1% 2% This file is formatted by: 3% bibtool petsc.bib -- expand.macros=on -- print.line.length=100 -- pass.comments=on 4% 5% If the reference uses PETSc, include a field listing components used, e.g. 6% petsc_uses = {KSP, SNES, TS, TAO}, 7% 8% For journal names, write out the full name, do not define abbreviations 9% 10% There are some additional historical comments below which may be of interest, 11% particularly in terms of notes about particularly impactful publications using PETSc. 12% 13 14% LiteralHTML: 15% LiteralHTML: <H2><center>Research and Publications that make use of PETSc</center></H2> 16% LiteralHTML: 17% LiteralHTML: <a name="nano"><H3><center>Nano-simulations</center></H3> 18% LiteralHTML: 19@book{deuflhard2011, 20 title = {Newton Methods for Nonlinear Problems}, 21 author = {Peter Deuflhard}, 22 volume = {35}, 23 year = {2011}, 24 isbn = {978-3-642-23898-7}, 25 doi = {10.1007/978-3-642-23899-4}, 26 publisher = {Springer-Verlag}, 27 address = {Berlin, Heidelberg} 28} 29 30@article{ketcheson2010runge, 31 title = {Runge--Kutta methods with minimum storage implementations}, 32 author = {Ketcheson, David I}, 33 journal = {Journal of Computational Physics}, 34 volume = {229}, 35 number = {5}, 36 pages = {1763--1773}, 37 year = {2010}, 38 publisher = {Elsevier} 39} 40 41@article{WalkerNi2011, 42 title = {Anderson acceleration for fixed-point iterations}, 43 author = {Homer F Walker and Peng Ni}, 44 journal = {SIAM Journal on Numerical Analysis}, 45 volume = {49}, 46 number = {4}, 47 pages = {1715--1735}, 48 year = {2011}, 49 publisher = {SIAM} 50} 51 52@article{Hua2007, 53 title = {Numerical simulation of microdroplet formation in coflowing immiscible liquids}, 54 author = {Hua, Jinsong and Zhang, Baili and Lou, Jing}, 55 journal = {AIChE Journal}, 56 volume = {53}, 57 number = {10}, 58 pages = {2534--2548}, 59 year = {2007}, 60 publisher = {Wiley Online Library} 61} 62 63@Article{ openblas, 64 title = {OpenBLAS: A High Performance BLAS Library on Loongson 3A CPU}, 65 journal = {Journal of Software}, 66 volume = {22}, 67 pages = {208--216}, 68 year = {2011}, 69 url = {https://www.jos.org.cn/josen/article/abstract/11042}, 70 author = {ZHANG Xian-Yi and WANG Qian and ZHANG Yun-Quan Richard} 71} 72 73@Misc{ openblas-website, 74 title = {{OpenBLAS}}, 75 key = {OpenBLAS}, 76 howpublished = {\url{https://www.openblas.net}} 77} 78 79@Misc{ openacc-website, 80 title = {{OpenACC}}, 81 key = {OpenACC}, 82 howpublished = {\url{https://www.openacc.org}} 83} 84 85@Misc{ bueler2020petsc, 86 title = {PETSc for Partial Differential Equations: Numerical Solutions in C and Python}, 87 author = {Bueler, Ed}, 88 year = {2020}, 89 publisher = {SIAM}, 90 petsc_uses = {KSP} 91} 92 93@TechReport{ petscforgpuexascale, 94 title = {Toward Performance-Portable PETSc for GPU-based Exascale Systems}, 95 author = {Richard Tran Mills and Mark F. Adams and Satish Balay and Jed Brown and Alp Dener 96 and Matthew Knepley and Scott E. Kruger and Hannah~Morgan and Todd Munson and Karl 97 Rupp and Barry F. Smith and Stefano Zampini and Hong Zhang and Junchao Zhang}, 98 institution = {Argonne National Laboratory}, 99 number = {ANL/MCS-P9401-1020}, 100 note = {\url{https://arxiv.org/abs/2011.00715}}, 101 year = {2020}, 102 petsc_uses = {KSP} 103} 104 105@Article{ mills2021, 106 title = {Toward performance-portable {PETS}c for {GPU}-based exascale systems}, 107 journal = {Parallel Computing}, 108 volume = {108}, 109 pages = {102831}, 110 year = {2021}, 111 issn = {0167-8191}, 112 doi = {https://doi.org/10.1016/j.parco.2021.102831}, 113 url = {https://www.sciencedirect.com/science/article/pii/S016781912100079X}, 114 author = {Richard Tran Mills and Mark F. Adams and Satish Balay and Jed Brown and Alp Dener 115 and Matthew Knepley and Scott E. Kruger and Hannah Morgan and Todd Munson and Karl 116 Rupp and Barry F. Smith and Stefano Zampini and Hong Zhang and Junchao Zhang} 117} 118 119@Article{ rupp:2016:pis:2988256.2907944, 120 author = {Karl Rupp and Josef Weinbub and Ansgar J\"{u}ngel and Tibor Grasser}, 121 title = {Pipelined Iterative Solvers with Kernel Fusion for Graphics Processing Units}, 122 journal = {ACM Trans. Math. Softw.}, 123 issue_date = {September 2016}, 124 volume = {43}, 125 number = {2}, 126 month = aug, 127 year = {2016}, 128 issn = {0098-3500}, 129 pages = {11:1--11:27}, 130 articleno = {11}, 131 numpages = {27}, 132 doi = {10.1145/2907944}, 133 acmid = {2907944}, 134 publisher = {ACM}, 135 address = {New York, NY, USA}, 136 keywords = {BiCGStab method, CUDA, GMRES method, GPU, Iterative solvers, OpenCL, conjugate 137 gradient method}, 138 petsc_uses = {KSP} 139} 140 141@Article{ dalcin2011parallel, 142 title = {Parallel distributed computing using python}, 143 author = {Dalcin, Lisandro D and Paz, Rodrigo R and Kler, Pablo A and Cosimo, Alejandro}, 144 journal = {Advances in Water Resources}, 145 volume = {34}, 146 number = {9}, 147 pages = {1124--1139}, 148 year = {2011}, 149 publisher = {Elsevier}, 150 petsc_uses = {KSP} 151} 152 153@Article{ mendezpongaortiz2018, 154 title = {Diffusive molecular dynamics simulations of lithiation of silicon nanopillars}, 155 author = {JP Mendez and M Ponga and M Ortiz}, 156 journal = {Journal of the Mechanics and Physics of Solids}, 157 year = {2018}, 158 petsc_uses = {KSP} 159} 160 161@TechReport{ morgan2020evaluation, 162 title = {Evaluation of {PETS}c on a Heterogeneous Architecture, the {OLCF} {S}ummit 163 System: Part 1: Vector Node Performance}, 164 author = {Morgan, Hannah Mairs and Mills, Richard Tran and Smith, Barry}, 165 year = {2020}, 166 institution = {Argonne National Laboratory}, 167 url = {https://publications.anl.gov/anlpubs/2020/04/159190.pdf}, 168 petsc_uses = {KSP} 169} 170 171@TechReport{ pdeconstrainedspectraladjoints, 172 title = {PDE constrained optimization, error estimation and control with spectral elements 173 using PETSc and TAO}, 174 author = {Oana Marin and Emil Constantinescu and Barry Smith}, 175 type = {Preprint}, 176 number = {ANL/MCS-P9031-1117}, 177 institution = {ANL}, 178 month = nov, 179 year = {2017}, 180 petsc_uses = {KSP} 181} 182 183@InProceedings{ asc2013, 184 author = {S. Abhyankar and B. F. Smith and E. Constantinescu}, 185 title = {Evaluation of overlapping restricted additive Schwarz preconditioning for 186 parallel solution of very large power flow problems}, 187 booktitle = {HiPCNA-PG’13}, 188 year = {2013}, 189 petsc_uses = {KSP} 190} 191 192@InProceedings{ as2013, 193 author = {S. Abhyankar and B. F. Smith}, 194 title = {{PETSc:} An Advanced Math and Computing Framework for Rapidly Developing Parallel 195 Smart Grid Applications}, 196 booktitle = {Proceedings of the IEEE PES General Meeting}, 197 year = {2013}, 198 petsc_uses = {KSP} 199} 200 201@TechReport{ tspaper, 202 title = {{PETSc/TS}: A Modern Scalable {DAE/ODE} Solver Library}, 203 author = {Shrirang Abhyankar and Jed Brown and Emil Constantinescu and Debojyoti Ghosh and 204 Barry F. Smith}, 205 type = {Preprint}, 206 number = {ANL/MCS-P5061-0114}, 207 institution = {ANL}, 208 month = jan, 209 year = {2014}, 210 petsc_uses = {KSP} 211} 212 213@TechReport{ abhyankaretal2018, 214 author = {Shrirang Abhyankar and Jed Brown and Emil M. Constantinescu and Debojyoti Ghosh 215 and Barry F. Smith and Hong Zhang}, 216 title = {{PETSc/TS}: {A} Modern Scalable {ODE/DAE} Solver Library}, 217 journal = {arXiv e-preprints}, 218 eprint = {1806.01437}, 219 archiveprefix = {arXiv}, 220 year = {2018}, 221 petsc_uses = {KSP} 222} 223 224@Article{ zhang2021cams, 225 title = {Optimal checkpointing for adjoint multistage time-stepping schemes}, 226 author = {Hong Zhang and Emil M. Constantinescu}, 227 journal = {arXiv e-preprints}, 228 eprint = {2202.11890}, 229 archiveprefix = {arXiv}, 230 year = {2022}, 231 petsc_uses = {KSP} 232} 233 234@InProceedings{ zhangconstantinescu2021b, 235 title = {Revolve-based adjoint checkpointing for multistage time integration}, 236 author = {Hong Zhang and Emil M. Constantinescu}, 237 booktitle = {Proceedings of the International Conference on Computational Science (ICCS)}, 238 month = jun, 239 year = {2021}, 240 petsc_uses = {KSP} 241} 242 243@Article{ zhang2022tsadjoint, 244 author = {Zhang, Hong and Constantinescu, Emil M. and Smith, Barry F.}, 245 title = {{PETSc TSAdjoint: A Discrete Adjoint ODE Solver for First-Order and Second-Order 246 Sensitivity Analysis}}, 247 journal = {SIAM Journal on Scientific Computing}, 248 volume = {44}, 249 number = {1}, 250 pages = {C1-C24}, 251 year = {2022}, 252 doi = {10.1137/21M140078X}, 253 petsc_uses = {KSP} 254} 255 256@TechReport{ bb2008, 257 author = {Tomasz Blachowicz and Bartlomiej Baron}, 258 title = {A graphical extension for the Windows version of the Parallel Finite Element 259 Micromagnetics Package (MagParExt)}, 260 url = {http://arxiv.org/abs/0807.2655}, 261 year = {2008}, 262 petsc_uses = {KSP} 263} 264 265@Article{ jacvgv2008, 266 author = {R. Y. Jaafar and A Asenjo and O Chubykalo-Fesenko and M Vazquez and E M Gonzalez 267 and J L Vicent}, 268 title = {Field induced vortex dynamics in magnetic Ni nanotriangles}, 269 journal = {Nanotechnology}, 270 volume = {19}, 271 year = {2008}, 272 doi = {10.1088/0957-4484/19/28/285717}, 273 petsc_uses = {KSP} 274} 275 276@Article{ yjdwh2008, 277 author = {Lin Yuan and Jianjun Jiang and Gang Du and Zhongyou Wang and Huahui He}, 278 title = {Micromagnetic Simulation of Magnetic Particles with Surface Anisotropy}, 279 journal = {Journal of the Magnetics Society of Japan}, 280 volume = {32}, 281 year = {2008}, 282 pages = {50-53}, 283 url = {http://www.jstage.jst.go.jp/article/msjmag/32/2_1/32_50/_article}, 284 petsc_uses = {KSP} 285} 286 287@Article{ mtrtrsa2008, 288 author = {D. Makarov and S. Tibus and C. T. Rettner and T. Thomson and B. D. Terris and T. 289 Schrefl and M. Albrecht}, 290 title = {Magnetic strip patterns induced by focused ion beam irradiation}, 291 journal = {J. Appl. Phys.}, 292 volume = {103}, 293 year = {2008}, 294 doi = {10.1063/1.2894587}, 295 petsc_uses = {KSP} 296} 297 298@InProceedings{ tmrttsa2008, 299 author = {S. Tibus and D. Makarov and C. T. Rettner and T. Thomson and B. D. Terris and T. 300 Schrefl and M. Albrecht}, 301 title = {Patterning of magnetic films by focused ion beam irradiation}, 302 booktitle = {Intermag 2008 paper no. CM-05, submitted to IEEE Trans. Magn.}, 303 year = {2008}, 304 petsc_uses = {KSP} 305} 306 307@Article{ yjdbh2007, 308 author = {Lin Yuan and Jianju Jiang and Yongjiang di and Shaowei Bie and Huahui He}, 309 title = {Micromagnetic simulation of the magnetic dispersion angle and effective damping 310 factor for the single-phase soft magnetic films}, 311 journal = {J. Magn. Magn. Mater.}, 312 volume = {320}, 313 number = {7}, 314 pages = {1393-1397}, 315 doi = {10.1016/j.jmmm.2007.11.025}, 316 petsc_uses = {KSP} 317} 318 319@Article{ lxky2007, 320 author = {DENG Lian-wen and HUANG Xiao-zhong and ZH0U Ke-sheng and YANG}, 321 title = {Micromagnetic simulation and experimental study on microwave permeability of 322 nano-magnetic films}, 323 journal = {Transactions of Nonferrous Metals Society of China}, 324 year = {2007}, 325 pages = {756-759}, 326 url = {http://www.ysxbcn.com/icnfm2007/part2B/s0756.pdf}, 327 petsc_uses = {KSP} 328} 329 330@Article{ yjdwh2008a, 331 author = {Lin Yuan and Jianjun Jiang and Gang Du and Zhongyou Wang and Huahui He}, 332 title = {Micromagnetic Simulation of Magnetic Particles with Surface Anisotropy}, 333 journal = {Journal of the Magnetics Society of Japan}, 334 volume = {32}, 335 year = {2008}, 336 pages = {50-53}, 337 doi = {10.3379/msjmag.32.50}, 338 petsc_uses = {KSP} 339} 340 341@Article{ lylw2007, 342 author = {Ching-Ming Lee and L. X. Ye and J. M. Lee and Te-Ho Wu}, 343 title = {Micromagnetic study of magnetization reversal in patterned DyFeCo thin films}, 344 journal = {Phys. Stat. Sol.}, 345 volume = {204}, 346 number = {12}, 347 pages = {4049-4052}, 348 year = {2007}, 349 doi = {10.1002/pssa.200777359}, 350 petsc_uses = {KSP} 351} 352 353@InProceedings{ sg2007, 354 author = {Simon Greaves}, 355 title = {Micromagnetic Simulations of Magnetic Recording Media}, 356 booktitle = {High Performance Computing on Vector Systems 2007}, 357 doi = {10.1007/978-3-540-74384-2_17}, 358 petsc_uses = {KSP} 359} 360 361@Article{ bsc2007, 362 author = {Nadjib Benatmane and Werner Scholz and T.W. Clinton}, 363 title = {Magnetic Configurations and Phase Diagrams of sub-100 nm NiFe Nanorings}, 364 journal = {IEEE Trans. Magn.}, 365 volume = {43}, 366 year = {2007}, 367 pages = {2884-2886}, 368 doi = {10.1109/TMAG.2007.892867}, 369 petsc_uses = {KSP} 370} 371 372@Article{ ffbf, 373 author = {T. Fischbacher and M. Franchin and G. Bordignon and H. Fangohr}, 374 title = {A Systematic Approach to Multiphysics Extensions of Finite-Element-Based 375 Micromagnetic Simulations: Nmag.}, 376 journal = {IEEE Trans. Magn. Volume}, 377 volume = {43}, 378 pages = {2896-2898}, 379 doi = {10.1109/TMAG.2007.893843}, 380 petsc_uses = {KSP} 381} 382 383@InBook{ dfssfs2006, 384 author = {R. Dittrich and J. Fidler and D. Suess and W. Schol and H. Forster, T. Schrefl}, 385 chapter = {Computational Aspects of Micromagnetics}, 386 title = {The Science of Hysteresis}, 387 editor = { G. Bertotti and I. Mayergoyz}, 388 url = {http://books.elsevier.com/us/elsevier/us/subindex.asp?maintarget=&isbn=0124808743}, 389 petsc_uses = {KSP} 390} 391 392@InBook{ fss, 393 author = {J. Fidler and T. Schrefl and W. Scholz}, 394 chapter = {Computational Micromagnetics}, 395 title = {Handbook of Theoretical and Computational Nanotechnology}, 396 editor = {M. Rieth and W. Schommers}, 397 url = {http://www.amazon.com/gp/product/158883042X}, 398 petsc_uses = {KSP} 399} 400 401@InBook{ shbsef, 402 author = {Thomas Schrefl and Gino Hrkac and Simon Bance and Dieter Suess and Otmar Ertl and 403 Josef Fidler}, 404 chapter = {Numerical Methods in Micromagnetics (Finite Element Method)}, 405 title = {Handbook of Magnetism and Advanced Magnetic Materials}, 406 editor = {Helmut Kronmueller and Stuart Parkin}, 407 doi = {10.1002/9780470022184.hmm203}, 408 petsc_uses = {KSP} 409} 410 411@InBook{ sfs, 412 author = {D. Suess and J. Fidler and T. Schrefl}, 413 chapter = {Micromagnetic Simulation of magnetic materials}, 414 title = {Handbook of Magnetic Materials}, 415 editor = {K. H. J. Buschow}, 416 url = {http://www.amazon.com/gp/product/0444518509}, 417 petsc_uses = {KSP} 418} 419 420@Article{ fsxzs, 421 author = {J. Fernandez-de-Castro and Xiao Shen and Jianhua Xue and Yuming Zhou and S. 422 Sharma}, 423 title = {Writer Flux Closure and Transition Degradation Mechanism in Perpendicular 424 Recording.}, 425 journal = {IEEE Trans. Magn. Volume}, 426 volume = {43}, 427 pages = {2175-2177}, 428 doi = {10.1109/TMAG.2007.893122}, 429 petsc_uses = {KSP} 430} 431 432@Article{ sb2006, 433 author = {W. Scholz and S. Batra}, 434 title = {Effect of write current waveform on magnetization and head field dynamics of 435 perpendicular recording heads}, 436 journal = {IEEE Trans. Magn.}, 437 volume = {42}, 438 year = {2006}, 439 pages = {2264--2266}, 440 url = {http://magnet.atp.tuwien.ac.at/scholz/projects/papers/ieee/scholz_2006_42_2264.pdf}, 441 petsc_uses = {KSP} 442} 443 444@Article{ bsr2006, 445 author = {S. Batra and W. Scholz and T. Roscamp}, 446 title = {Effect of thermal fluctuation field on the noise performance of a perpendicular 447 recording system}, 448 journal = {J. Appl. Phys.}, 449 volume = {99}, 450 year = {2006}, 451 url = {http://magnet.atp.tuwien.ac.at/scholz/projects/papers/jap/batra_2006_99.pdf}, 452 petsc_uses = {KSP} 453} 454 455@InProceedings{ japios2006, 456 author = {F. Johnson and S. Amancherla and G.J. Parker and L.E. Iorio and P.R. 457 Subramanian}, 458 title = {Micromagnetic simulations of the dependence of domain wall width with grain size 459 in systems with cubic and uniaxial anisotropy.