167 journal = {SIAM Journal on Scientific Computing}, 39168 volume = {15}, 39169 number = {2}, 39170 pages = {338--347}, 39171 year = {1994}, 39172 publisher = {SIAM} 39173} 39174 39175@Article{ ghai2019comparison, 39176 title = {A comparison of preconditioned {K}rylov subspace methods for large-scale 39177 nonsymmetric linear systems}, 39178 author = {Ghai, Aditi and Lu, Cao and Jiao, Xiangmin}, 39179 journal = {Numerical Linear Algebra with Applications}, 39180 volume = {26}, 39181 number = {1}, 39182 pages = {e2215}, 39183 year = {2019}, 39184 publisher = {Wiley Online Library} 39185} 39186 39187@Article{ mishrasalacknepley2022, 39188 title = {On the order of accuracy for finite difference approximations of partial 39189 differential equations using stencil composition}, 39190 author = {Abhishek Mishra and David Salac and Matthew G. Knepley}, 39191 journal = {International Journal on Numerical Methods in Engineering}, 39192 note = {Submitted}, 39193 year = {2022} 39194} 39195 39196@Article{ nathawaniknepley2022, 39197 title = {Droplet formation simulation using mixed finite elements}, 39198 author = {Darsh K. Nathawani and Matthew G. Knepley}, 39199 journal = {Physics of Fluids}, 39200 volume = {34}, 39201 pages = {064105}, 39202 doi = {10.1063/5.0089752}, 39203 year = {2022} 39204} 39205 39206@InProceedings{ nathawaniknepley2022b, 39207 title = {Simulating Paraffin Wax Droplets Using Mixed Finite Element Method}, 39208 author = {Darsh K. Nathawani and Matthew G. Knepley}, 39209 booktitle = {Proceeedings of the International Conference on Computational Fluid Dynamics 11 39210 (ICCFD11)}, 39211 editor = {Christoph Brehm and Shishir Pandya}, 39212 number = {4103}, 39213 year = {2022} 39214} 39215 39216@Article{ nathawaniknepley2023, 39217 title = {A one-dimensional mathematical model for shear-induced droplet formation in co-flowing fluids}, 39218 author = {Darsh K. Nathawani and Matthew G. Knepley}, 39219 journal = {Theoretical and Computational Fluid Dynamics}, 39220 url = {https://rdcu.be/dFtlR}, 39221 doi = {10.1007/s00162-024-00690-5}, 39222 year = {2024} 39223} 39224 39225@InProceedings{ georgalisnathawaniknepleypatra2023, 39226 title = {Uncertainty Quantification of Shear-induced Paraffin Droplet Pinch-off in Hybrid Rocket Motors}, 39227 author = {Georgios Georgalis and Darsh K. Nathawani and Matthew G. Knepley and Abani 39228 Patra}, 39229 booktitle = {AIAA SciTech 2024}, 39230 note = {Accepted}, 39231 year = {2023} 39232} 39233 39234@Article{ brownbarrabeamsghaffariknepleymosesshakeristengelthompsonzhang2022, 39235 title = {Performance Portable Solid Mechanics via Matrix-Free $p$-Multigrid}, 39236 author = {Jed Brown and Valeria Barra and Natalie Beams and Leila Ghaffari and Matthew 39237 Knepley and William Moses and Rezgar Shakeri and Karen Stengel and Jeremy L. 39238 Thompson and Junchao Zhang}, 39239 doi = {10.48550/ARXIV.2204.01722}, 39240 url = {https://arxiv.org/abs/2204.01722}, 39241 publisher = {arXiv}, 39242 note = {Submitted}, 39243 year = {2022} 39244} 39245 39246@InCollection{ mayknepley2023, 39247 title = {Numerical Modeling of Subduction}, 39248 author = {Dave A. May and Matthew G. Knepley}, 39249 booktitle = {Dynamics of Plate Tectonics and Mantle Convection}, 39250 editor = {João C. Duarte}, 39251 pages = {539-571}, 39252 isbn = {978-0-323-85733-8}, 39253 doi = {https://doi.org/10.1016/B978-0-323-85733-8.00020-2}, 39254 url = {https://www.sciencedirect.com/science/article/pii/B9780323857338000202}, 39255 year = {2023} 39256} 39257 39258@Article{ adamsknepley2023, 39259 title = {A bespoke multigrid approach for magnetohydrodynamics models of magnetized 39260 plasmas in {PETSc}}, 39261 author = {Mark F. Adams and Matthew G. Knepley}, 39262 url = {https://arxiv.org/abs/2302.10242}, 39263 note = {In preparation}, 39264 year = {2023}, 39265 petsc_uses = {DMPlex} 39266} 39267 39268@Article{ finnknepleypusztayadams2023, 39269 title = {A Numerical Study of {Landau} Damping with {PETSc-PIC}}, 39270 author = {Daniel S. Finn and Matthew G. Knepley and Joseph V. Pusztay and Mark F. Adams}, 39271 url = {https://arxiv.org/abs/2303.12620}, 39272 journal = {Communications in Applied Mathematics and Computational Science}, 39273 volume = {18}, 39274 number = {1}, 39275 pages = {135--152}, 39276 doi = {10.2140/camcos.2023.18.135}, 39277 year = {2023} 39278} 39279 39280@Article{ hamhaplaknepleymitchellsagiyama2024, 39281 title = {Efficient N-to-M Checkpointing Algorithm for Finite Element Simulations}, 39282 author = {David A. Ham and Vaclav Hapla and Matthew G. Knepley and Lawrence Mitchell and Koki Sagiyama}, 39283 journal = {SIAM Journal on Scientific Computing}, 39284 note = {Under review}, 39285 url = {https://arXiv.org/abs/2401.05868}, 39286 year = {2024}, 39287 petsc_uses = {DMPlex} 39288} 39289 39290@Article{ eggersdupont1994, 39291 title = {Drop formation in a one-dimensional approximation of the {Navier--Stokes} 39292 equation}, 39293 author = {Jens Eggers and Todd F. Dupont}, 39294 journal = {Journal of fluid mechanics}, 39295 volume = {262}, 39296 pages = {205--221}, 39297 year = {1994}, 39298 publisher = {Cambridge University Press} 39299} 39300 39301@PhDThesis{ pusztaythesis2023, 39302 title = {A Particle Basis Vlasov-Poisson-Landau Solver for Plasma Simulation in PETSc}, 39303 author = {Joseph V. Pusztay}, 39304 type = {{PhD} thesis}, 39305 school = {University at Buffalo, Department of Computer Science and Engineering}, 39306 address = {Buffalo, NY}, 39307 month = may, 39308 year = {2022} 39309} 39310 39311@PhDThesis{ finnthesis2023, 39312 title = {Structure-Preserving Particle-In-Cell Methods for the Vlasov-Poisson-Landau 39313 System}, 39314 author = {Daniel S. Finn}, 39315 type = {{PhD} thesis}, 39316 school = {University at Buffalo, Program in Computational and Data-Enabled Science and 39317 Engineering}, 39318 address = {Buffalo, NY}, 39319 month = may, 39320 year = {2023} 39321} 39322 39323@PhDThesis{ nathawanithesis2023, 39324 title = {Droplet Formation: One-dimensional Mathematical Model and Computations}, 39325 author = {Darsh Kiritbhai Nathawani}, 39326 type = {{PhD} thesis}, 39327 school = {University at Buffalo, Program in Computational and Data-Enabled Science and 39328 Engineering}, 39329 address = {Buffalo, NY}, 39330 month = may, 39331 year = {2023} 39332} 39333 39334@article{MckayEriksonKozdon2019, 39335 title = {A computational method for earthquake cycles within anisotropic media}, 39336 author = {Maricela Best Mckay and Brittany A Erickson and Jeremy E Kozdon}, 39337 journal = {Geophysical Journal International}, 39338 volume = {219}, 39339 number = {2}, 39340 pages = {816--833}, 39341 year = {2019}, 39342} 39343 39344@article{EricksonOReillyNordstrom2019, 39345 title = {Accuracy of stable, high-order finite difference methods for hyperbolic systems with non-smooth wave speeds}, 39346 author = {Brittany A Erickson and Ossian O’Reilly and Jan Nordstr{\"o}m}, 39347 journal = {Journal of Scientific Computing}, 39348 volume = {81}, 39349 pages = {2356--2387}, 39350 year = {2019}, 39351} 39352 39353@article{KozdonEricksonWilcox2021, 39354 title = {Hybridized summation-by-parts finite difference methods}, 39355 author = {Jeremy E Kozdon and Brittany A Erickson and Lucas C Wilcox}, 39356 journal = {Journal of Scientific Computing}, 39357 volume = {87}, 39358 number = {3}, 39359 pages = {85}, 39360 year = {2021}, 39361} 39362 39363@article{SEAS2022, 39364 title = {Community-driven code comparisons for three-dimensional dynamic modeling of sequences of earthquakes and aseismic slip}, 39365 author = {Junle Jiang and Brittany A Erickson and Val{\`e}re R Lambert and Jean-Paul Ampuero and Ryosuke Ando and Sylvain D Barbot and Camilla Cattania and Luca Dal Zilio and Benchun Duan and Eric M Dunham