}, 460 booktitle = {Intermag 2006 Conference}, 461 petsc_uses = {KSP} 462} 463 464@Article{ kbmb2006, 465 author = {A. Kaya and M. Benakli and M.L. Mallary and J.A. Bain}, 466 title = {A Micromagnetic Study of the Effect of Spatial Variations in Damping in 467 Perpendicular Recording Heads}, 468 journal = {IEEE Trans. Magn.}, 469 volume = {42}, 470 year = {2006}, 471 pages = {2428--2430}, 472 doi = {10.1109/TMAG.2006.879430}, 473 petsc_uses = {KSP} 474} 475 476@Article{ cclcw2006, 477 author = {C. C. Chang and Y. C. Chang and C. M. Lee and C. C. Chen and J. Wu}, 478 title = {Control of Domain Wall Motion in Permalloy Ring}, 479 journal = {IEEE Trans. Magn.}, 480 volume = {42}, 481 year = {2006}, 482 pages = {2960--2962}, 483 doi = {10.1109/TMAG.2006.878414}, 484 petsc_uses = {KSP} 485} 486 487@Article{ bfmfzczg2007, 488 author = {Richard P. Boardman and Hans Fangohr and Matthew J. Fairman and J. Zimmermann and 489 Simon J. Cox and Alexander A. Zhukov and Peter A.J. de Groot}, 490 title = {Micromagnetic modelling of ferromagnetic cones}, 491 journal = {J. Magn. Magn. Mater.}, 492 volume = {312}, 493 year = {2007}, 494 pages = {234-238}, 495 url = {http://eprints.soton.ac.uk/45900/}, 496 petsc_uses = {KSP} 497} 498 499@PhDThesis{ rb2005, 500 author = {Richard Boardman}, 501 title = {Computer simulation studies of magnetic nanostructures}, 502 school = {Computational Engineering and Design Group, School of Engineering Sciences, 503 University of Southampton, United Kingdom}, 504 year = {2005}, 505 url = {http://www.soton.ac.uk/~rpb/thesis.pdf}, 506 petsc_uses = {KSP} 507} 508 509@InProceedings{ cwwy2006, 510 author = {I-Hsin Chung and Robert E. Walkup and Hui-Fang Wen and Hao Yu}, 511 title = {MPI Performance Analysis Tools on Blue Gene/L}, 512 booktitle = {ACM/IEEE SC 2006 Conference (SC'06)}, 513 year = {2006}, 514 url = {http://sc06.supercomputing.org/schedule/pdf/pap159.pdf}, 515 petsc_uses = {KSP} 516} 517 518@InProceedings{ ch2006, 519 author = {I.-H. Chung and J.K. Hollingsworth}, 520 title = {A Case Study Using Automatic Performance Tuning for Large-Scale Scientific 521 Programs}, 522 booktitle = {High Performance Distributed Computing, 2006 15th IEEE International Symposium}, 523 pages = {45--56}, 524 doi = {10.1109/HPDC.2006.1652135}, 525 petsc_uses = {KSP} 526} 527 528@Article{ lkpl2005, 529 author = {C. K. Lim and Y. S. Kim and N. Y. Park and J. Lee}, 530 title = {Multibit MRAM using a pair of memory cells}, 531 journal = {IEEE Trans. Magn.}, 532 volume = {41}, 533 year = {2005}, 534 pages = {2670-2672}, 535 doi = {10.1109/TMAG.2005.855288}, 536 petsc_uses = {KSP} 537} 538 539@Article{ gscn2005, 540 author = {K. Yu. Guslienko and W. Scholz and R. W. Chantrell and V. Novosad}, 541 title = {Vortex state oscillations in soft magnetic cylindrical dots}, 542 journal = {Phys. Rev. B}, 543 volume = {71}, 544 year = {2005}, 545 doi = {10.1103/PhysRevB.71.144407}, 546 petsc_uses = {KSP} 547} 548 549@PhDThesis{ mda, 550 author = {Massimiliano d'Aquino}, 551 title = {Nonlinear Magnetization Dynamics in Thin-Films and Nanoparticles}, 552 school = { Universita di Napoli Federico II.}, 553 url = {http://www.fedoa.unina.it/148/01/d_Aquino_thesis.pdf}, 554 petsc_uses = {KSP} 555} 556 557@TechReport{ ssdfssf2003, 558 author = {T. Schrefl and W. Scholz and R. Dittrich and H. Forster and D. Suess and M. 559 Stehno and J. Fidler}, 560 title = {Micromagnetic Simulations of Domainstructures in Softmagnetic Thin Films}, 561 url = {http://www.zid.tuwien.ac.at/projekte/2003/03-138-1.html}, 562 petsc_uses = {KSP} 563} 564 565@InProceedings{ sb2006a, 566 author = {W. Scholz and S. Batra}, 567 title = {Effect of write current waveform on magnetization and head field dynamics of 568 perpendicular recording heads}, 569 booktitle = {Intermag 2006 Conference, San Diego, CA, paper no. EF-03}, 570 petsc_uses = {KSP} 571} 572 573@Article{ scholz-batra1, 574 author = {W. Scholz and S. Batra}, 575 title = {Micromagnetic Simulation of Head Field and Write Bubble Dynamics in Perpendicular 576 Recording}, 577 journal = {IEEE Trans. Magn.}, 578 note = {submitted}, 579 year = {2005}, 580 petsc_uses = {KSP} 581} 582 583@Article{ scholz-batra2, 584 author = {W. Scholz and S. Batra}, 585 title = {Micromagnetic Modeling of Head Field Rise Time for High Data-Rate Recording}, 586 journal = {IEEE Trans. Magn.}, 587 volume = {41}, 588 year = {2005}, 589 pages = {702-706}, 590 petsc_uses = {KSP} 591} 592 593@Article{ daquino-scholz1, 594 author = {M. d'Aquino and W. Scholz and T. Schrefl and C. Serpico and J. Fidler}, 595 title = {Micromagnetic Analysis of Fast Precessional Switching}, 596 journal = {J. Magn. Magn. Mater.}, 597 volume = {290-291}, 598 year = {2005}, 599 pages = {510-513}, 600 petsc_uses = {KSP} 601} 602 603@Article{ aq-scholz-fid, 604 author = {M. d'Aquino and W. Scholz and T. Schrefl and C. Serpico and J. Fidler}, 605 title = {Numerical and analytical study of fast precessional switching}, 606 journal = {J. Appl. Phys.}, 607 volume = {95}, 608 year = {2004}, 609 pages = {7055-7057}, 610 petsc_uses = {KSP} 611} 612 613@InProceedings{ gar-tabik-gar, 614 author = {E. M. Garzon and S. Tabik and I. Garcia and A. R. Bretones}, 615 title = {Multiprocessing of the Time Domain Analysis of Thin-Wire Antennas and 616 Scatterers}, 617 booktitle = {12th Euromicro Conference on Parallel, Distributed and Network-Based Processing 618 (PDP'04)}, 619 year = {2004}, 620 pages = {80--}, 621 petsc_uses = {KSP} 622} 623 624@InProceedings{ aq-scholz-mia, 625 author = {M. d'Aquino and W. Scholz and T. Schrefl and C. Serpico and G. Miano}, 626 title = {Analysis of fast precessional switching in magnetic thin films}, 627 booktitle = {Proceedings of PIERS (Progress In Electromagnetic Research Symposium)}, 628 year = {2004}, 629 pages = {257-260}, 630 petsc_uses = {KSP} 631} 632 633@Article{ scholz-fid-seus, 634 author = {W. Scholz and J. Fidler and T. Schrefl and D. Suess and H. Forster and R. 635 Dittrich and V. Tsiantos}, 636 title = {Numerical Micromagnetic Simulation of Fe-Pt Nanoparticles with Multiple Easy 637 Axes}, 638 journal = {J. Magn. Magn. Mater.}, 639 year = {2004}, 640 pages = {1524-1525}, 641 petsc_uses = {KSP} 642} 643 644@Article{ boardman-zimmerman, 645 author = {Richard Boardman and Juergen Zimmermann and Hans Fangohr and Alexander Zhukov and 646 Peter de Groot}, 647 title = {Micromagnetic simulation studies of ferromagnetic part-spheres}, 648 journal = {Journal of Applied Physics}, 649 year = {2005}, 650 petsc_uses = {KSP} 651} 652 653@Article{ lim-kim-park, 654 author = {C. K. Lim and Y. S. Kim and N. Y. Park and J. Lee}, 655 title = {High Density Magnetic Random Access Memory Using a Pair of Asymmetrical Cell}, 656 journal = {IEEE Trans. Magn.}, 657 note = {submitted}, 658 petsc_uses = {KSP} 659} 660 661@Article{ scholz-suess2, 662 author = {W. Scholz and D. Suess and T. Schrefl and and J. Fidler}, 663 title = {Micromagnetic simulation of magnetization reversal in small particles with 664 surface anisotropy}, 665 journal = {J. Appl. Phys.}, 666 volume = {95}, 667 year = {2004}, 668 pages = {6807-6809}, 669 petsc_uses = {KSP} 670} 671 672@Article{ scholz-schrefl1, 673 author = {W. Scholz and T. Schrefl and J. Fidler and T. Matthias and D. Suess and V. 674 Tsiantos}, 675 title = {Micromagnetic simulation of the pinning and depinning process in permanent 676 magnets}, 677 journal = {IEEE Trans. Magn.}, 678 volume = {39}, 679 year = {2003}, 680 pages = {2920-2922}, 681 petsc_uses = {KSP} 682} 683 684@Article{ scholz-guslienko, 685 author = {W. Scholz and K. Y. Guslienko and V. Novosad and D. Suess and T. Schrefl and R. 686 W. Chantrell and J. Fidler}, 687 title = {Transition from single-domain to vortex state in soft magnetic cylindrical 688 nanodots}, 689 journal = {J. Magn. Magn. Mater.}, 690 volume = {266}, 691 year = {2003}, 692 pages = {155-163}, 693 petsc_uses = {KSP} 694} 695 696@Article{ scholz1, 697 author = { W. Scholz and J. Fidler and T. Schrefl and D. Suess and R. Dittrich and H. 698 Forster and V. Tsiantos}, 699 title = {Scalable Parallel Micromagnetic Solvers for Magnetic Nanostructures}, 700 journal = {Comp. Mat. Sci}, 701 year = {2003}, 702 pages = {366--383}, 703 volume = {28}, 704 url = {http://magnet.atp.tuwien.ac.at/scholz/projects/papers/preprint/scholz/cms03/magpar.pdf}, 705 petsc_uses = {KSP} 706} 707 708@PhDThesis{ scholz2, 709 author = {W. Scholz}, 710 title = {Scalable Parallel Micromagnetic Solvers for Magnetic Nanostructures}, 711 school = {Vienna University of Technology, Vienna, Austria}, 712 year = {2003}, 713 petsc_uses = {KSP} 714} 715 716@Article{ scholz3, 717 author = {W. Scholz and D. Suess and R. Dittrich and T. Schrefl and V. Tsiantos and H. 718 Forster and J. Fidler}, 719 title = {Implementation of a high performance parallel finite element micromagnetics 720 package}, 721 journal = {J. Magn. Magn. Mater.}, 722 year = {2004}, 723 url = {http://magnet.atp.tuwien.ac.at/scholz/projects/papers/preprint/scholz/icm2003/scholz_petsc.pdf}, 724 petsc_uses = {KSP} 725} 726 727% LiteralHTML: <td width="100%" colspan="2"><hr size="4" color="#FF5B5B"> </td> 728@InBook{ zhanggladwell1, 729 author = {W. Zhang and I. Gladwell}, 730 chapter = {Performance of MOL for Surface Motion Driven by a Laplacian of Curvature}, 731 editor = {Z. Chen and R.E. Ewing and Z.-C. Shi}, 732 year = {2000}, 733 title = {Numerical Treatment of Multiphase Flows in Porous Media, Lecture Notes in 734 Physics, vol. 552}, 735 publisher = {Springer}, 736 pages = {4190-}, 737 petsc_uses = {KSP} 738} 739 740@Article{ wolf1, 741 author = {A. J. Haslan and D. Moldovan and S. R. Phillpot and V. Yamakov}, 742 title = {Combined Atomistic and Mesoscale simulation of grain growth in nanocrystalline 743 thin films}, 744 journal = {Phil. Mag. A}, 745 year = {2003}, 746 lab = {ANL}, 747 petsc_uses = {KSP} 748} 749 750@Article{ wolf2, 751 author = {A. J. Haslan and D. Moldovan and S. R. Phillpot and H. Gleiter}, 752 title = {Mesoscopic simulation of two dimensional grain growth with anisotropic 753 grain-boundary properties}, 754 journal = {Computational Materials Science}, 755 year = {2001}, 756 volume = {23}, 757 pages = {15--32}, 758 lab = {ANL}, 759 petsc_uses = {KSP} 760} 761 762@Article{ wolf3, 763 author = {D. Moldovan and S. R. Phillpot and A. J. Haslan}, 764 title = {Role of grain rotation in grain growth by mesoscale simulation}, 765 journal = {Phil. Mag. A}, 766 year = {2002}, 767 volume = {82}, 768 pages = {1271--1297}, 769 lab = {ANL}, 770 petsc_uses = {KSP} 771} 772 773% LiteralHTML: <td width="100%" colspan="2"><hr size="4" color="#FF5B5B"> </td> 774@Article{ saut, 775 author = { Olivier Saut}, 776 title = {Bidimensional Study of the Maxwell-Bloch Model in a Nonlinear Crystal}, 777 journal = {SIAM Journal on Scientific Computing}, 778 year = {2004}, 779 note = {submitted}, 780 url = {http://mip.ups-tlse.fr/\~{ }saut/data/sisc04.pdf}, 781 petsc_uses = {KSP} 782} 783 784% LiteralHTML: 785% LiteralHTML: <a name="biology"><H3><center>Biology -- Medical</center></H3> 786% LiteralHTML: 787@InBook{ khanallorenziayachepennec2016, 788 title = {Simulating Patient Specific Multiple Time-Point {MRIs} from a Biophysical Model 789 of Brain Deformation in {Alzheimer's} Disease}, 790 booktitle = {Computational Biomechanics for Medicine: Imaging, Modeling and Computing}, 791 author = {Bishesh Khanal and Marco Lorenzi and Nicholas Ayache and Xavier Pennec}, 792 editor = {Grand R. Joldes and Barry Doyle and Adam Wittek and Poul M.F. Nielsen and Karol 793 Miller}, 794 pages = {167--176}, 795 isbn = {978-3-319-28329-6}, 796 doi = {10.1007/978-3-319-28329-6_15}, 797 publisher = {Springer International Publishing}, 798 year = {2016}, 799 petsc_uses = {KSP} 800} 801 802@Article{ ataseven, 803 author = {Y. Ataseven and Z. Akaliota n-Acar and C.~E. Acar and N. G. Gen\c{c}er}, 804 title = {Parallel implementation of the accelerated BEM approach for EMSI of the human 805 brain}, 806 journal = {Medical and Biological Engineering and Computing}, 807 month = feb, 808 year = {2008}, 809 doi = {10.1007/s11517-008-0316-0}, 810 petsc_uses = {KSP} 811} 812 813@Article{ dennis-eberhart-03, 814 author = {B. H. Dennis and R. C. Eberhart and G. S. Dulikravich and S.W. Radons}, 815 pages = {832-840}, 816 volume = {125}, 817 number = {6}, 818 title = {Finite-element simulation of cooling of realistic 3-D human head and neck}, 819 journal = {J Biomech Eng}, 820 year = {2003}, 821 url = {http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?cmd=Retrieve&db=PubMed&list_uids=14986408&dopt=Citation}, 822 petsc_uses = {KSP} 823} 824 825@Conference{ gu7174parallel, 826 title = {{A parallel reduced-space sequential-quadratic programming algorithm for 827 frequency-domain small animal optical tomography}}, 828 author = {Gu, X. and Kim, H.K. and Masciotti, J. and Hielscher, A.H.}, 829 booktitle = {Proc. of SPIE Vol}, 830 volume = {7174}, 831 number = {717406}, 832 pages = {1}, 833 petsc_uses = {KSP} 834} 835 836@Article{ barchanski2005using, 837 title = {{Using domain decomposition techniques for the calculation of low-frequency 838 electric current densities in high-resolution 3D human anatomy models}}, 839 author = {Barchanski, A. and Clemens, M. and De Gersem, H. and Steiner, T. and Weiland, 840 T.}, 841 journal = {COMPEL: The International Journal for Computation and Mathematics in Electrical 842 and Electronic Engineering}, 843 volume = {24}, 844 number = {2}, 845 pages = {458--467}, 846 issn = {0332-1649}, 847 year = {2005}, 848 publisher = {Emerald Group Publishing Limited}, 849 petsc_uses = {KSP} 850} 851 852@Article{ motrescurienen05, 853 author = {V. C. Motrescu and U. van Rienen}, 854 pages = {227--231}, 855 volume = {3}, 856 title = {Computation of currents induced by ELF electric fields in anisotropic human 857 tissues using the Finite Integration Technique}, 858 journal = {Advances in Radio Science}, 859 year = {2005}, 860 url = {http://www.copernicus.org/URSI/ars/3/ars-3-227.pdf}, 861 petsc_uses = {KSP} 862} 863 864@Article{ motrescurienen04, 865 author = {V. C. Motrescu and U. van Rienen}, 866 pages = {309--313}, 867 volume = {2}, 868 title = {Computation of electrostatic fields in anisotropic human tissues using the Finite 869 Integration Technique (FIT)}, 870 journal = {Advances in Radio Science}, 871 year = {2004}, 872 url = {http://www.copernicus.org/URSI/ars/ARS_2_1/309.pdf}, 873 petsc_uses = {KSP} 874} 875 876@InProceedings{ dbl2, 877 author = {Enzo A. Dari and Mariano I. Cantero and Raul A. Feijoo}, 878 title = {Computational arterial flow modeling using a parallel {Navier-Stokes} solver}, 879 booktitle = {ECCOMAS2000}, 880 year = {2000}, 881 url = {http://146.134.8.133/Feijoo/CModComplexos/Conferencias/ECCOMAS2000/Darie/eccomas.html}, 882 petsc_uses = {KSP} 883} 884 885@Unpublished{ cell, 886 title = {Parallel Simulation Engines for Whole-Cell Models}, 887 author = {Markus Schwehm and Nils Gehlenborg and Hendrik Post and Amelie Stein and Kirstin 888 Weber}, 889 note = {Poster at Second International Conference on Systems Biology (ICSB) 2001}, 890 url = {http://www.icsb-2001.org/Posters/110_schwehm2.pdf}, 891 institution = {University of Tubingen, ZBIT - Zentrum fur Bioinformatik Tubingen}, 892 year = {2001}, 893 petsc_uses = {KSP} 894} 895 896@Article{ barker2010two, 897 title = {Two-level Newton and hybrid Schwarz preconditioners for fluid-structure 898 interaction}, 899 author = {Barker, A.T. and Cai, X.C.}, 900 journal = {SIAM Journal on Scientific Computing}, 901 volume = {32}, 902 number = {4}, 903 pages = {2395--2417}, 904 year = {2010}, 905 publisher = {Society for Industrial and Applied Mathematics}, 906 petsc_uses = {KSP} 907} 908 909@Article{ barker2010scalable, 910 title = {Scalable parallel methods for monolithic coupling in fluid-structure interaction 911 with application to blood flow modeling}, 912 author = {Barker, A.T. and Cai, X.C.}, 913 journal = {Journal of Computational Physics}, 914 volume = {229}, 915 number = {3}, 916 pages = {642--659}, 917 year = {2010}, 918 publisher = {Elsevier}, 919 petsc_uses = {KSP} 920} 921 922@Article{ barker2009nks, 923 title = {NKS for fully coupled fluid-structure interaction with application}, 924 author = {Barker, A.T. and Cai, X.C.}, 925 journal = {Domain Decomposition Methods in Science and Engineering XVIII}, 926 pages = {275--282}, 927 year = {2009}, 928 publisher = {Springer}, 929 petsc_uses = {KSP} 930} 931 932@Article{ mirams2013, 933 author = {Chris Luscombe and Geoff Williams and Jordi Munoz-Muriedas and David J Gavaghan 934 and Yi Cui and Gary R Mirams}, 935 title = {Evaluation of an in silico cardiac safety assay: using ion channel screening data 936 to predict QT interval changes in the rabbit ventricular wedge}, 937 journal = {Journal of pharmacological and toxicological methods}, 938 volume = {68}, 939 number = {1}, 940 pages = {88--96}, 941 year = {2013}, 942 doi = {10.1016/j.vascn.2013.04.004}, 943 petsc_uses = {KSP} 944} 945 946% LiteralHTML: <td width="100%" colspan="2"><hr size="4" color="#FF5B5B"> </td> 947% LiteralHTML: <center><img alt="" 948% LiteralHTML: src="images/spine0l.jpg"></center></p> 949% LiteralHTML: <center><img alt="" 950% LiteralHTML: src="images/vertebra.jpg"></center></p> 951% LiteralHTML:<font color="#FF0000"> 952% LiteralHTML:Treating fractures of the hip and spine is a major medical cost. 953% LiteralHTML:Understanding bone mechanical properties and how they may lead to 954% LiteralHTML:fractures is thus an important medical research activity. PETSc and 955% LiteralHTML:Prometheus have been used for extremely large scale finite element 956% LiteralHTML:simulation of the solid mechanics of a portion of a human spine by a 957% LiteralHTML:team of doctors and computational scientists. This computation was 958% LiteralHTML:a winner of a Gordon Bell Special Prize at SC2004 and ran scalably 959% LiteralHTML:with over 4000 processors.</p> 960% LiteralHTML: </font> 961@Article{ arbenz2008scalable, 962 title = {A scalable multi-level preconditioner for matrix-free $\mu$-finite element 963 analysis of human bone structures}, 964 author = {Arbenz, P. and van Lenthe, G.H. and Mennel, U. and M{\\"u}ller, R. and Sala, M.}, 965 journal = {International Journal for Numerical Methods in Engineering}, 966 volume = {73}, 967 number = {7}, 968 pages = {927--947}, 969 year = {2008}, 970 publisher = {Wiley Online Library}, 971 petsc_uses = {KSP} 972} 973 974@InProceedings{ adams-04, 975 author = {Adams, M.~F. and Bayraktar, H.H. and Keaveny, T.M. and Papadopoulos, P.}, 976 booktitle = {ACM/IEEE Proceedings of SC2004: High Performance Networking and Computing}, 977 title = {Ultrascalable implicit finite element analyses in solid mechanics with over a 978 half a billion degrees of freedom}, 979 note = {Gordon Bell Award}, 980 year = {2004}, 981 petsc_uses = {KSP} 982} 983 984@InProceedings{ adams-03b, 985 author = {Adams, M.~F. and Bayraktar, H.H. and Keaveny, T.M. and Papadopoulos, P.}, 986 title = {Applications of Algebraic Multigrid to Large-Scale Finite Element Analysis of 987 Whole Bone Micro-Mechanics on the IBM SP}, 988 booktitle = {ACM/IEEE Proceedings of SC2003: High Performance Networking and Computing}, 989 year = {2003}, 990 petsc_uses = {KSP} 991} 992 993@InProceedings{ oghattas2002, 994 author = {Volkan Akcelik and George Biros and Omar Ghattas}, 995 title = {Parallel Multiscale {Gauss-Newton-Krylov} Methods For Inverse Wave Propagation}, 996 booktitle = {Procceedings of SC2002}, 997 url = {http://www-2.cs.cmu.edu/\~{ }oghattas/papers/sc2002.pdf}, 998 note = {Winner of SC2002 Best Paper. A parallel algorithm for inverse problems governed 999 by time-dependent PDEs, and scalability results for an inverse wave propagation 1000 problem of determining the material field of an acoustic medium. Using the 1001 algorithm, they solved a synthetic inverse wave propagation problem though a 1002 pelvic bone geometry involving 2.1 million inversion parameters in 3 hours on 256 1003 processors.}, 1004 year = {2002}, 1005 petsc_uses = {KSP} 1006} 1007 1008% LiteralHTML: <a name="biology:cardiology"> 1009% LiteralHTML: <td width="100%" colspan="2"><hr size="4" color="#FF5B5B"> </td> 1010% LiteralHTML: <center><img alt="" 1011% LiteralHTML: src="images/heart.jpg"> 1012% LiteralHTML: <img alt="" 1013% LiteralHTML: src="images/pump.jpg"></center></p> 1014% LiteralHTML: 1015% LiteralHTML:<font color="#FF0000"> 1016% LiteralHTML: Arrhythmias are disorders of the regular rhythmic beating of the 1017% LiteralHTML: heart; they are the cause of the majority of sudden cardiac 1018% LiteralHTML: deaths. The heart beat is controlled by electrical signals moving 1019% LiteralHTML: through the heart. PETSc has been used by several research groups to 1020% LiteralHTML: simulate the electronic behavior of the heart in an attempt to more 1021% LiteralHTML: fully understand the developments of arrhthmias.</p> 1022% LiteralHTML:</font> 1023@InProceedings{ oghattas2000, 1024 author = {J. Antaki and G. Belloch and O. Ghattas and I. Malcevic and G. Miller and N. 1025 Walkington}, 1026 title = {A Parallel Dynamic-Mesh Lagrangian Method for Simulation of Flows with Dynamic 1027 Interfaces}, 1028 booktitle = {Procceedings of SC2000}, 1029 url = {http://www.cs.cmu.edu/\~{ }oghattas/papers/sc2000/sc2000.pdf}, 1030 note = {Blood flow modeling at the microscale including effects on individual blood 1031 cells, for designing heart assist pumps, etc.}, 1032 year = {2000}, 1033 petsc_uses = {KSP} 1034} 1035 1036@InBook{ cfps2006, 1037 author = {P. Colli Franzone and L. F. Pavarino and G. Savare}, 1038 editor = {A. Quarteroni et al.}, 1039 title = {Complex Systems in Biomedicine}, 1040 chapter = {Computational Electrocardiology: mathematical and numerical modeling}, 1041 publisher = {Springer-Verlag}, 1042 pages = {187--241}, 1043 year = {2006}, 1044 petsc_uses = {KSP} 1045} 1046 1047@InProceedings{ cfpst2007, 1048 author = {P. Colli Franzone and L. F. Pavarino and S. Scacchi and B. Taccardi}, 1049 title = {Determining recovery times from transmembrane action potentials and unipolar 1050 electrograms in normal heart tissue}, 1051 booktitle = {FIMH07}, 1052 publisher = {Springer-Verlag}, 1053 volume = {4466}, 1054 pages = {139--149}, 1055 year = {2007}, 1056 petsc_uses = {KSP} 1057} 1058 1059@Article{ seemann2010framework, 1060 title = {{Framework for Modular, Flexible and Efficient Solving the Cardiac Bidomain 1061 Equations Using PETSc}}, 1062 author = {Seemann, G. and Sachse, FB and Karl, M. and Weiss, DL and Heuveline, V. and 1063 D{\\"o}ssel, O.}, 1064 journal = {Progress in Industrial Mathematics at ECMI 2008}, 1065 pages = {363--369}, 1066 year = {2010}, 1067 publisher = {Springer}, 1068 petsc_uses = {KSP} 1069} 1070 1071@InProceedings{ pft2005, 1072 author = {Luca F. Pavarino and Piero Colli Franzone and Bruno Taccardi}, 1073 title = {Monodomain Simulations of Excitation and Recovery in Cardiac Blocks with 1074 Intramural Heterogeneity}, 1075 booktitle = {Functional Imaging and modeling of the Heart (FIMH05)}, 1076 pages = {267--277}, 1077 editors = {A. Frangi et al.}, 1078 publisher = {Springer, Lecture Notes in Computer Science (LNCS), v. 3504}, 1079 year = {2005}, 1080 petsc_uses = {KSP} 1081} 1082 1083@Article{ bgcp2005, 1084 author = {Boyce E. Griffith and Charles S. Peskin}, 1085 title = {On the order of accuracy of the immersed boundary method: Higher order 1086 convergence rates for sufficiently smooth problems}, 1087 journal = {Journal of Computational Physics}, 1088 year = {2005}, 1089 volume = {208}, 1090 pages = {75--105}, 1091 petsc_uses = {KSP} 1092} 1093 1094@Article{ griffith2007adaptive, 1095 title = {An adaptive, formally second order accurate version of the immersed boundary 1096 method}, 1097 author = {Griffith, B.E. and Hornung, R.D. and McQueen, D.M. and Peskin, C.S.}, 1098 journal = {Journal of Computational Physics}, 1099 volume = {223}, 1100 number = {1}, 1101 pages = {10--49}, 1102 year = {2007}, 1103 publisher = {Elsevier}, 1104 petsc_uses = {KSP} 1105} 1106 1107@PhDThesis{ griffith05, 1108 author = {Boyce Griffith}, 1109 title = {Simulating the blood-muscle-valve mechanics of the heart by an adaptive and 1110 parallel version of the immersed boundary method}, 1111 school = {New York University}, 1112 year = {2005}, 1113 petsc_uses = {KSP} 1114} 1115 1116@PhDThesis{ murillo, 1117 author = {Maria S. Murillo}, 1118 title = {Parallel Algorithms and Software for Time-Dependent System of Nonlinear Partial 1119 Differential Equations with an Application in Computational Biology}, 1120 school = {University of Colorado at Boulder}, 1121 year = {2002}, 1122 petsc_uses = {KSP} 1123} 1124 1125@Article{ spv2004, 1126 author = {Rodrigo Weber Dos Santos and G. Plank and S. Bauer}, 1127 title = {Parallel multigrid preconditioner for the cardiac bidomain model}, 1128 journal = {IEEE Trans. Biomed. Eng}, 1129 year = {2004}, 1130 volume = {51}, 1131 pages = {1960--1968}, 1132 petsc_uses = {KSP} 1133} 1134 1135@Article{ vphl2003, 1136 author = {E. J. Vigmond and M. Hughes and G. Plank, L.J. Leon}, 1137 title = { Computational Tools for Modeling Electrical Activity in Cardiac Tissue}, 1138 journal = {J. Electrocardiol.}, 1139 year = {2003}, 1140 volume = {36}, 1141 pages = {69--74}, 1142 petsc_uses = {KSP} 1143} 1144 1145@InProceedings{ spbv2003, 1146 author = {Rodrigo Weber Dos Santos and G. Plank and S. Bauer and and E.J. Vigmond}, 1147 title = {Preconditioning Techniques for the Bidomain Equations}, 1148 booktitle = {Proceedings of the 15th International Conference on Domain Decomposition 1149 Methods}, 1150 pages = {571--580}, 1151 publisher = {Springer, Lecture Notes in Computational Science and Engineering (LNCSE).}, 1152 note = {}, 1153 url = {http://www.ddm.org/DD15/proceedings-dd15.html}, 1154 year = {2003}, 1155 petsc_uses = {KSP} 1156} 1157 1158@Article{ franz-pavir-04, 1159 author = {P. Colli Franzone and L.~F. Pavarino}, 1160 title = {A parallel solver for reaction-diffusion systems in computational 1161 electrocardiology}, 1162 journal = {Mathematical Models and Methods in Applied Sciences}, 1163 year = {2004}, 1164 volume = {14}, 1165 number = {6}, 1166 pages = {883--912}, 1167 petsc_uses = {KSP} 1168} 1169 1170@Article{ franz-pavir-05, 1171 author = {P. Colli Franzone and L.~F. Pavarino and B. Taccardi}, 1172 title = {Simulating patterns of excitation, repolarization and action potential 1173 durationwith cardiac Bidomain and Monodomain models}, 1174 journal = {Mathematical Biosciences}, 1175 year = {2005}, 1176 volume = {197}, 1177 number = {1}, 1178 pages = {35--66}, 1179 petsc_uses = {KSP} 1180} 1181 1182@Article{ franz-pavir-06, 1183 author = {P. Colli Franzone and L.~F. Pavarino and B. Taccardi}, 1184 title = {Effects of transmural electrical heterogeneities and electrotonic interactions on 1185 the dispersion of cardiac repolarization and action potential duration: a 1186 simulation study}, 1187 journal = {Mathematical Biosciences}, 1188 year = {2006}, 1189 volume = {204}, 1190 number = {1}, 1191 pages = {132--165}, 1192 petsc_uses = {KSP} 1193} 1194 1195@InProceedings{ colli-franz-sim, 1196 author = {P. Colli-Franzone and L.F. Pavarino and B. Taccardi}, 1197 title = {MODELING ANISOTROPIC AND HETEROGENEOUS CARDIAC MODELS: PARALLEL SIMULATIONS}, 1198 booktitle = {MEDICON and HEALTH TELEMATICS 2004, Health in the Information Society, X 1199 Mediterranean Conference on Medical and Biological Engineering}, 1200 url = {http://cluster.mat.unimi.it/doc/Progetti/Pavarino-LF.pdf}, 1201 year = {2004}, 1202 petsc_uses = {KSP} 1203} 1204 1205@InProceedings{ pf2003, 1206 author = {Luca F. Pavarino and Piero Colli Franzone}, 1207 title = {Parallel Solution of Cardiac Reaction-Diffusion Models}, 1208 booktitle = {Proceedings of the 15th International Conference on Domain Decomposition 1209 Methods}, 1210 pages = {669--776}, 1211 publisher = {Springer, Lecture Notes in Computational Science and Engineering (LNCSE).}, 1212 note = {}, 1213 url = {http://www.ddm.org/DD15/proceedings-dd15.html}, 1214 year = {2003}, 1215 petsc_uses = {KSP} 1216} 1217 1218@Article{ maria-is04, 1219 author = {Maria Murillo and Xiao-Chuan Cai}, 1220 title = {A fully implicit parallel algorithm for simulating the non-linear electrical 1221 activity of the heart}, 1222 journal = {Numerical Linear Algebra with Applications}, 1223 year = {2004}, 1224 volume = {11}, 1225 pages = {261 - 277}, 1226 url = {http://www3.interscience.wiley.com/cgi-bin/abstract/107632540/ABSTRACT}, 1227 petsc_uses = {KSP} 1228} 1229 1230@Article{ murli2007monitoring, 1231 title = {{Monitoring and Migration of a PETSc-based Parallel Application for Medical 1232 Imaging in a Grid computing PSE}}, 1233 author = {Murli, A. and Boccia, V. and Carracciuolo, L. and D’Amore, L. and Laccetti, G. 1234 and Lapegna, M.}, 1235 journal = {Grid-Based Problem Solving Environments}, 1236 pages = {421--432}, 1237 year = {2007}, 1238 publisher = {Springer}, 1239 petsc_uses = {KSP} 1240} 1241 1242@Article{ carracciuolo:2006:tpc, 1243 author = {Carracciuolo, L. and D'Amore, L. and Murli, A.}, 1244 title = {Towards a parallel component for imaging in PETSc programming environment: a case 1245 study in 3-D echocardiography}, 1246 journal = {Parallel Comput.}, 1247 volume = {32}, 1248 issue = {1}, 1249 month = jan, 1250 year = {2006}, 1251 issn = {0167-8191}, 1252 pages = {67--83}, 1253 numpages = {17}, 1254 doi = {10.1016/j.parco.2005.09.001}, 1255 acmid = {1141218}, 1256 publisher = {Elsevier Science Publishers B. V.}, 1257 address = {Amsterdam, The Netherlands, The Netherlands}, 1258 keywords = {Distributed software environment, Image denoising, Non linear PDE, Parallel 1259 component}, 1260 petsc_uses = {KSP} 1261} 1262 1263@Article{ damore2011integration, 1264 title = {Integration of emerging computer technologies for an efficient image sequences 1265 analysis}, 1266 journal = {Integrated Computer-Aided Engineering }, 1267 volume = {18}, 1268 number = {4}, 1269 pages = {365 - 378}, 1270 year = {2011}, 1271 note = {}, 1272 issn = {1875-8835}, 1273 doi = {10.3233/ICA-2011-0382}, 1274 url = {http://iospress.metapress.com/content/KM614806M50TKVP7}, 1275 author = {L. D'Amore and D. Casaburi and A. Galletti and L. Marcellino and A. Murli}, 1276 keywords = {Image sequence, pipe and filters, parallel computing, multicore processors}, 1277 petsc_uses = {KSP} 1278} 1279 1280@InProceedings{ eth_biwi_00721, 1281 author = {K. Burckhardt and D. Szczerba and J. Brown and K. Muralidhar and and G. 1282 Székely}, 1283 title = {Fast Implicit Simulation of Oscillatory Flow in Human Abdominal Bifurcation using 1284 a Schur Complement Preconditioner}, 1285 booktitle = {Euro-Par 2009 Parallel Processing}, 1286 year = {2009}, 1287 month = aug, 1288 pages = {747-759}, 1289 volume = {5704}, 1290 editor = {H. Sips and D. Epema and and H.-X. Lin}, 1291 series = {Lecture Notes in Computer Science}, 1292 publisher = {Springer}, 1293 keywords = {Aortic aneurysm, flow simulation, streamline diffusion FEM, indefinite matrix, 1294 parallel Krylov solver}, 1295 petsc_uses = {KSP} 1296} 1297 1298% LiteralHTML: <a name="biology:imagingandsurgery"> 1299% LiteralHTML: <td width="100%" colspan="2"><hr size="4" color="#FF5B5B"> </td> 1300% LiteralHTML: <center><img alt="" 1301% LiteralHTML: src="images/brain.jpg"></center> 1302@Article{ ganser2004deformable, 1303 title = {A deformable digital brain atlas system according to Talairach and Tournoux}, 1304 author = {Ganser, K.A. and Dickhaus, H. and Metzner, R. and Wirtz, C.R.