and Alice-Agnes Gabriel and Nadia Lapusta and Duo Li and Meng Li and Dunyu Liu and Yajing Liu and So Ozawa and Casper Pranger and Ylona van Dinther}, 39366 journal = {Journal of Geophysical Research: Solid Earth}, 39367 volume = {127}, 39368 number = {3}, 39369 pages = {e2021JB023519}, 39370 year = {2022}, 39371} 39372 39373@article{EricksonKozdonHarvey2022, 39374 title = {A non-stiff summation-by-parts finite difference method for the scalar wave equation in second order form: Characteristic boundary conditions and nonlinear interfaces}, 39375 author = {Brittany A Erickson and Jeremy E Kozdon and Tobias Harvey}, 39376 journal = {Journal of Scientific Computing}, 39377 volume = {93}, 39378 number = {1}, 39379 pages = {17}, 39380 year = {2022}, 39381} 39382 39383@article{RuckerEriksonKarlstromLeeGopalakrishnan2022, 39384 title = {A Computational Framework for Time-Dependent Deformation in Viscoelastic Magmatic Systems}, 39385 author = {Cody Rucker and Brittany A Erickson and Leif Karlstrom and Brian Lee and Jay Gopalakrishnan}, 39386 journal = {Journal of Geophysical Research: Solid Earth}, 39387 volume = {127}, 39388 number = {9}, 39389 pages = {e2022JB024506}, 39390 year = {2022}, 39391} 39392 39393@article{HarveyEriksonKozdon2023, 39394 title = {A High-order Accurate Summation-by-Parts Finite Difference Method for Fully-dynamic Earthquake Sequence Simulations within Sedimentary Basins}, 39395 author = {Tobias W Harvey and Brittany A Erickson and Jeremy E Kozdon}, 39396 journal = {Journal of Geophysical Research: Solid Earth}, 39397 pages = {e2022JB025357}, 39398 year = {2023}, 39399} 39400 39401@article{SEAS2023, 39402 title = {Incorporating full elastodynamic effects and dipping fault geometries in community code verification exercises for simulations of earthquake sequences and aseismic slip {(SEAS)}}, 39403 author = {Brittany A Erickson and Junle Jiang and Val{\`e}re Lambert and Sylvain D Barbot and Mohamed Abdelmeguid and Martin Almquist and Jean-Paul Ampuero and Ryosuke Ando and Camilla Cattania and Alexandre Chen and Luca Dal Zilio and Shuai Deng and Eric M. Dunham and Ahmed E. Elbanna and Alice‐Agnes Gabriel and Tobias W. Harvey and Yihe Huang and Yoshihiro Kaneko and Jeremy E. Kozdon and Nadia Lapusta and Duo Li and Meng Li and Chao Liang and Yajing Liu and So Ozawa and Andrea Perez‐Silva and Casper Pranger and Paul Segall and Yudong Sun and Prithvi Thakur and Carsten Uphoff and Ylona van Dinther and Yuyun Yang}, 39404 journal = {Bulletin of the Seismological Society of America}, 39405 volume = {113}, 39406 number = {2}, 39407 pages = {499--523}, 39408 year = {2023}, 39409} 39410 39411@article{ErwayMarcia2017, 39412 title = {On solving large-scale limited-memory quasi-{N}ewton equations}, 39413 author = {Erway, Jennifer B and Marcia, Roummel F}, 39414 journal = {Linear Algebra and its Applications}, 39415 volume = {515}, 39416 pages = {196--225}, 39417 year = {2017}, 39418 publisher = {Elsevier}, 39419} 39420 39421@article{Ritto-CorreaCamotim2008, 39422 title={On the arc-length and other quadratic control methods: Established, less known and new implementation procedures}, 39423 volume={86}, 39424 ISSN={0045-7949}, 39425 DOI={10.1016/j.compstruc.2007.08.003}, 39426 number={11}, 39427 journal={Computers & Structures}, 39428 author={Ritto-Corr{\^{e}}a, Manuel and Camotim, Dinar}, 39429 year={2008}, 39430 month=jun, 39431 pages={1353-1368}, 39432} 39433 39434 39435@article{LeonPaulinoPereiraMenezesLages_2011, 39436 title={A Unified Library of Nonlinear Solution Schemes}, 39437 volume={64}, 39438 ISSN={0003-6900, 2379-0407}, 39439 DOI={10.1115/1.4006992}, 39440 number={4}, 39441 journal={Applied Mechanics Reviews}, 39442 author={Leon, Sofie E. and Paulino, Glaucio H. and Pereira, Anderson and Menezes, Ivan F. M. and Lages, Eduardo N.}, 39443 year={2011}, 39444 month=jul, 39445 pages={040803}, 39446} 39447