}, 1305 journal = {Medical Image Analysis}, 1306 volume = {8}, 1307 number = {1}, 1308 pages = {3--22}, 1309 year = {2004}, 1310 publisher = {Elsevier}, 1311 petsc_uses = {KSP} 1312} 1313 1314@Unpublished{ taccsurgery, 1315 title = {TACC supercomputer performs laser cancer surgery on canine}, 1316 url = {http://www.tacc.utexas.edu/research/users/features/dynamic.php?m_b_c=laser}, 1317 note = {In April, the Lonestar supercomputer at the Texas Advanced Computing Center in 1318 Austin performed laser surgery on a dog in Houston without the intervention of a 1319 surgeon. The treatment was developed collaboratively by computational experts from 1320 the Institute for Computational Engineering and Sciences (ICES) at UT-Austin, 1321 leading technologists from the M.D. Anderson Cancer Center in Houston, and 1322 cyberinfrastructure specialists and systems from TACC. Using precise lasers, 1323 state-of-the-art thermal imaging technology, and advanced computational methods, 1324 dynamic, data-driven treatments are being pursued as a minimally invasive 1325 alternative to the standard treatment of cancer.}, 1326 petsc_uses = {KSP} 1327} 1328 1329@Article{ ffhbresso2008, 1330 author = {Yusheng Feng and David Fuentes and Andrea Hawkins and Jon Bass and Marissa 1331 Nichole Rylander and Andrew Elliott and Anil Shetty and R. Jason Stafford and J. 1332 Tinsley Oden}, 1333 title = {Nanoshell-Mediated Laser Surgery Simulation for Prostate Cancer Treatment}, 1334 journal = {Engineering with Computers}, 1335 note = {Special issue on Computational Bioengineering}, 1336 year = {2008}, 1337 url = {http://www.tacc.utexas.edu/research/users/features/laser_surgery.pdf}, 1338 petsc_uses = {KSP} 1339} 1340 1341@TechReport{ dobbhbbbdeffghkkps2008, 1342 author = {K. R. Diller and J. T. Oden and C. Bajaj and J. C. Browne and J. Hazle and I. 1343 Babu{\v{s}}ka and J. Bass and L. Bidaut and L. Demkowicz and A. Elliott and Y. 1344 Feng and D. Fuentes and S. Goswami and A. Hawkins and S. Khoshnevis and B. Kwon 1345 and S. Prudhomme and R. J. Stafford}, 1346 title = {Computational Infrastructure for the Real-Time Patient-Specific Treatment of 1347 Cancer}, 1348 year = {2008}, 1349 institution = {University of Texas at Austin}, 1350 url = {http://www.tacc.utexas.edu/research/users/features/cancer.pdf}, 1351 petsc_uses = {KSP} 1352} 1353 1354@Article{ ogdb2004, 1355 author = {A.A. Oberai and N.H. Gokhale and M.M. Doyley and J.C.Bamber}, 1356 title = {Evaluation of the Adjoint Equation Based Algorithm for Elasticity Imaging}, 1357 journal = {Physics in Medicine and Biology}, 1358 year = {2004}, 1359 volume = {49}, 1360 pages = {2955--2947}, 1361 petsc_uses = {KSP} 1362} 1363 1364@InProceedings{ majumdar11, 1365 author = {A. Majumdar and A. Birnbaum and D. Choi and A. Trivedi and S. K. Warfield and K. 1366 Baldridge and P. Krysl}, 1367 title = {A Dynamic Data Driven Grid System for Intra-Operative Image Guided Neurosurgery}, 1368 booktitle = {ICCS 2005}, 1369 pages = {672--679}, 1370 editor = {V.S. Sunderam et al.}, 1371 year = {2005}, 1372 petsc_uses = {KSP} 1373} 1374 1375@Conference{ sermesant-etal:03, 1376 author = {Sermesant, M. and Clatz, O. and Li, Z. and Lanteri, S. and Delingette, H. and 1377 Ayache, H.}, 1378 title = {A parallel implementation of non-rigid registration using a volumetric 1379 biomechanical model}, 1380 booktitle = {Second International Workshop on Biomedical Image Registration {WBIR'03}}, 1381 address = {Philadelphia, PA, USA}, 1382 publisher = {Springer-Verlag}, 1383 editor = {Gee, J.C. and Maintz, J.B.A. and Vannier, M.W.}, 1384 series = {Lecture Notes in Computer Science}, 1385 volume = {2717}, 1386 pages = {398-407}, 1387 date = {june 23-24}, 1388 year = {2003}, 1389 url = {ftp://ftp-sop.inria.fr/epidaure/Publications/Sermesant/WBIR2003Sermesant.pdf}, 1390 petsc_uses = {KSP} 1391} 1392 1393@Conference{ sermesant-etal:04, 1394 author = {J. Rexilius and S.K. Warfield and C.R.G. Guttmann and X. Wei and R. Benson and L. 1395 Wolfson and M. Shenton and H. Handels and R. Kikinis}, 1396 title = {A Novel Nonrigid Registration Algorithm And Applications}, 1397 booktitle = {Medical Image Computing and Computer-Assisted Intervention - MICCAI 2001}, 1398 address = {Philadelphia, PA, USA}, 1399 publisher = {Springer-Verlag}, 1400 editor = {Gee, J.C. and Maintz, J.B.A. and Vannier, M.W.}, 1401 series = {Lecture Notes in Computer Science}, 1402 volume = {2208}, 1403 pages = {923}, 1404 year = {2003}, 1405 url = {http://www.springerlink.com/app/home/contribution.asp?wasp=6pgwnvthup0amt7g9j4k&referrer=parent&backto=issue,105,251;journal,1191,1949;linkingpublicationresults,1:105633,1}, 1406 petsc_uses = {KSP} 1407} 1408 1409@Article{ warfield-haker-talos-05, 1410 author = {Simon K. Warfield and Steven J. Haker and Ion-Florin Talos and Corey A. Kemper 1411 and Neil Weisenfeld and Andrea U.J. Mewes and Daniel Goldberg-Zimring and Kelly H. 1412 Zou and Carl-Fredrik Westin and William M. Wells and Clare M.C. Tempany and 1413 Alexandra Golby and Peter M. Black and Ferenc A. Jolesz and Ron Kikinis}, 1414 title = {Capturing intraoperative deformations: research experience at Brigham and Women's 1415 hospital}, 1416 journal = {Medical Image Analysis}, 1417 url = {http://splweb.bwh.harvard.edu:8000/pages/papers/warfield/capturing-intraoperative-deformations-MIA2005.pdf}, 1418 year = {2005}, 1419 petsc_uses = {KSP} 1420} 1421 1422@Article{ brain3, 1423 author = {Simon K. Warfield and Florin Talos and Alida Tei and Arya Nabavi and Matthieu 1424 Ferrant and Peter McL. Black and Ferenc A. Jolesz and Ron Kikinis}, 1425 title = {Real-Time Registration of Volumetic Brain {MRI} by Biomechanical Simulation of 1426 Deformation during Image Guided Neurosurgery}, 1427 journal = {Computing and Visualization in Science}, 1428 url = {http://splweb.bwh.harvard.edu:8000/pages/ppl/warfield/papers/2002/warfield-2002-cvs-appeared.pdf}, 1429 year = {2002}, 1430 petsc_uses = {KSP} 1431} 1432 1433@Article{ brain2, 1434 author = {Matthieu Ferrant and Arya Nabavi and Benoit Macq and Ferenc A. Jolesz and Ron 1435 Kikinis and Simon K. Warfield}, 1436 title = {Registration of {3D} Intraoperative {MR} Images of the Brain using a Finite 1437 Element Biomechanical Model}, 1438 journal = {IEEE Transactions on Medical Imaging}, 1439 url = {http://splweb.bwh.harvard.edu:8000/pages/papers/ferrant/tmi2001.pdf}, 1440 year = {2001}, 1441 petsc_uses = {KSP} 1442} 1443 1444@InProceedings{ brain1, 1445 author = {Simon K. Warfield and Matthieu Ferrant and Xavier Gallez and Arya Nabavi and 1446 Ferenc A. Jolesz and Ron Kikinis}, 1447 title = {Real-Time Biomechanical Simulation of Volumetric Brain Deformation for Image 1448 Guided Neurosurgery}, 1449 booktitle = {Proceedings of SC2000}, 1450 url = {http://www.sc2000.org/techpapr/papers/pap.pap230.pdf}, 1451 year = {2000}, 1452 petsc_uses = {KSP} 1453} 1454 1455@Article{ vanne06, 1456 author = {V. Kolehmainen and A. Vanne and S. Siltanen and S. Jarvenpaa and J.P. Kaipio and 1457 M. Lassas and M. Kalke}, 1458 title = {Parallelized Bayesian inversion for three-dimensional dental X-ray imaging}, 1459 journal = {IEEE Transactions on Medical Imaging}, 1460 volume = {25}, 1461 number = {2}, 1462 month = feb, 1463 year = {2006}, 1464 pages = {218--228}, 1465 petsc_uses = {KSP} 1466} 1467 1468@InProceedings{ knepleybardhan2015, 1469 title = {Work/Precision Tradeoffs in Continuum Models of Biomolecular Electrostatics}, 1470 author = {Matthew G. Knepley and Jaydeep P. Bardhan}, 1471 booktitle = {Proceedings of ASME 2015 International Mechanical Engineering Congress \& 1472 Exposition}, 1473 volume = {9}, 1474 pages = {V009T12A04}, 1475 doi = {10.1115/IMECE2015-53579}, 1476 year = {2015}, 1477 petsc_uses = {KSP} 1478} 1479 1480@InProceedings{ bardhanknepley2015, 1481 title = {Multiscale models and approximation algorithms for protein electrostatics}, 1482 author = {Jaydeep P. Bardhan and Matthew G. Knepley}, 1483 booktitle = {Boundary Elements and Other Mesh Reduction Methods XXXVIII}, 1484 volume = {61}, 1485 pages = {163--174}, 1486 url = {http://www.witpress.com/Secure/elibrary/papers/BEM38/BEM38013FU1.pdf}, 1487 doi = {10.2495/BEM380131}, 1488 publisher = {WIT Press}, 1489 year = {2015}, 1490 petsc_uses = {KSP} 1491} 1492 1493% LiteralHTML: 1494% LiteralHTML: <a name="fusion"><H3><center>Fusion</center></H3> 1495% LiteralHTML: 1496@InProceedings{ adamsbrennanknepleywang2022, 1497 title = {{Landau} collision operator in the {CUDA} programming model applied to thermal 1498 quench plasmas}, 1499 author = {Mark. F. Adams and Dylan P. Brennan and Matthew G. Knepley and Peng Wang}, 1500 booktitle = {36th IEEE International Parallel \& Distributed Processing Symposium Conference 1501 (IPDPS '22)}, 1502 doi = {10.1109/IPDPS53621.2022.00020}, 1503 year = {2022}, 1504 petsc_uses = {DMPlex} 1505} 1506 1507@Misc{ adamsknepleybrennan2021, 1508 title = {Runaway Electron Generation with High-Performance, Structure Preserving 1509 Discretization of Fokker-Plank-Landau}, 1510 author = {Mark F. Adams and Matthew G. Knepley and Dylan Brennan}, 1511 year = {2021}, 1512 petsc_uses = {KSP} 1513} 1514 1515@Article{ adamshirvijokiknepleybrownisaacmills2017, 1516 title = {{Landau} Collision Integral Solver with Adaptive Mesh Refinement on Emerging 1517 Architectures}, 1518 author = {Mark F. Adams and Eero Hirvijoki and Matthew G. Knepley and Jed Brown and Tobin 1519 Isaac and Richard Mills}, 1520 journal = {SIAM Journal on Scientific Computing}, 1521 volume = {39}, 1522 number = {6}, 1523 pages = {C452--C465}, 1524 doi = {10.1137/17M1118828}, 1525 eprint = {1702.08880}, 1526 year = {2017}, 1527 petsc_uses = {KSP} 1528} 1529 1530@Article{ pusztayknepleyadams2022, 1531 title = {Conservative Projection Between FEM and Particle Bases}, 1532 author = {Joseph V. Pusztay and Matthew G. Knepley and Mark F. Adams}, 1533 journal = {SIAM Journal on Scientific Computing}, 1534 volume = {44}, 1535 number = {4}, 1536 pages = {C310--C319}, 1537 doi = {10.1137/21M145407}, 1538 year = {2022} 1539} 1540 1541@Article{ hirvijoki2017, 1542 author = {Eero Hirvijoki and Mark F. Adams}, 1543 title = {Conservative discretization of the {Landau} collision integral}, 1544 journal = {Physics of Plasmas}, 1545 volume = {24}, 1546 number = {3}, 1547 pages = {032121}, 1548 doi = {10.1063/1.4979122}, 1549 year = {2017}, 1550 petsc_uses = {KSP} 1551} 1552 1553@Article{ mollenadamsknepleyhagerchang2021, 1554 title = {Implementation of higher-order velocity mapping between marker particles and grid 1555 in the particle-in-cell code XGC}, 1556 author = {Albert Moll\'en and Mark F. Adams and Matthew G. Knepley and Robert Hager and C. 1557 S. Chang}, 1558 journal = {Journal of Plasma Physics}, 1559 volume = {87}, 1560 number = {2}, 1561 pages = {905870229}, 1562 eprint = {2012.11764}, 1563 doi = {10.1017/S0022377821000441}, 1564 year = {2021}, 1565 petsc_uses = {KSP} 1566} 1567 1568@Article{ lsmh2014, 1569 author = {M. Landreman and H. M. Smith and A. Mollen and P. Helander}, 1570 title = {Comparison of particle trajectories and collision operators for collisional 1571 transport in nonaxisymmetric plasmas}, 1572 journal = { Physics of Plasmas}, 1573 volume = {21}, 1574 year = {2014}, 1575 petsc_uses = {KSP} 1576} 1577 1578@Article{ lpcep2014, 1579 author = {M. Landreman and F. I Parra and P. J. Catto and D. Ernst and I. Pusztai}, 1580 title = {Radially global delta-f computation of neoclassical phenomena in a tokamak 1581 pedestal}, 1582 journal = {Plasma Physics and Controlled Fusion}, 1583 volume = {56}, 1584 year = {2014}, 1585 petsc_uses = {KSP} 1586} 1587 1588@Article{ facets-scidac08, 1589 title = {First Results from Core-Edge Parallel Composition in the {FACETS} Project}, 1590 author = {J. Cary and J. Candy and R. Cohen and S. Krasheninnikov and D. McCune and D. 1591 Estep and J. Larson and A. Malony and A. Pankin and P. Worley and J. Carlsson and 1592 A. Hakim and P. Hamill and S. Kruger and M. Miah and S. Muzsala and A. Pletzer and 1593 S. Shasharina and D. Wade-Stein and N. Wang and S. Balay and L. McInnes and H. 1594 Zhang and T. Casper and L. Diachin and T. Epperly and T. Rognlien and M. Fahey and 1595 J. Cobb and A. Morris and S. Shende and G. Hammett and K. Indireshkumar and D. 1596 Stotler and A. Pigarov}, 1597 journal = {J. Phys.: Conf. Ser.}, 1598 volume = {125}, 1599 year = {2008}, 1600 pages = {012040}, 1601 url = {http://www.iop.org/EJ/abstract/1742-6596/125/1/012040}, 1602 petsc_uses = {KSP} 1603} 1604 1605@Article{ facets-scidac09, 1606 title = {Concurrent, Parallel, Multiphysics Coupling in the {FACETS} Project}, 1607 author = {J. Cary and J. Candy and J. Cobb and R. H. Cohen and T. Epperly and D. Estep and 1608 S. Krasheninnikov and A. Malony and D. McCune and L. McInnes and A. Pankin and S. 1609 Balay and J. Carlsson and M. R. Fahey and R. Groebner and A. Hakim and S. Kruger 1610 and M. Miah and A. Pletzer and S. Shasharina and S. Vadlamani and D. Wade-Stein 1611 and T. Rognlien and A. Morris and S. Shende and G. W. Hammett and K. Indireshkumar 1612 and A. Pigarov and H. Zhang}, 1613 journal = {J. Phys.: Conf. Ser.}, 1614 volume = {180}, 1615 year = {2009}, 1616 pages = {012056}, 1617 url = {http://iopscience.iop.org/1742-6596/180/1/012056}, 1618 petsc_uses = {KSP} 1619} 1620 1621@InProceedings{ facets-scidac10, 1622 title = {Coupled Whole Device Simulations of Plasma Transport in Tokamaks with the 1623 {FACETS} Code}, 1624 author = {A. Hakim and J. Cary and J. Candy and J. Cobb and R. Cohen and T. Epperly and D. 1625 Estep and S. Krasheninnikov and A. Malony and D McCune and L.C. McInnes and A. 1626 Pankin and S. Balay J. Carlsson and M. Fahey and R. Groebner and S. Kruger and M. 1627 Miah and A. Pletzer and S. Shasharina and S. Vadlamani and D. Wade-Stein and T. 1628 Rognlein and A. Morris and S. Shende and G. Hammett and K. Indareshkumar and A. 1629 Pigarov and H. Zhang}, 1630 booktitle = {Proceedings of SciDAC 2010 Conference}, 1631 year = {2010}, 1632 url = {http://computing.ornl.gov/workshops/scidac2010/papers/fusion_a_hakim.pdf}, 1633 petsc_uses = {KSP} 1634} 1635 1636@InProceedings{ facets-fec2010, 1637 title = {Concurrent, Parallel, Coupled Core-Edge Simulations of Pedestal Formation Using 1638 the {FACETS} Framework}, 1639 author = {J. Cary and A. Hakim and A. Pletzer and M. Miah and S. Kruger and S. Shasharina 1640 and S. Vadlamani and J. Carlsson and A. Pankin and T. Rognlien and R. Cohen and D. 1641 McCune and K. Indireshkumar and A. Pigarov and L.C. McInnes and H. Zhang}, 1642 booktitle = {Proceedings of the 23rd annual IAEA Fusion Energy Conference (FEC 2010), Daejon, 1643 Republic of Korea}, 1644 year = {2010}, 1645 petsc_uses = {KSP} 1646} 1647 1648@InProceedings{ facets-epdp2010, 1649 title = {{FACETS}: A Framework for Parallel Coupling of Fusion Components}, 1650 author = {J. Cary and A. Hakim and M. Miah and S. Kruger and A. Pletzer and S. Shasharina 1651 and S. Vadlamani and A. Pankin and R. Cohen and T. Epperly and T. Rognlien and R. 1652 Groebner and S. Balay and L. McInnes and H. Zhang}, 1653 booktitle = {Proceedings of Euromicro PDP 2010 (The 18th Euromicro International Conference on 1654 Parallel, Distributed and Network-Based Computing), Pisa, Italy}, 1655 year = {2010}, 1656 petsc_uses = {KSP} 1657} 1658 1659@Article{ carlssoncary09, 1660 author = {Johan Carlsson, John R. Cary}, 1661 title = {The hypersecant Jacobian approximation for quasi-Newton solves of sparse 1662 nonlinear systems}, 1663 journal = {arXiv}, 1664 year = {2009}, 1665 note = {http://arxiv.org/abs/0905.1054}, 1666 url = {http://arxiv.org/pdf/0905.1054v1}, 1667 petsc_uses = {KSP} 1668} 1669 1670@InProceedings{ oshahjs2006, 1671 author = {F. Ogando and A. Signell and J.A. Heikkinen and M. Aspn\"as and S. Henriksson and 1672 S.J. Janhunen and T.P. Kiviniemi}, 1673 title = {Performance enhancements to ELMFIRE gyrokinetic code leading to new ranges of 1674 application}, 1675 booktitle = {33rd EPS Conference on Plasma Phys.}, 1676 year = {2006}, 1677 url = {http://epsppd.epfl.ch/Roma/pdf/P4_153.pdf}, 1678 note = {European fusion code}, 1679 petsc_uses = {KSP} 1680} 1681 1682@Article{ zhu2006, 1683 author = {P. Zhu and A. Bhattacharjee and K. Germaschewski}, 1684 title = {Intermediate nonlinear evolution of the Parker instability: Formation of 1685 convection-induced discontinuities and absence of finite-time singularities}, 1686 journal = {Phys. Rev. Lett.}, 1687 volume = {96}, 1688 number = {065001}, 1689 year = {2006}, 1690 doi = {10.1103/PhysRevLett.96.065001}, 1691 petsc_uses = {KSP} 1692} 1693 1694@InProceedings{ ppc2005, 1695 author = {B. Philip and M. Pernice and L.Chacon}, 1696 title = {Solution of Reduced Resistive Magnetohydrodynamics using Implicit Adaptive Mesh 1697 Refinement}, 1698 booktitle = {Proceedings of the 16th International Conference on Domain Decomposition 1699 methods}, 1700 year = {2005}, 1701 lab = {LANL}, 1702 petsc_uses = {KSP} 1703} 1704 1705@Article{ pp2005, 1706 author = {M. Pernice and B. Philip}, 1707 title = {Solution of Equilibrium Radiation Diffusion Problems using Adaptive Mesh 1708 Refinement}, 1709 year = {2005}, 1710 journal = {SIAM J. of Sci. Comput.}, 1711 lab = {LANL}, 1712 petsc_uses = {KSP} 1713} 1714 1715@Article{ gt2004, 1716 author = {A. H. Glasser and X. Z. Tang}, 1717 title = {The SEL macroscopic modeling code}, 1718 year = {2004}, 1719 journal = {Computer Physics Communications}, 1720 pages = {237--243}, 1721 volume = {164}, 1722 lab = {LANL}, 1723 petsc_uses = {KSP} 1724} 1725 1726@Article{ nl2006, 1727 author = {Y. Nishimura and Z.Lin}, 1728 title = {A finite element mesh in a tokamak edge geometry}, 1729 year = {2006}, 1730 journal = {Contributions to Plasma Physics}, 1731 volume = {22}, 1732 lab = {PPPL}, 1733 petsc_uses = {KSP} 1734} 1735 1736@Article{ nlle2004, 1737 author = {Y. Nishimura and Z.Lin and J.Lewandowski and S.Ethier}, 1738 title = {A finite element Poisson solver for gyrokinetic particle simulations in a global 1739 field aligned mesh}, 1740 year = {2006}, 1741 journal = {J. Comput. Phys.}, 1742 volume = {214}, 1743 pages = {657}, 1744 lab = {PPPL}, 1745 petsc_uses = {KSP} 1746} 1747 1748@InProceedings{ lnlle2004, 1749 author = {J.L.V Lewandowski and Y.Nishimura and W.W.Lee and Z.Lin and S. Ethier}, 1750 title = {Global gyrokinetic Particle-in-cell Simulations with Trapped Electrons}, 1751 booktitle = {Sherwood Fusion Theory Conference, Missoula, MT}, 1752 year = {2004}, 1753 url = {http://www.sherwoodtheory.org/sherwood04/program/1e15.pdf}, 1754 lab = {PPPL}, 1755 petsc_uses = {KSP} 1756} 1757 1758@InProceedings{ nlclew2004, 1759 author = {Y. Nishimura and Z.Lin and L.Chen and J.Lewandowski and S.Ethier and W. Wang}, 1760 title = {Electromagnetic gyrokinetic simulation with a fluid-kinetic hybrid electron 1761 model}, 1762 booktitle = {Sherwood Fusion Theory Conference, Missoula, MT}, 1763 year = {2004}, 1764 url = {http://www.sherwoodtheory.org/sherwood04/program/1C32.pdf}, 1765 lab = {PPPL}, 1766 petsc_uses = {KSP} 1767} 1768 1769@Article{ tb1, 1770 author = {X.~Z.~Tang and A.~H.~Boozer}, 1771 title = {Numerical studies of a steady state axisymmetric co-axial helicity injection 1772 plasma}, 1773 journal = {Physics of Plasmas}, 1774 year = {2004}, 1775 pages = {171--185}, 1776 volume = {11}, 1777 lab = {LANL}, 1778 petsc_uses = {KSP} 1779} 1780 1781@Unpublished{ nlcw, 1782 title = {Inclusion of electromagnetic effects into gyrokinetic particle simulations}, 1783 author = {Y. Nishimura and Z.Lin and L.Chen and W. Wang}, 1784 note = {American Physical Society 45th Annual Meeting Division of Plasma Physics, 1785 Albuquerque, New Mexico, October 2003}, 1786 year = {2003}, 1787 petsc_uses = {KSP} 1788} 1789 1790@TechReport{ tang2001, 1791 author = {X. Z. Tang and G. Y. Fu and S. C. Jardin and L. L. Lowe and W. Park and H. R. 1792 Strauss}, 1793 title = {Resistive Magnetohydrodynamics Simulation of Fusion Plasmas}, 1794 year = {2001}, 1795 institution = {Princeton Plasma Physics Laboratory}, 1796 number = {PPPL-3532}, 1797 url = {http://www.pppl.gov/pub_report/2001/PPPL-3532.pdf}, 1798 note = {Presented at 10th Society for Industrial and Applied Mathematics (SIAM) 1799 Conference on Parallel Processing for Scientific Computing, Portsmouth, Virginia, 1800 March 12-14, 2001.}, 1801 lab = {PPPL}, 1802 petsc_uses = {KSP} 1803} 1804 1805% LiteralHTML: 1806% LiteralHTML: <a name="geosciences"><H3><center>Geosciences</center></H3> 1807% LiteralHTML: 1808@Article{ valerathomasgarciacastillo2019, 1809 author = {Manuel Valera and Mary P. Thomas and Mariangel Garcia and Jose E. Castillo}, 1810 title = {Parallel Implementation of a {PETSc-Based} Framework for the General Curvilinear 1811 Coastal Ocean Model}, 1812 journal = {Journal of Marine Science and Engineering}, 1813 volume = {7}, 1814 number = {6}, 1815 article-number= {185}, 1816 url = {https://www.mdpi.com/2077-1312/7/6/185}, 1817 issn = {2077-1312}, 1818 doi = {10.3390/jmse7060185}, 1819 year = {2019}, 1820 petsc_uses = {KSP} 1821} 1822 1823@Article{ furuichimat2015, 1824 title = {Implicit solution of the material transport in Stokes flow simulation: Toward 1825 thermal convection simulation surrounded by free surface}, 1826 author = {Mikito Furuichi and Dave A May}, 1827 journal = {Computer Physics Communications}, 1828 volume = {192}, 1829 pages = {1--11}, 1830 year = {2015}, 1831 petsc_uses = {KSP} 1832} 1833 1834@Article{ sharplesmoresivelicjadamecmay2016, 1835 title = {Simulating faults and plate boundaries with a transversely isotropic plasticity 1836 model}, 1837 author = {Wendy Sharples and Louis N Moresi and Mirko Velic and Margarete A Jadamec and 1838 Dave A May}, 1839 journal = {Physics of the Earth and Planetary Interiors}, 1840 volume = {252}, 1841 pages = {77--90}, 1842 year = {2016}, 1843 petsc_uses = {KSP} 1844} 1845 1846@Article{ spiegelmanmaywilson2016, 1847 title = {On the solvability of incompressible Stokes with viscoplastic rheologies in 1848 geodynamics}, 1849 author = {Marc Spiegelman and Dave A May and Cian R Wilson}, 1850 journal = {Geochemistry, Geophysics, Geosystems}, 1851 volume = {17}, 1852 number = {6}, 1853 pages = {2213--2238}, 1854 year = {2016}, 1855 petsc_uses = {KSP} 1856} 1857 1858@Article{ buiteretal2016, 1859 title = {Benchmarking numerical models of brittle thrust wedges}, 1860 author = {Susanne JH Buiter and Guido Schreurs and Markus Albertz and Taras V Gerya and 1861 Boris Kaus and Walter Landry and Laetitia {Le Pourhiet} and Yury Mishin and David 1862 L Egholm and Michele Cooke and Bertrand Maillot and Cedric Thieulot and Tony Crook 1863 and Dave May and Pauline Souloumiac and Christopher Beaumont}, 1864 journal = {Journal of structural geology}, 1865 volume = {92}, 1866 pages = {140--177}, 1867 year = {2016}, 1868 petsc_uses = {KSP} 1869} 1870 1871@Article{ afanasievboehmdrielkrischerrietmannmayknepleyfichtner2019, 1872 title = {Modular and flexible spectral-element waveform modelling in two and three 1873 dimensions}, 1874 author = {Michael Afanasiev and Christian Boehm and Martin van Driel and Lion Krischer and 1875 Max Rietmann and Dave A. May and Matthew G. Knepley and Andreas Fichtner}, 1876 journal = {Geophysical Journal International}, 1877 volume = {216}, 1878 number = {3}, 1879 pages = {1675--1692}, 1880 doi = {10.1093/gji/ggy469}, 1881 year = {2019}, 1882 petsc_uses = {KSP} 1883} 1884 1885@Article{ haplaknepleyafanasievboehmdrielkrischerfichtner2020, 1886 title = {Fully Parallel Mesh {I/O} using {PETSc} {DMPlex} with an Application to Waveform 1887 Modeling}, 1888 author = {Vaclav Hapla and Matthew G. Knepley and Michael Afanasiev and Christian Boehm and 1889 Martin van Driel and Lion Krischer and Andreas Fichtner}, 1890 journal = {SIAM Journal on Scientific Computing}, 1891 volume = {43}, 1892 number = {2}, 1893 pages = {C127--C153}, 1894 eprint = {http://arxiv.org/abs/2004.08729}, 1895 doi = {10.1137/20M1332748}, 1896 year = {2021}, 1897 petsc_uses = {KSP} 1898} 1899 1900@Article{ parsani2021, 1901 title = {High-order accurate entropy-stable discontinuous collocated Galerkin methods with 1902 the summation-by-parts property for compressible CFD frameworks: Scalable SSDC 1903 algorithms and flow solver}, 1904 author = {Matteo Parsani and Radouan Boukharfane and Irving Reyna Nolasco and David C. {Del 1905 Rey Fernández} and Stefano Zampini and Bilel Hadri and Lisandro Dalcin}, 1906 journal = {Journal of Computational Physics}, 1907 volume = {424}, 1908 pages = {109844}, 1909 issn = {0021-9991}, 1910 doi = {https://doi.org/10.1016/j.jcp.2020.109844}, 1911 url = {http://www.sciencedirect.com/science/article/pii/S0021999120306185}, 1912 year = {2021}, 1913 petsc_uses = {KSP} 1914} 1915 1916@Article{ ambartsumyanbouakaramthanhghattaskeyesstadlerturkiyyahzampini2020, 1917 title = {Hierarchical matrix approximations of {Hessians} arising in inverse problems 1918 governed by {PDEs}}, 1919 author = {I. Ambartsumyan and W. Bouakaram and Than Bui-Thanh and Omar Ghattas and David 1920 Keyes and Georg Stadler and George Turkiyyah and Stefano Zampini}, 1921 journal = {SIAM Journal of Scientific Computing}, 1922 volume = {42}, 1923 number = {5}, 1924 pages = {A3397--A3426}, 1925 year = {2020} 1926} 1927 1928@Article{ zampinibouakaramturkiyyahkniokeyes2022, 1929 title = {H2Opus: a distributed memory {multi-GPU} software for non-local operators}, 1930 author = {Stefano Zampini and W. Bouakaram and George Turkiyyah and O. Knio and David E. 1931 Keyes}, 1932 journal = {Advances on Computational Mathematics}, 1933 note = {In press}, 1934 year = {2022} 1935} 1936 1937@Article{ dassizampiniscacchi2022, 1938 title = {Robust and scalable adaptive {BDDC} preconditioners for virtual element 1939 discretizations of elliptic equations in mixed form}, 1940 author = {F. Dassi and Stefano Zampini and S. Scacchi}, 1941 journal = {Computer Methods in Applied Mechanics and Engineering}, 1942 volume = {391}, 1943 pages = {114620}, 1944 year = {2022} 1945} 1946 1947@Article{ youngoppenheimdimant2017, 1948 author = {Matthew A. Young and Meers M. Oppenheim and Yakov S. Dimant}, 1949 title = {Hybrid simulations of coupled Farley-Buneman/gradient drift instabilities in the 1950 equatorial E region ionosphere}, 1951 journal = {Journal of Geophysical Research: Space Physics}, 1952 volume = {122}, 1953 number = {5}, 1954 issn = {2169-9402}, 1955 doi = {10.1002/2017JA024161}, 1956 pages = {5768--5781}, 1957 year = {2017}, 1958 petsc_uses = {KSP} 1959} 1960 1961@Article{ rioussetpatylillisfillingimenglandwithershale2013, 1962 title = {Three-dimensional multifluid modeling of atmospheric electrodynamics in Mars' 1963 dynamo region}, 1964 author = {Jeremy A Riousset and Carol S Paty and Robert J Lillis and Matthew O Fillingim 1965 and Scott L England and Paul G Withers and John P M Hale}, 1966 journal = {Journal of Geophysical Research: Space Physics}, 1967 volume = {118}, 1968 number = {6}, 1969 pages = {3647--3659}, 1970 year = {2013}, 1971 publisher = {Wiley Online Library}, 1972 petsc_uses = {KSP} 1973} 1974 1975@Article{ chien2016representation, 1976 title = {Representation of topography by partial steps using the immersed boundary method 1977 in a vector vorticity equation model (VVM)}, 1978 author = {Chien, Mu-Hua and Wu, Chien-Ming}, 1979 journal = {Journal of Advances in Modeling Earth Systems}, 1980 year = {2016}, 1981 publisher = {Wiley Online Library}, 1982 petsc_uses = {KSP} 1983} 1984 1985@Article{ berger2015parallel, 1986 title = {Parallel preconditioners for monolithic solution of shear bands}, 1987 author = {Berger-Vergiat, Luc and McAuliffe, Colin and Waisman, Haim}, 1988 journal = {Journal of Computational Physics}, 1989 year = {2015}, 1990 publisher = {Elsevier}, 1991 petsc_uses = {KSP} 1992} 1993 1994@Article{ may2015496, 1995 title = {A scalable, matrix-free multigrid preconditioner for finite element 1996 discretizations of heterogeneous {S}tokes flow }, 1997 journal = {Computer Methods in Applied Mechanics and Engineering }, 1998 volume = {290}, 1999 number = {0}, 2000 pages = {496--523}, 2001 year = {2015}, 2002 issn = {0045-7825}, 2003 doi = {10.1016/j.cma.2015.03.014}, 2004 author = {D.A. May and J. Brown and L. {Le Pourhiet}}, 2005 petsc_uses = {KSP} 2006} 2007 2008@Article{ isaacknepley2017, 2009 title = {Support for Non-conformal Meshes in {PETSc}'s {DMPlex} Interface}, 2010 author = {Tobin Isaac and Matthew G. Knepley}, 2011 journal = {ArXiv e-prints}, 2012 eprint = {1508.02470}, 2013 year = {2017}, 2014 note = {\url{http://arxiv.org/abs/1508.02470}}, 2015 petsc_uses = {DMPlex} 2016}} 2017 2018@Article{ knepleylangegorman2017, 2019 title = {Unstructured Overlapping Mesh Distribution in Parallel}, 2020 author = {Matthew G. Knepley and Michael Lange and Gerard J. Gorman}, 2021 journal = {ArXiv e-prints}, 2022 eprint = {1506.06194}, 2023 year = {2017}, 2024 note = {\url{http://arxiv.org/abs/1506.06194}}, 2025 petsc_uses = {DMPlex} 2026} 2027 2028@Article{ langemitchellknepleygorman2015, 2029 title = {Efficient mesh management in {Firedrake} using {PETSc-DMPlex}}, 2030 author = {Michael Lange and Lawrence Mitchell and Matthew G. Knepley and Gerard J. Gorman}, 2031 journal = {SIAM Journal on Scientific Computing}, 2032 volume = {38}, 2033 number = {5}, 2034 pages = {S143--S155}, 2035 eprint = {http://arxiv.org/abs/1506.07749}, 2036 doi = {10.1137/15M1026092}, 2037 year = {2016}, 2038 petsc_uses = {DMPlex} 2039} 2040 2041@InProceedings{ langeknepleygorman2015, 2042 title = {Flexible, Scalable Mesh and Data Management using {PETSc DMPlex}}, 2043 author = {Michael Lange and Matthew G. Knepley and Gerard J. Gorman}, 2044 booktitle = {Proceedings of the Exascale Applications and Software Conference}, 2045 month = apr, 2046 url = {http://www.easc2015.ed.ac.uk/sites/default/files/attachments/EASC15Proceedings.pdf}, 2047 year = {2015}, 2048 petsc_uses = {DMPlex} 2049} 2050 2051@InProceedings{ wallworkknepleybarralpiggott2022, 2052 title = {Parallel Metric-Based Mesh Adaptation in {PETSc} using {ParMmg}}, 2053 author = {Joseph G. Wallwork and Matthew G. Knepley and Nicolas Barral and Matthew D. 2054 Piggott}, 2055 booktitle = {SIAM International Meshing Roundtable Workshop 2022}, 2056 editor = {Trevor Robinson}, 2057 month = jan, 2058 address = {Seattle, WA}, 2059 pages = {1--5}, 2060 url = {http://imr.sandia.gov/papers/imr31/2026_imr31RJ_Wallwork.pdf}, 2061 year = {2022}, 2062 petsc_uses = {DMPlex} 2063} 2064 2065@InProceedings{ timalsinaknepley2023, 2066 title = {Tetrahedralization of a Hexahedral Mesh}, 2067 author = {Aman Timalsina and Matthew G. Knepley}, 2068 booktitle = {SIAM International Meshing Roundtable Workshop 2023}, 2069 year = {2023}, 2070 petsc_uses = {DMPlex} 2071} 2072 2073@Article{ farrellknepleywechsungmitchell2020, 2074 title = {{PCPATCH}: software for the topological construction of multigrid relaxation 2075 methods}, 2076 author = {Patrick E Farrell and Matthew G Knepley and Lawrence Mitchell and Florian 2077 Wechsung}, 2078 journal = {ACM Transaction on Mathematical Software}, 2079 eprint = {http://arxiv.org/abs/1912.08516}, 2080 volume = {47}, 2081 number = {3}, 2082 pages = {1--22}, 2083 year = {2021}, 2084 petsc_uses = {KSP,DMPlex} 2085} 2086 2087@Article{ farrellmitchellscottwechsung2022, 2088 title = {Robust multigrid methods for nearly incompressible elasticity using macro 2089 elements}, 2090 author = {Patrick E Farrell and Lawrence Mitchell and L Ridgway Scott and Florian 2091 Wechsung}, 2092 journal = {IMA Journal of Numerical Analysis}, 2093 issn = {0272-4979}, 2094 doi = {10.1093/imanum/drab083}, 2095 url = {https://doi.org/10.1093/imanum/drab083}, 2096 year = {2022}, 2097 petsc_uses = {KSP,DMPlex} 2098} 2099 2100@Misc{ firedrakeproject, 2101 title = {{The Firedrake project}}, 2102 author = {David A Ham and Firedrake Team}, 2103 url = {http://firedrakeproject.org}, 2104 year = {2022}, 2105 petsc_uses = {KSP} 2106} 2107 2108@Article{ rathgeberhammitchelllangeluporinimcraeberceamarkallkelly2016, 2109 title = {Firedrake: automating the finite element method by composing abstractions}, 2110 author = {Florian Rathgeber and David A Ham and Lawrence Mitchell and Michael Lange and 2111 Fabio Luporini and Andrew TT McRae and Gheorghe-Teodor Bercea and Graham R Markall 2112 and Paul HJ Kelly}, 2113 journal = {ACM Transactions on Mathematical Software (TOMS)}, 2114 volume = {43}, 2115 number = {3}, 2116 pages = {24}, 2117 year = {2016}, 2118 petsc_uses = {KSP} 2119} 2120 2121@Article{ mitchellmuller2016, 2122 title = {High level implementation of geometric multigrid solvers for finite element 2123 problems: Applications in atmospheric modelling}, 2124 author = {Lawrence Mitchell and Eike Hermann M{\"u}ller}, 2125 journal = {Journal of Computational Physics}, 2126 volume = {327}, 2127 pages = {1--18}, 2128 year = {2016}, 2129 petsc_uses = {KSP} 2130} 2131 2132@Article{ mcraeberceamitchellhamcotter2016, 2133 title = {Automated generation and symbolic manipulation of tensor product finite 2134 elements}, 2135 author = {Andrew TT McRae and Gheorghe-Teodor Bercea and Lawrence Mitchell and David A Ham 2136 and Colin J Cotter}, 2137 journal = {SIAM Journal on Scientific Computing}, 2138 volume = {38}, 2139 number = {5}, 2140 pages = {S25--S47}, 2141 year = {2016}, 2142 petsc_uses = {KSP} 2143} 2144 2145@Article{ berceamcraehammitchellrathgebernardiluporinikelly2016, 2146 title = {A structure-exploiting numbering algorithm for finite elements on extruded 2147 meshes, and its performance evaluation in {Firedrake}}, 2148 author = {Gheorghe-Teodor Bercea and Andrew TT McRae and David A Ham and Lawrence Mitchell 2149 and Florian Rathgeber and L. Nardi and Fabio Luporini and Paul HJ Kelly}, 2150 journal = {Geoscientific Model Development}, 2151 volume = {9}, 2152 number = {10}, 2153 pages = {3803--3815}, 2154 doi = {10.5194/gmd-9-3803-2016}, 2155 year = {2016}, 2156 petsc_uses = {KSP} 2157} 2158 2159@InProceedings{ markallrathgebermitchellloriantbertollihamkelly2013, 2160 author = {Graham R. Markall and Florian Rathgeber and Lawrence Mitchell and Nicolas Loriant 2161 and Carlo Bertolli and David A. Ham and Paul HJ Kelly}, 2162 editor = {Julian Martin Kunkel and Thomas Ludwig and Hans Werner Meuer}, 2163 title = {Performance-Portable Finite Element Assembly Using {PyOP2} and {FEniCS}}, 2164 booktitle = {Proceedings of 28th International Supercomputing Conference, ISC 2013}, 2165 publisher = {Springer Berlin Heidelberg}, 2166 pages = {279--289}, 2167 isbn = {978-3-642-38750-0}, 2168 doi = {10.1007/978-3-642-38750-0_21}, 2169 year = {2013}, 2170 petsc_uses = {KSP} 2171} 2172 2173@Article{ kirbymitchell2017, 2174 title = {Solver composition across the {PDE}/linear algebra barrier}, 2175 author = {Robert C Kirby and Lawrence Mitchell}, 2176 journal = {arXiv preprint arXiv:1706.01346}, 2177 year = {2017}, 2178 petsc_uses = {KSP} 2179} 2180 2181@Article{ saibaba2012application, 2182 title = {Application of hierarchical matrices to linear inverse problems in 2183 geostatistics}, 2184 author = {Saibaba, Arvind Krishna and Ambikasaran, Sivaram and Yue Li, J and Kitanidis, 2185 Peter K and Darve, Eric F}, 2186 journal = {Oil and Gas Science and Technology-Revue de l'IFP-Institut Francais du Petrole}, 2187 volume = {67}, 2188 number = {5}, 2189 pages = {857}, 2190 year = {2012}, 2191 petsc_uses = {KSP} 2192} 2193 2194@Article{ collignonkausmayfernandez14, 2195 author = {Collignon, M. and Kaus, B. and May, D.A. and Fern\'andez, N.}, 2196 title = {Influences of surface processes on fold growth during {3-D} detachment folding}, 2197 journal = {Geochem Geophy Geosy}, 2198 year = {2014}, 2199 petsc_uses = {KSP} 2200} 2201 2202@Article{ fernandezkaus14, 2203 author = {Fern\'andez, N. and Kaus, B.}, 2204 title = {Fold interaction and wavelength selection in 3D models of multilayer detachment 2205 folding}, 2206 journal = {Tectonophysics}, 2207 year = {2014}, 2208 petsc_uses = {KSP} 2209} 2210 2211@Article{ baumannkauspopov14, 2212 author = {Baumann, T. and Kaus, B. J. P. and Popov, A.}, 2213 title = {Constraining effective rheology through parallel joint geodynamic inversion}, 2214 journal = {Tectonophysics}, 2215 year = {2014}, 2216 petsc_uses = {KSP} 2217} 2218 2219@Article{ lechmannschmalholzhetenyimaykaus14, 2220 author = {Lechmann, S. M. and Schmalholz, S. M. and Hetenyi, G. and May, D. A. and Kaus, B. 2221 J. P.}, 2222 title = {Quantifying the impact of mechanical layering and underthrusting on the dynamics 2223 of the modern {India-Asia} collisional system with {3-D} numerical models}, 2224 journal = { Journal of Geophysical Research - Solid Earth}, 2225 year = {2014}, 2226 petsc_uses = {KSP} 2227} 2228 2229@InBook{ fernandezkaus14b, 2230 author = {Fern\'andez N. and Kaus B.J.P.}, 2231 title = {Analytical and numerical investigation of 3D multilayer detachment}, 2232 booktitle = {Mathematics of Planet Earth}, 2233 editor = {Pardo-Ig\'uzquiza E. and Guardiola-Albert C. and Heredia J. and Moreno-Merino L. 2234 and Dur\'an J.J. and Vargas-Guzman J.A.}, 2235 publisher = {Springer}, 2236 year = {2014}, 2237 petsc_uses = {KSP} 2238} 2239 2240@Article{ hossein-hsueh-etal-2014a, 2241 author = {Hossein, M.Z. and Hsueh, C.-J. and Bourdin, B. and Bhattacharya, K.}, 2242 journal = {J. Mech. Phys. Solids}, 2243 pages = {320--348}, 2244 title = {Effective toughness of heterogeneous media}, 2245 volume = {71}, 2246 year = {2014}, 2247 petsc_uses = {KSP} 2248} 2249 2250@Unpublished{ leon-baldelli-bourdin-2014a, 2251 author = {Le\'{o}n Baldelli, A.A. and Bourdin, B.}, 2252 month = aug, 2253 note = {Submitted.}, 2254 title = {On the asymptotic derivation of Winkler-type energies from {3D} elasticity}, 2255 year = {2014}, 2256 petsc_uses = {KSP} 2257} 2258 2259@Article{ leon-baldelli-babadjian-etal-2013a, 2260 author = {Leòn-Baldelli, A. A. and Babadjian, J.-F. and Bourdin, B. and Henao, D. and 2261 Maurini, C.}, 2262 journal = {J. Mech. Phys. Solids}, 2263 pages = {15-32}, 2264 title = {A Variational Model For Fracture And Delamination Of Thin Films}, 2265 volume = {70}, 2266 year = {2014}, 2267 petsc_uses = {KSP} 2268} 2269 2270@Article{ mesgarnejad-bourdin-etal-2014a, 2271 author = {Mesgarnejad, A. and Bourdin, B. and Khonsari, M. M.}, 2272 journal = {Comp. Methods Appl. Mech. Engng.}, 2273 title = {Validation simulations for the variational approach to fracture}, 2274 volume = {Submitted}, 2275 year = {2014}, 2276 petsc_uses = {KSP} 2277} 2278 2279@InProceedings{ bourdin-chukwudozie-etal-2013a, 2280 author = {Bourdin, B. and Chukwudozie, C. and Yoshioka, K.}, 2281 booktitle = {Proceedings of the 38th Workshop on Geothermal Reservoir Engineering Stanford 2282 University, Stanford, CA}, 2283 title = {A Variational Approach To The Modeling And Numerical Simulation Of Hydraulic 2284 Fracturing Under In-Situ Stresses}, 2285 year = {2013}, 2286 petsc_uses = {KSP} 2287} 2288 2289@Article{ maurini-bourdin-etal-2012a, 2290 author = {Maurini, C. and Bourdin, B. and Gauthier, G. and Lazarus, V.}, 2291 journal = {Int. J. Fracture}, 2292 number = {1-2}, 2293 pages = {75-91}, 2294 title = {Crack patterns obtained by unidirectional drying of a colloidal suspension in a 2295 capillary tube: experiments and numerical simulations using a two-dimensional 2296 variational approach}, 2297 volume = {184}, 2298 year = {2013}, 2299 petsc_uses = {KSP} 2300} 2301 2302@Article{ mesgarnejad-bourdin-etal-2013a, 2303 author = {Mesgarnejad, A. and Bourdin, B. and Khonsari, M.M.}, 2304 journal = {J. Mech. Phys Solids}, 2305 number = {11}, 2306 pages = {2360--2379}, 2307 title = {A variational approach to the fracture of brittle thin films under out of plane 2308 loading}, 2309 volume = {61}, 2310 year = {2013}, 2311 petsc_uses = {KSP} 2312} 2313 2314@InProceedings{ bourdin-chukwudozie-etal-2012a, 2315 author = {Bourdin, B. and Chukwudozie, C. and Yoshioka, K.}, 2316 booktitle = {Proceedings of the 2012 SPE Annual Technical Conference and Exhibition}, 2317 title = {A Variational Approach to the Numerical Simulation of Hydraulic Fracturing}, 2318 volume = {SPE 159154}, 2319 year = {2012}, 2320 petsc_uses = {KSP} 2321} 2322 2323@Article{ millerdawsonfarthinghouhuangkeeskelleylangtangen13, 2324 author = {Cass T. Miller and Clint N. Dawson and Matthew W. Farthing and Thomas Y. Hou and 2325 Jingfang Huang and Christopher E. Kees and C.T. Kelley and Hans Petter 2326 Langtangen}, 2327 title = {Numerical simulation of water resources problems: Models, methods, and trends}, 2328 journal = {Advances in Water Resources}, 2329 volume = {51}, 2330 number = {0}, 2331 pages = {405--437}, 2332 year = {2013}, 2333 note = {35th Year Anniversary Issue}, 2334 issn = {0309-1708}, 2335 doi = {10.1016/j.advwatres.2012.05.008}, 2336 petsc_uses = {KSP} 2337} 2338 2339@Article{ scheltingamyerspietrzak10, 2340 author = {Terwisscha van Scheltinga, ArjenD. and Myers, PaulG. and Pietrzak, JulieD.}, 2341 title = {A finite element sea ice model of the Canadian Arctic Archipelago}, 2342 journal = {Ocean Dynamics}, 2343 volume = {60}, 2344 number = {6}, 2345 pages = {1539-1558}, 2346 year = {2010}, 2347 issn = {1616-7341}, 2348 doi = {10.1007/s10236-010-0356-5}, 2349 publisher = {Springer-Verlag}, 2350 keywords = {Ocean modelling; Unstructured meshes; Sea ice; Arctic Ocean; Canadian Arctic 2351 Archipelago; Freshwater flux}, 2352 language = {English}, 2353 petsc_uses = {KSP} 2354} 2355 2356@InBook{ destefanoandreasisecchi13, 2357 author = {M. De Stefano and F. Golfré Andreasi and A. Secchi}, 2358 title = {Towards preconditioned nonlinear conjugate gradients for generic geophysical 2359 inversions}, 2360 booktitle = {SEG Technical Program Expanded Abstracts 2013}, 2361 chapter = {626}, 2362 pages = {3226--3230}, 2363 doi = {10.1190/segam2013-0244.1}, 2364 url = {http://library.seg.org/doi/abs/10.1190/segam2013-0244.1}, 2365 eprint = {http://library.seg.org/doi/pdf/10.1190/segam2013-0244.1}, 2366 petsc_uses = {KSP} 2367} 2368 2369@Article{ pourhiethuetmaylabroussejolivet12, 2370 author = {L. {Le Pourhiet} and B. Huet and D. A. May and L. Labrousse and L. Jolivet}, 2371 title = {Kinematic interpretation of the 3D shapes of metamorphic core complexes}, 2372 journal = {Geochem. Geophys. Geosyst.}, 2373 volume = {13}, 2374 pages = {Q09002}, 2375 year = {2012}, 2376 doi = {10.1029/2012GC004271}, 2377 petsc_uses = {KSP} 2378} 2379 2380@Article{ lechmannmaykausschmalholz11, 2381 author = {S. M. Lechmann and D. A. May and B. J. P. Kaus and S. M. Schmalholz}, 2382 title = {Comparing thin-sheet models with {3-D} multilayer models for continental 2383 collision}, 2384 journal = {Geophysical Journal International}, 2385 volume = {187}, 2386 pages = {10--33}, 2387 year = {2011}, 2388 doi = {10.1111/j.1365-246X.2011.05164.x}, 2389 petsc_uses = {KSP} 2390} 2391 2392@Article{ stefano:r69, 2393 author = {Michele De Stefano and Federico Golfr\'{e} Andreasi and Simone Re and Massimo 2394 Virgilio and Fred F. Snyder}, 2395 collaboration = {}, 2396 title = {Multiple-domain, simultaneous joint inversion of geophysical data with 2397 application to subsalt imaging}, 2398 publisher = {SEG}, 2399 year = {2011}, 2400 journal = {Geophysics}, 2401 volume = {76}, 2402 number = {3}, 2403 pages = {R69-R80}, 2404 keywords = {geophysical image processing; inverse problems; seismology}, 2405 doi = {10.1190/1.3554652}, 2406 petsc_uses = {KSP} 2407} 2408 2409@Article{ stefano:806, 2410 author = {Michele De Stefano}, 2411 collaboration = {}, 2412 title = {Simultaneous joint inversion for susceptibility and velocity}, 2413 publisher = {SEG}, 2414 year = {2011}, 2415 journal = {SEG Technical Program Expanded Abstracts}, 2416 volume = {30}, 2417 number = {1}, 2418 pages = {806-810}, 2419 keywords = {3D; imaging; inversion; magnetics; multiparameter}, 2420 doi = {10.1190/1.3628198}, 2421 petsc_uses = {KSP} 2422} 2423 2424@Article{ mayknepley2011, 2425 author = {Dave A. May and Matthew G. Knepley}, 2426 title = {Optimal, scalable forward models for computing gravity anomalies}, 2427 journal = {Geophysical Journal International}, 2428 volume = {187}, 2429 number = {1}, 2430 pages = {161--177}, 2431 url = {http://arxiv.org/abs/1107.5951}, 2432 note = {\url{http://arxiv.org/abs/1107.5951}}, 2433 year = {2011}, 2434 petsc_uses = {KSP} 2435} 2436 2437@InProceedings{ bourdinknepleymaurini2010, 2438 author = {Blaise Bourdin and Matthew G. Knepley and C. Maurini}, 2439 title = {Numerical Simulation of Reservoir Stimulation - A Variational Approach}, 2440 booktitle = {Proceedings of the 37th Stanford Geothermal Workshop}, 2441 url = {https://es.stanford.edu/ERE/pdf/IGAstandard/SGW/2011/bourdin.pdf}, 2442 note = {\url{https://es.stanford.edu/ERE/pdf/IGAstandard/SGW/2011/bourdin.pdf}}, 2443 address = {Stanford, CA}, 2444 year = {2010}, 2445 petsc_uses = {KSP} 2446} 2447 2448@InProceedings{ bourdinknepleymaurini2010b, 2449 author = {Blaise Bourdin and Matthew G. Knepley and C. Maurini}, 2450 title = {Secondary Thermal Cracks in {EGS}: a Variational Approach}, 2451 booktitle = {Proceedings of the 34th Annual Meeting of the Geothermal Resources Council}, 2452 url = {https://www.math.lsu.edu/~bourdin/Biography_assets/Bourdin-Knepley-Maurini-2010.pdf}, 2453 note = {\url{https://www.math.lsu.edu/~bourdin/Biography_assets/Bourdin-Knepley-Maurini-2010.pdf}}, 2454 address = {Sacramento, CA}, 2455 year = {2010}, 2456 petsc_uses = {KSP} 2457} 2458 2459@Article{ chen2007full, 2460 title = {Full 3D tomography for the crustal structure of the Los Angeles region}, 2461 author = {Chen, P. and Zhao, L. and Jordan, T.H.}, 2462 journal = {Bulletin of the Seismological Society of America}, 2463 volume = {97}, 2464 number = {4}, 2465 pages = {1094}, 2466 year = {2007}, 2467 publisher = {Seismol Soc America}, 2468 petsc_uses = {KSP} 2469} 2470 2471@Article{ brown2010ens, 2472 author = {Brown, Jed}, 2473 affiliation = {Versuchsanstalt für Wasserbau, Hydrologie und Glaziologie (VAW), ETH Zürich, 2474 Zürich, Switzerland}, 2475 title = {Efficient Nonlinear Solvers for Nodal High-Order Finite Elements in {3D}}, 2476 journal = {Journal of Scientific Computing}, 2477 publisher = {Springer Netherlands}, 2478 issn = {0885-7474}, 2479 keyword = {Mathematics and Statistics}, 2480 pages = {48-63}, 2481 volume = {45}, 2482 issue = {1}, 2483 doi = {10.1007/s10915-010-9396-8}, 2484 year = {2010}, 2485 petsc_uses = {KSP} 2486} 2487 2488@PhDThesis{ brown2011, 2489 title = {Computational methods for ice flow simulation}, 2490 author = {Jed Brown}, 2491 school = {ETH Z{\"u}rich}, 2492 year = {2011}, 2493 petsc_uses = {KSP} 2494} 2495 2496@Article{ brown2013tmeice, 2497 title = {Achieving textbook multigrid efficiency for hydrostatic ice flow}, 2498 author = {Jed Brown and Barry F. Smith and Aron Ahmadia}, 2499 journal = {SIAM Journal on Scientific Computing}, 2500 volume = {35}, 2501 number = {2}, 2502 year = {2013}, 2503 pages = {359--375}, 2504 doi = {10.1137/110834512}, 2505 note = {Also preprint ANL/MCS-P743-1298}, 2506 petsc_uses = {KSP} 2507} 2508 2509@InProceedings{ brown2013quasinewton, 2510 author = {Jed Brown and Peter Brune}, 2511 title = {Low-rank quasi-{N}ewton updates for robust {J}acobian lagging in {N}ewton-type 2512 methods}, 2513 year = {2013}, 2514 booktitle = {International Conference on Mathematics and Computational Methods Applied to 2515 Nuclear Science and Engineering}, 2516 pages = {2554--2565}, 2517 petsc_uses = {KSP} 2518} 2519 2520@Misc{ spiegelman-siampp10, 2521 title = {Block Preconditioners and Advanced Software for Multiphysics Problems in Solid 2522 Earth Geodynamics}, 2523 author = {Marc Spiegelman}, 2524 note = {presentation at the 2010 SIAM Conference on Parallel Processing for Scientific 2525 Computing}, 2526 year = {2010}, 2527 petsc_uses = {KSP} 2528} 2529 2530@Article{ schauer2011a, 2531 author = {Marco Schauer and Sabine Langer and Jose E. Roman and Enrique S. 2532 Quintana-Ort\'{\i}}, 2533 title = {Large scale simulation of wave propagation in soils interacting with structures 2534 using {FEM} and {SBFEM}}, 2535 journal = {Journal of Computational Acoustics}, 2536 volume = {19}, 2537 number = {1}, 2538 pages = {75--93}, 2539 year = {2011}, 2540 doi = {10.1142/S0218396X11004316}, 2541 petsc_uses = {KSP} 2542} 2543 2544@Misc{ bsa2010, 2545 author = {J. Brown and B. Smith and A. Ahmadia}, 2546 title = {Achieving textbook multigrid efficiency for hydrostatic ice sheet flow}, 2547 note = {submitted to SIAM Journal on Scientific Computing}, 2548 year = {2012}, 2549 petsc_uses = {KSP} 2550} 2551 2552@Article{ kellerkatz2016, 2553 title = {The Role of Volatiles in Reactive Melt Transport in the Asthenosphere}, 2554 author = {Tobias Keller and Richard F. Katz}, 2555 journal = {Journal of Petrology}, 2556 doi = {10.1093/petrology/egw030}, 2557 url = {http://petrology.oxfordjournals.org/content/early/2016/07/15/petrology.egw030.abstract}, 2558 eprint = {http://petrology.oxfordjournals.org/content/early/2016/07/15/petrology.egw030.full.pdf+html}, 2559 year = {2016}, 2560 petsc_uses = {KSP} 2561} 2562 2563@Article{ weatherley12, 2564 author = {S. Weatherley and R.F. Katz}, 2565 title = {Melting and channelized magmatic flow in chemically heterogeneous, upwelling 2566 mantle}, 2567 journal = {Geochem.\ Geophys.\ Geosys.}, 2568 year = {2012}, 2569 volume = {13}, 2570 number = {1}, 2571 pages = {Q0AC18}, 2572 doi = {10.1029/2011GC003989}, 2573 petsc_uses = {KSP} 2574} 2575 2576@Article{ katz12, 2577 author = {R.F. Katz and S. Weatherley}, 2578 title = {Consequences of mantle heterogeneity for melt extraction at mid-ocean ridges}, 2579 journal = {Earth\ Planet.\ Sci.\ Lett.}, 2580 year = {2012}, 2581 doi = {10.1016/j.epsl.2012.04.042}, 2582 volume = {335-336}, 2583 pages = {226-237}, 2584 petsc_uses = {KSP} 2585} 2586 2587@Article{ katz10b, 2588 author = {R.F. Katz}, 2589 title = {Porosity-driven convection and asymmetry beneath mid-ocean ridges}, 2590 journal = {Geochem.\ Geophys.\ Geosys.}, 2591 volume = {10}, 2592 number = {Q0AC07}, 2593 year = {2010}, 2594 doi = {10.1029/2010GC003282}, 2595 petsc_uses = {KSP} 2596} 2597 2598@Article{ england10, 2599 author = {P.C. England and R.F. Katz}, 2600 title = {Melting above the anhydrous solidus controls the location of volcanic arcs}, 2601 journal = {Nature}, 2602 year = {2010}, 2603 volume = {467}, 2604 pages = {700--703}, 2605 doi = {10.1038/nature09417}, 2606 petsc_uses = {KSP} 2607} 2608 2609@Article{ weatherley10, 2610 author = {S. Weatherley and R.F. Katz}, 2611 title = {Plate-Driven Mantle Dynamics and Global Patterns of Mid-Ocean Ridge Bathymetry}, 2612 journal = {Geochem.\ Geophys.\ Geosys.}, 2613 year = {2010}, 2614 volume = {11}, 2615 number = {10}, 2616 doi = {10.1029/2010GC003192}, 2617 petsc_uses = {KSP} 2618} 2619 2620@Article{ katz10, 2621 author = {R.F. Katz and M.G. Worster}, 2622 title = {The stability of ice-sheet grounding lines}, 2623 journal = {Proc.~Roy.~Soc.~A}, 2624 year = {2010}, 2625 volume = {466}, 2626 pages = {1597--1620}, 2627 doi = {10.1098/rspa.2009.0434}, 2628 url = {http://www.earth.ox.ac.uk/~richardk/publications/Katz_Worster_PRSA10.pdf}, 2629 petsc_uses = {KSP} 2630} 2631 2632@Article{ kyrkesmith2013stress, 2633 title = {Stress balances of ice streams in a vertically integrated, higher-order 2634 formulation}, 2635 author = {Kyrke-Smith, T.M. and Katz, R.F. and Fowler, A.C.}, 2636 journal = {Journal of Glaciology}, 2637 volume = {59}, 2638 number = {215}, 2639 pages = {449--466}, 2640 year = {2013}, 2641 doi = {10.3189/2013JoG12J140}, 2642 petsc_uses = {KSP} 2643} 2644 2645@Article{ takei2013anisotropy1, 2646 author = {Takei Y. and R.F. Katz}, 2647 title = {{Consequences of viscous anisotropy in a deforming, two-phase aggregate: 1. 2648 Governing equations and linearised analysis}}, 2649 journal = {J.\ Fluid\ Mech.}, 2650 year = {2013}, 2651 volume = {734}, 2652 pages = {424-455}, 2653 doi = {10.1017/jfm.2013.482}, 2654 petsc_uses = {KSP} 2655} 2656 2657@Article{ katz2013anisotropy2, 2658 author = {Katz R.F. and Y. Takei}, 2659 title = {{Consequences of viscous anisotropy in a deforming, two-phase aggregate: 2. 2660 Numerical solutions of the full equations}}, 2661 journal = {J.\ Fluid\ Mech.}, 2662 year = {2013}, 2663 volume = {734}, 2664 pages = {456-485}, 2665 doi = {10.1017/jfm.2013.483}, 2666 petsc_uses = {KSP} 2667} 2668 2669@Article{ kyrke-smith2014subglacial, 2670 author = {Kyrke-Smith, T.M. and R.F. Katz and A.C. Fowler}, 2671 title = {Subglacial hydrology and the formation of ice streams}, 2672 journal = {Proc.\ Roy.\ Soc.\ A}, 2673 year = {2014}, 2674 volume = {470}, 2675 number = {2161}, 2676 doi = {10.1098/rspa.2013.0494}, 2677 petsc_uses = {KSP} 2678} 2679 2680@Article{ spiegelmanwilsonvankeken2013, 2681 author = {{Spiegelman}, M.~W. and {Wilson}, C.~R. and {Van Keken}, P.~E. }, 2682 title = {{TerraFERMA: The Transparent Finite Element Rapid Model Assembler for 2683 multi-physics problems in the solid Earth sciences}}, 2684 journal = {AGU Fall Meeting Abstracts}, 2685 keywords = {0560 COMPUTATIONAL GEOPHYSICS Numerical solutions, 1902 INFORMATICS Community 2686 modeling frameworks, 1906 INFORMATICS Computational models, algorithms}, 2687 year = {2013}, 2688 month = dec, 2689 pages = {A2208}, 2690 adsurl = {http://adsabs.harvard.edu/abs/2013AGUFMDI31A2208S}, 2691 adsnote = {Provided by the SAO/NASA Astrophysics Data System}, 2692 petsc_uses = {KSP} 2693} 2694 2695@Article{ bueler2009shallow, 2696 title = {{Shallow shelf approximation as a ``sliding law'' in a thermomechanically coupled 2697 ice sheet model}}, 2698 author = {Ed Bueler and Jed Brown}, 2699 journal = {Journal of Geophysical Research-Earth Surface}, 2700 volume = {114}, 2701 number = {F3}, 2702 pages = {F03008}, 2703 year = {2009}, 2704 publisher = {American Geophysical Union}, 2705 petsc_uses = {KSP} 2706} 2707 2708@Article{ bueler2007est, 2709 title = {{Exact solutions to the thermomechanically coupled shallow ice approximation: 2710 effective tools for verification}}, 2711 author = {Ed Bueler and Jed Brown and Craig Lingle}, 2712 journal = {J. Glaciol}, 2713 volume = {53}, 2714 pages = {499--516}, 2715 year = {2007}, 2716 petsc_uses = {KSP} 2717} 2718 2719@Article{ bueler2007fcv, 2720 title = {{Fast computation of a viscoelastic deformable Earth model for ice-sheet 2721 simulations}}, 2722 author = {Ed Bueler and Craig S. Lingle and Jed Brown}, 2723 journal = {Ann. Glaciol}, 2724 volume = {46}, 2725 pages = {97--105}, 2726 year = {2007}, 2727 petsc_uses = {KSP} 2728} 2729 2730@Article{ bueler2005iso, 2731 author = {Ed Bueler and Craig S. Lingle and Jed A. Kallen-Brown and David N. Covey and 2732 Latrice N. Bowman}, 2733 title = {Exact solutions and numerical verification for isothermal ice sheets}, 2734 journal = {J. Glaciol.}, 2735 volume = {51}, 2736 number = {173}, 2737 pages = {291--306}, 2738 year = {2005}, 2739 petsc_uses = {KSP} 2740} 2741 2742@Article{ chao2008programming, 2743 title = {{Programming on Numerical Simulation of Tsunami with PETSc and FEPG}}, 2744 author = {Chao-fan, Z. and Yao-lin, S.}, 2745 journal = {Earthquake}, 2746 year = {2008}, 2747 petsc_uses = {KSP} 2748} 2749 2750@Article{ marti2014, 2751 author = {Marti, P. and Schaeffer, N. and Hollerbach, R. and Cébron, D. and Nore, C. and 2752 Luddens, F. and Guermond, J.-L. and Aubert, J. and Takehiro, S. and Sasaki, Y. and 2753 Hayashi, Y.-Y. and Simitev, R. and Busse, F. and Vantieghem, S. and Jackson, A.}, 2754 title = {Full sphere hydrodynamic and dynamo benchmarks}, 2755 journal = {Geophysical Journal International}, 2756 year = {2014}, 2757 doi = {10.1093/gji/ggt518}, 2758 url = {http://gji.oxfordjournals.org/content/early/2014/01/26/gji.ggt518.abstract}, 2759 petsc_uses = {KSP} 2760} 2761 2762@InProceedings{ ganfulukyangxueyang2013, 2763 author = {Gan, Lin and Fu, Haohuan and Luk, Wayne and Yang, Chao and Xue, Wei and Yang, 2764 Guangwen}, 2765 title = {Global Atmospheric Simulation on a Reconfigurable Platform}, 2766 booktitle = {Proceedings of the 2013 IEEE 21st Annual International Symposium on 2767 Field-Programmable Custom Computing Machines}, 2768 series = {FCCM '13}, 2769 pages = {230--}, 2770 year = {2013}, 2771 isbn = {978-0-7695-4969-9}, 2772 doi = {10.1109/FCCM.2013.26}, 2773 acmid = {2495688}, 2774 publisher = {IEEE Computer Society}, 2775 petsc_uses = {KSP} 2776} 2777 2778@InProceedings{ ganfuchaolukxuemencerhuangyang2014, 2779 author = {Lin Gan and Haohuan Fu and Chao Yang and Luk, W. and Wei Xue and Mencer, O. and 2780 Xiaomeng Huang and Guangwen Yang}, 2781 booktitle = {Field Programmable Logic and Applications (FPL), 2014 24th International 2782 Conference on}, 2783 title = {A highly-efficient and green data flow engine for solving euler atmospheric 2784 equations}, 2785 year = {2014}, 2786 month = sep, 2787 pages = {1-6}, 2788 doi = {10.1109/FPL.2014.6927462}, 2789 petsc_uses = {KSP} 2790} 2791 2792%Aagaard, B., Williams, C., Knepley, M. (2011). PyLith: A finite-element code for modeling quasi-static and dynamic crustal deformation (abstract), EarthScope National Meeting, Austin, Texas, May 17–20. 2793%Aagaard, B., Williams, C., and Knepley, M. (2011). PyLith: A finite-element code for modeling quasi-static and dynamic crustal deformation (abstract), Southern California Earthquake Center Annual Meeting, Palm Springs, California, September 11–14. 2794%Aagaard, B., Williams, C., and Knepley, M. (2012). PyLith: A Finite-Element Code for Modeling Quasi-Static and Dynamic Crustal Deformation (abstract), Seismological Society of America Annual Meeting, San Diego, California, April 17-19. 2795@Article{ aagaardknepleywilliams13, 2796 title = {A Domain Decomposition Approach to Implementing Fault Slip in Finite-Element 2797 Models of Quasi-static and Dynamic Crustal Deformation}, 2798 author = {Brad T. Aagaard and Matthew G. Knepley and Charles A. Williams}, 2799 journal = {Journal of Geophysical Research: Solid Earth}, 2800 volume = {118}, 2801 number = {6}, 2802 pages = {3059--3079}, 2803 issn = {2169-9356}, 2804 doi = {10.1002/jgrb.50217}, 2805 keywords = {fault slip, finite-element modeling, crustal deformation, earthquake physics}, 2806 year = {2013}, 2807 petsc_uses = {KSP} 2808} 2809 2810@InProceedings{ aagaardknepleywilliams11, 2811 author = {Charles A. Williams and Brad Aagaard and Matthew G. Knepley}, 2812 title = {{PyLith}: A Finite-Element Code for Modeling Quasi-Static and Dynamic Crustal 2813 Deformation}, 2814 booktitle = {Eos Transactions of the AGU}, 2815 organization = {American Geophysical Union}, 2816 note = {Fall Meeting Supplemental, Abstract DI14A-08}, 2817 year = {2011}, 2818 petsc_uses = {KSP} 2819} 2820 2821@InProceedings{ knepley10b, 2822 author = {Matthew G. {Knepley}}, 2823 title = {Acceleration of low order finite element computation with {GPUs} (Invited)}, 2824 booktitle = {Eos Transactions of the AGU}, 2825 organization = {American Geophysical Union}, 2826 note = {Fall Meeting Supplemental, Abstract IN44A-01}, 2827 year = {2010}, 2828 petsc_uses = {KSP} 2829} 2830 2831@InProceedings{ mayknepleygurnis09, 2832 author = {Dave A. May and Matthew G. Knepley and Michael Gurnis}, 2833 title = {{CitcomSX}: Robust preconditioning in {CitcomS} via {PETSc}}, 2834 booktitle = {Eos Transactions of the AGU}, 2835 organization = {American Geophysical Union}, 2836 note = {Fall Meeting Supplemental, Abstract P31A-A1241}, 2837 year = {2009}, 2838 petsc_uses = {KSP} 2839} 2840 2841@InProceedings{ yuenknepleyerlebacherwright09, 2842 author = {David A. Yuen and Matthew G. Knepley and Gordon Erlebacher and Grady B. Wright}, 2843 title = {The Coming Role of {GPU} in Computational Geodynamics}, 2844 booktitle = {Eos Transactions of the AGU}, 2845 organization = {American Geophysical Union}, 2846 note = {Fall Meeting Supplemental, Abstract DI22A-05}, 2847 year = {2009}, 2848 petsc_uses = {KSP} 2849} 2850 2851@InProceedings{ aagaardknepleywilliams08, 2852 author = {Brad Aagaard and Charles A. Williams and Matthew G. Knepley}, 2853 title = {{PyLith}: A Finite-Element Code for Modeling Quasi-Static and Dynamic Crustal 2854 Deformation}, 2855 booktitle = {Eos Transactions of the AGU}, 2856 organization = {American Geophysical Union}, 2857 volume = {89}, 2858 number = {53}, 2859 note = {Fall Meeting Supplemental, Abstract T41A-1925}, 2860 year = {2007}, 2861 petsc_uses = {KSP} 2862} 2863 2864@InProceedings{ aagaardknepleywilliams07, 2865 author = {Charles A. Williams and Brad Aagaard and Matthew G. Knepley}, 2866 title = {{PyLith}: A Finite-Element Code for Modeling Quasi-Static and Dynamic Crustal 2867 Deformation}, 2868 booktitle = {Eos Transactions of the AGU}, 2869 organization = {American Geophysical Union}, 2870 volume = {88}, 2871 number = {52}, 2872 note = {Fall Meeting Supplemental, Abstract T21B-1798}, 2873 year = {2007}, 2874 petsc_uses = {KSP} 2875} 2876 2877@InProceedings{ aagaardknepleywilliams05, 2878 author = {Charles A. Williams and Brad Aagaard and Matthew G. Knepley}, 2879 title = {Development of software for studying earthquakes across multiple spatial and 2880 temporal scales by coupling quasi-static and dynamic simulations}, 2881 booktitle = {Eos Transactions of the AGU}, 2882 organization = {American Geophysical Union}, 2883 volume = {86}, 2884 number = {52}, 2885 note = {Fall Meeting Supplemental, Abstract S53A-1072}, 2886 year = {2005}, 2887 petsc_uses = {KSP} 2888} 2889 2890@InProceedings{ williamsgablehagermeadeaagaardknepley08, 2891 author = {Charles A. Williams and Carl Gable and Bradford H. Hager and Brendan Meade and 2892 Brad Aagaard and Matthew G. Knepley}, 2893 title = {Modeling of Multiple Earthquake Cycles in Southern California Using the {SCEC} 2894 Community Fault Model}, 2895 booktitle = {Proceedings of Geosciences '08}, 2896 address = {Wellington, NZ}, 2897 month = nov, 2898 year = {2008}, 2899 petsc_uses = {KSP} 2900} 2901 2902@TechReport{ zhang07, 2903 title = {Two New Approaches in Solving the Nonlinear Shallow Water Equations for 2904 Tsunamis}, 2905 author = {C. Zhang and M. G. Knepley and D. A. Yuen and Y. Shi}, 2906 type = {Preprint}, 2907 number = {ANL/MCS-P1459-0907}, 2908 institution = {ANL}, 2909 month = sep, 2910 year = {2007}, 2911 petsc_uses = {KSP} 2912} 2913 2914@Article{ katz08b, 2915 author = {Richard F. Katz}, 2916 title = {Magma dynamics with the enthalpy method: {B}enchmark solutions and magmatic 2917 focusing at mid-ocean ridges}, 2918 journal = {J. Petrology}, 2919 year = {2008}, 2920 volume = {49}, 2921 pages = {2099--2121}, 2922 doi = {10.1093/petrology/egn058}, 2923 petsc_uses = {KSP} 2924} 2925 2926@Article{ hgrhkjvv2008, 2927 title = {On preconditioning for a parallel solution of the Richards equation}, 2928 author = {Michael Herbst and Swen Gottschalk and Martin Reissel and Horst Hardelauf and Roy 2929 Kasteel and Matthieu Javaux and Jan Vanderborght and Harry Vereeckena}, 2930 journal = {Computers and Geosciences}, 2931 volume = {34}, 2932 pages = {1958--1963}, 2933 year = {2008}, 2934 petsc_uses = {KSP} 2935} 2936 2937@Article{ maymoresi2008, 2938 title = {Preconditioned iterative methods for {Stokes} flow problems arising in 2939 computational geodynamics}, 2940 journal = {Physics of the Earth and Planetary Interiors}, 2941 volume = {171}, 2942 number = {1-4}, 2943 pages = {33--47}, 2944 year = {2008}, 2945 note = {{R}ecent Advances in Computational Geodynamics: Theory, Numerics and 2946 Applications}, 2947 issn = {0031-9201}, 2948 doi = {10.1016/j.pepi.2008.07.036}, 2949 author = {Dave A. May and Louis Moresi}, 2950 keywords = {Stokes flow, Krylov, Preconditioner, Schur complement, BFBt}, 2951 petsc_uses = {KSP} 2952} 2953 2954@Article{ kausmuhlhausmay2010, 2955 title = {A stabilization algorithm for geodynamic numerical simulations with a free 2956 surface}, 2957 author = {Boris JP Kaus and Hans M{\"u}hlhaus and Dave A May}, 2958 journal = {Physics of the Earth and Planetary Interiors}, 2959 volume = {181}, 2960 number = {1}, 2961 pages = {12--20}, 2962 year = {2010}, 2963 petsc_uses = {KSP} 2964} 2965 2966@Article{ duretzmaygeryatackley2011, 2967 title = {Discretization errors and free surface stabilization in the finite difference and 2968 marker-in-cell method for applied geodynamics: A numerical study}, 2969 author = {Thibault Duretz and David Alexander May and Taras V Gerya and Paul J Tackley}, 2970 journal = {Geochemistry, Geophysics, Geosystems}, 2971 volume = {12}, 2972 number = {7}, 2973 year = {2011}, 2974 petsc_uses = {KSP} 2975} 2976 2977@Article{ furuichimaytackley2011, 2978 title = {Development of a {Stokes} flow solver robust to large viscosity jumps using a 2979 {Schur} complement approach with mixed precision arithmetic}, 2980 author = {Mikito Furuichi and Dave A May and Paul J Tackley}, 2981 journal = {Journal of Computational Physics}, 2982 volume = {230}, 2983 number = {24}, 2984 pages = {8835--8851}, 2985 year = {2011}, 2986 petsc_uses = {KSP} 2987} 2988 2989@Article{ kellermaykaus2013, 2990 title = {Numerical modelling of magma dynamics coupled to tectonic deformation of 2991 lithosphere and crust}, 2992 author = {Tobias Keller and Dave A May and Boris JP Kaus}, 2993 journal = {Geophysical Journal International}, 2994 volume = {195}, 2995 number = {3}, 2996 pages = {1406--1442}, 2997 year = {2013}, 2998 petsc_uses = {KSP} 2999} 3000 3001@Article{ schellartfreemanstegmanmoresimay2007, 3002 title = {Evolution and diversity of subduction zones controlled by slab width}, 3003 author = {WP Schellart and Justin Freeman and David R Stegman and Louis Moresi and David A 3004 May}, 3005 journal = {Nature}, 3006 volume = {446}, 3007 number = {7133}, 3008 pages = {308--311}, 3009 year = {2007}, 3010 petsc_uses = {KSP} 3011} 3012 3013@Article{ cramerischmelinggolabekduretzorendtbuitermaykausgeryatackley2012, 3014 title = {A comparison of numerical surface topography calculations in geodynamic 3015 modelling: an evaluation of the sticky air method}, 3016 author = {F Crameri and H Schmeling and GJ Golabek and T Duretz and R Orendt and SJH Buiter 3017 and David A May and Boris JP Kaus and Taras V Gerya and Paul J Tackley}, 3018 journal = {Geophysical Journal International}, 3019 volume = {189}, 3020 number = {1}, 3021 pages = {38--54}, 3022 year = {2012}, 3023 petsc_uses = {KSP} 3024} 3025 3026@Article{ stegmanfreemanschellartmoresimay2006, 3027 title = {Influence of trench width on subduction hinge retreat rates in 3-D models of slab 3028 rollback}, 3029 author = {David R Stegman and Justin Freeman and WP Schellart and Louis Moresi and David A 3030 May}, 3031 journal = {Geochemistry, Geophysics, Geosystems}, 3032 volume = {7}, 3033 number = {3}, 3034 year = {2006}, 3035 petsc_uses = {KSP} 3036} 3037 3038@InProceedings{ may2014ptatin, 3039 title = {{pTatin3D}: {H}igh-performance methods for long-term lithospheric dynamics}, 3040 author = {Dave A May and Jed Brown and Laetitia {Le Pourhiet}}, 3041 booktitle = {Proceedings of {SC14}: The {International Conference for High Performance 3042 Computing, Networking, Storage and Analysis}}, 3043 organization = {ACM}, 3044 pages = {274--284}, 3045 year = {2014}, 3046 doi = {10.1109/SC.2014.28}, 3047 petsc_uses = {KSP} 3048} 3049 3050@Article{ maybrownpourhiet2015, 3051 title = {A scalable, matrix-free multigrid preconditioner for finite element 3052 discretizations of heterogeneous {Stokes} flow}, 3053 author = {David A May and Jed Brown and Laetitia {Le Pourhiet}}, 3054 journal = {Computer Methods in Applied Mechanics and Engineering}, 3055 volume = {290}, 3056 pages = {496--523}, 3057 year = {2015}, 3058 doi = {10.1016/j.cma.2015.03.014}, 3059 petsc_uses = {KSP} 3060} 3061 3062@Article{ duretzmayyamato2016, 3063 title = {A free surface capturing discretization for the staggered grid finite difference 3064 scheme}, 3065 author = {Thibault Duretz and Dave A May and Philippe Yamato}, 3066 journal = {Geophysical Journal International}, 3067 volume = {204}, 3068 number = {3}, 3069 pages = {1518--1530}, 3070 year = {2016}, 3071 petsc_uses = {KSP} 3072} 3073 3074@Article{ rhebergenwellskatzwathen2014, 3075 author = {Sander Rhebergen and Garth N. Wells and Richard F. Katz and Andrew J. Wathen}, 3076 title = {Analysis of block-preconditioners for models of coupled magma/mantle dynamics}, 3077 journal = {SIAM J. Sci. Comput.}, 3078 volume = {36}, 3079 pages = {A1960--A1977}, 3080 year = {2014}, 3081 petsc_uses = {KSP} 3082} 3083 3084@Article{ katz08a, 3085 author = {R.F. Katz and M.G. Worster}, 3086 title = {Simulation of directional solidification, thermochemical convection, and chimney 3087 formation in a {H}ele-{S}haw cell}, 3088 journal = {J. Comp. Phys.}, 3089 volume = {227}, 3090 pages = {9823-9840}, 3091 year = {2008}, 3092 doi = {10.1016/j.jcp.2008.06.039}, 3093 petsc_uses = {KSP} 3094} 3095 3096@Article{ aabg2007, 3097 author = {A. Askan and V. Akcelik and J. Bielak and O. Ghattas}, 3098 title = {Full waveform inversion for seismic velocity and anelastic losses in 3099 heterogeneous structures}, 3100 journal = {Bulletin of Seismological Society of America}, 3101 year = {2007}, 3102 volume = {97}, 3103 pages = {1990--2008}, 3104 petsc_uses = {KSP} 3105} 3106 3107@Article{ katz2006, 3108 author = {Richard F. Katz and Marc Spiegelman and Benjamin Holtzman}, 3109 title = {The dynamics of melt and shear localization in partially molten aggregates}, 3110 journal = {Nature}, 3111 year = {2006}, 3112 volume = {442}, 3113 pages = {676--679}, 3114 month = aug, 3115 day = {10}, 3116 url = {http://www.nature.com/nature/journal/v442/n7103/abs/nature05039.html}, 3117 petsc_uses = {KSP} 3118} 3119 3120@InProceedings{ mqrs2003, 3121 author = {Roland Masson and Philippe Quandalle and Stephane Requena and Robert Scheichl}, 3122 year = {2003}, 3123 title = {Parallel Preconditioning for Sedimentary Basin Simulations}, 3124 booktitle = {Large-Scale Scientific Computing: 4th International Conference, LSSC 2003, 3125 Sozopol, Bulgaria, June 4-8, 2003}, 3126 petsc_uses = {KSP} 3127} 3128 3129@InProceedings{ lichtner1, 3130 author = {Chuan Lu and Peter C. Lichtner}, 3131 year = {2005}, 3132 title = {{PFLOTRAN}: Massively Parallel {3-D} Simulator for {CO2} Sequestration in 3133 Geologic Media}, 3134 booktitle = {Fourth Annual Conference on Carbon Capture and Sequestration DOE/NETL}, 3135 lab = {LANL}, 3136 petsc_uses = {KSP} 3137} 3138 3139@Article{ hammondlichtnermills2014, 3140 title = {Evaluating the Performance of Parallel Subsurface Simulators: An Illustrative 3141 Example with {PFLOTRAN}}, 3142 author = {Glenn E. Hammond and Peter C. Lichtner and Richard Tran Mills}, 3143 journal = {Water Resources Research}, 3144 volume = {50}, 3145 number = {1}, 3146 pages = {208--228}, 3147 doi = {10.1002/2012WR013483}, 3148 year = {2014}, 3149 petsc_uses = {KSP} 3150} 3151 3152@Article{ smw2003, 3153 author = {R. Scheichl and R. Masson and J. Wendebourg}, 3154 title = {Decoupling and Block Preconditioning for Sedimentary Basin Simulations}, 3155 journal = {Computational Geosciences}, 3156 year = {2003}, 3157 volume = {7}, 3158 pages = {295--318}, 3159 url = {http://www.maths.bath.ac.uk/MATHEMATICS/preprints.html}, 3160 petsc_uses = {KSP} 3161} 3162 3163@Article{ kees-miller-03, 3164 author = {C. E. Kees and C.T. Miller and E.W. Jenkins and C.T. Kelley}, 3165 title = {Versatile multilevel Schwarz preconditioners for multiphase flow}, 3166 journal = {Computational Geosciences}, 3167 year = {2003}, 3168 volume = {7}, 3169 pages = {91--114}, 3170 petsc_uses = {KSP} 3171} 3172 3173@Article{ bk2003, 3174 author = {JN Buur and T Kuehnel}, 3175 title = {Improving depth imaging by automated model updating}, 3176 journal = {The Leading Edge}, 3177 year = {2003}, 3178 volume = {22}, 3179 pages = {310-318}, 3180 petsc_uses = {KSP} 3181} 3182 3183@Article{ frederickbuffett2016, 3184 title = {Submarine groundwater discharge as a possible formation mechanism for 3185 permafrost-associated gas hydrate on the circum-Arctic continental shelf}, 3186 author = {Jennifer M. Frederick and Bruce A. Buffett}, 3187 journal = {Journal of Geophysical Research: Solid Earth}, 3188 volume = {121}, 3189 number = {3}, 3190 pages = {1383--1404}, 3191 issn = {2169-9356}, 3192 doi = {10.1002/2015JB012627}, 3193 year = {2016}, 3194 petsc_uses = {KSP} 3195} 3196 3197% LiteralHTML: <td width="100%" colspan="2"><hr size="4" color="#FF5B5B"> </td> 3198% LiteralHTML:<font color="#FF0000"> 3199% LiteralHTML:Simulation of the earth's mantle and crust is valuable to 3200% LiteralHTML:understanding earthquakes, volcanos, etc. PETSc has been used for a 3201% LiteralHTML:variety of these simulations.</p> 3202% LiteralHTML:</font> 3203% LiteralHTML: 3204@InProceedings{ appelbe1, 3205 author = {B. Appelbe and D. May and S. Quenette and S. Tang and F. Wang and L. Moresi}, 3206 year = {2003}, 3207 title = {Mantle convection modeling with viscoelastic/brittle lithosphere: Numerical and 3208 computational methodology}, 3209 page = {781}, 3210 booktitle = {Lecture Notes in Computer Science, volume 2659, part of the ICCS Conference 3211 Proceedings}, 3212 publisher = {Springer-Verlag}, 3213 url = {http://vpac.org/VDT/SNARK/Presentations/RD0201-paper-20030602-ICCS03_ACES03_LNCS-mantle_convection_modelling.pdf}, 3214 petsc_uses = {KSP} 3215} 3216 3217% LiteralHTML:<a name="katz"> 3218@InProceedings{ gd1, 3219 author = {Guillaume Dumont and Michel Kern}, 3220 title = {Parallelization of a 3D Seismic Migration Code with PETSc}, 3221 year = {1999}, 3222 booktitle = {Proceedings of the Ninth SIAM Conference on Parallel Processing for Scientific 3223 Computing}, 3224 petsc_uses = {KSP} 3225} 3226 3227% LiteralHTML: <center><img alt="" src="images/katz1.jpg"> <img alt="" src="images/katz3.jpg"> 3228% LiteralHTML: <img alt="" src="images/katz2.jpg"></center></p> 3229% LiteralHTML:<font color="#FF0000"> 3230% LiteralHTML: Figures from the work of Richard Katz 3231@PhDThesis{ katzthesis, 3232 author = {R.F. Katz}, 3233 title = {The deep roots of volcanoes: models of magma dynamics with applications to 3234 subduction zones}, 3235 school = {Columbia University}, 3236 year = {2005}, 3237 url = {http://www.ldeo.columbia.edu/\~{ }katz/thesis/Katz_Dissertation_Columbia05.pdf}, 3238 petsc_uses = {KSP} 3239} 3240 3241@InCollection{ knepleykatzsmith06, 3242 author = {Knepley, Matthew G. and Katz, Richard F. and Smith, Barry}, 3243 affiliation = {Argonne National Laboratory Mathematics and Computer Science Division Argonne IL 3244 USA}, 3245 title = {Developing a Geodynamics Simulator with {PETSc}}, 3246 booktitle = {Numerical Solution of Partial Differential Equations on Parallel Computers}, 3247 series = {Lecture Notes in Computational Science and Engineering}, 3248 editor = {Bruaset, Are Magnus and Tveito, Aslak}, 3249 publisher = {Springer Berlin Heidelberg}, 3250 isbn = {978-3-540-31619-0}, 3251 keyword = {Mathematics and Statistics}, 3252 pages = {413-438}, 3253 volume = {51}, 3254 doi = {10.1007/3-540-31619-1_12}, 3255 year = {2006}, 3256 petsc_uses = {KSP} 3257} 3258 3259@Article{ katz04, 3260 author = {Richard F. Katz and Marc Spiegelman and S.M. Carbotte}, 3261 title = {Ridge migration, asthenospheric flow and the origin of magmatic segmentation in 3262 the global mid-ocean ridge system}, 3263 journal = {Geophys.\ Res.\ Letts.}, 3264 year = {2004}, 3265 volume = {31}, 3266 pages = {L15605}, 3267 petsc_uses = {KSP} 3268} 3269 3270@Article{ katz07, 3271 author = {Richard F. Katz and Matthew G. Knepley and Barry Smith and Marc Spiegelman and 3272 Ethan Coon}, 3273 title = {Numerical simulation of geodynamic processes with the {Portable Extensible 3274 Toolkit for Scientific Computation}}, 3275 journal = {Phys. Earth Planet. In.}, 3276 volume = {163}, 3277 pages = {52--68}, 3278 year = {2007}, 3279 petsc_uses = {KSP} 3280} 3281 3282@Article{ williams2006development, 3283 title = {{Development of a package for modeling stress in the lithosphere}}, 3284 author = {Williams, CA}, 3285 journal = {Eos Trans. AGU}, 3286 volume = {87}, 3287 pages = {36}, 3288 year = {2006}, 3289 petsc_uses = {KSP} 3290} 3291 3292@Article{ goverswortel05, 3293 author = {R. Govers and M.J.R. Wortel}, 3294 title = {Lithosphere tearing at STEP faults: response to edges of subduction zones}, 3295 journal = {Earth and Planetary Science Letters}, 3296 volume = {236/1-2}, 3297 pages = {505-523}, 3298 year = {2005}, 3299 petsc_uses = {KSP} 3300} 3301 3302@InProceedings{ snark2, 3303 author = {B. Appelbe and D. May and S. Quenette and S. Tang and F. Wang and L. Moresi}, 3304 year = {2002}, 3305 title = {Towards Rapid Geoscience Model Development - The {Snark} Project}, 3306 booktitle = {Proceedings of 3rd ACES (APEC Cooperation for Earthquake Simulation) Workshop}, 3307 petsc_uses = {KSP} 3308} 3309 3310@Article{ snark1, 3311 author = {Bill Appelbe and David May and Louis Moresi and Steve Quenette and Siew-Chiang 3312 Tan and Feng Wang}, 3313 title = {Snark - A Reusable Framwork for Geoscience Computational Models}, 3314 journal = {Submitted to Pure and Applied Geosciences}, 3315 petsc_uses = {KSP} 3316} 3317 3318@InProceedings{ earthquake2003, 3319 author = {Volkan Akcelik and Jacobo Bielak and George Biros and Ioannis Epanomeritakis and 3320 Antonio Fernandez and Omar Ghattas and Eui Joong Kim and David O'Hallaron and 3321 Tiankai Tu}, 3322 year = {2003}, 3323 title = {High Resolution Forward and Inverse Earthquake Modeling on Terascale Computers}, 3324 booktitle = {Proceedings of SC2003}, 3325 note = {A winner of the Gordon Bell Prize for special achievement at SC2003}, 3326 petsc_uses = {KSP} 3327} 3328 3329@InProceedings{ stefano12, 3330 author = {Michele De Stefano}, 3331 title = {Simultaneous Joint Inversion of Refraction Tomography and Magnetic Data}, 3332 booktitle = {PIERS Proceedings}, 3333 month = aug, 3334 address = {Moscow, RUSSIA}, 3335 pages = {491--495}, 3336 year = {2012}, 3337 petsc_uses = {KSP} 3338} 3339 3340%http://www.piers.org/piersproceedings/download.php?file=cGllcnMyMDEyTW9zY293fDJBN18wNDkxLnBkZnwxMjAzMTUwNDE2MDY= 3341 3342% LiteralHTML: <td width="100%" colspan="2"><hr size="4" color="#FF5B5B"> </td> 3343% LiteralHTML: <center><img alt="" 3344% LiteralHTML: src="images/ocean.jpg"></center></p> 3345@Article{ khatiwala07, 3346 author = {Khatiwala, S.}, 3347 title = {A computational framework for simulation of biogeochemical tracers in the ocean}, 3348 journal = {Glob. Biogeochem. Cycles}, 3349 volume = {21}, 3350 doi = {10.1029/2007GB002923}, 3351 year = {2007}, 3352 url = { http://www.ldeo.columbia.edu/\~{ }spk/Papers/KhatiwalaMatrixBiogeochemGBC07.pdf} 3353} 3354 3355@Article{ dks2004, 3356 author = {Sergey Danilov, Gennady Kivman and Jens Schroeter}, 3357 journal = {Ocean Modelling}, 3358 year = {2004}, 3359 volume = {6(2)}, 3360 pages = {125-150}, 3361 title = {A finite-element Ocean Model: Principles and Evaluation}, 3362 url = {http://www.sciencedirect.com/science?_ob=IssueURL&_tockey=%23TOC%236214%232004%23999939997%231%23FLA%23Volume_6,_Issue_2,_Pages_101-190_(2004)&_auth=y&view=c&_acct=C000007278&_version=1&_urlVersion=0&_userid=97338&md5=c3a50a31c599d8d38c8ce1f29117f267}, 3363 petsc_uses = {KSP} 3364} 3365 3366@Article{ danilov1, 3367 author = {S. Danilov and G. Kivman and J. Schroter}, 3368 year = {2004}, 3369 title = {Evaluation of an eddy-permitting finite-element ocean model in the North 3370 Atlantic}, 3371 journal = {Ocean Modelling}, 3372 petsc_uses = {KSP} 3373} 3374 3375@Article{ nerger1, 3376 author = {L. Nerger and S. Danilov and G. Kivman and W. Hiller and J. Schroter}, 3377 year = {2004}, 3378 title = {Data Assimilation with the Ensemble Kalman Filter and the SEIK Filter applied to 3379 a Finite Element Model of the North Atlantic}, 3380 journal = {Journal of marine systems}, 3381 petsc_uses = {KSP} 3382} 3383 3384@Conference{ rakowsky2003self, 3385 title = {{A self-adaptive finite element model of the atmosphere}}, 3386 author = {Rakowsky, N. and Frickenhaus, S. and Hiller, W. and L{\\"a}uter, M. and Handorf, 3387 D. and Dethloff, K. and Zwieflhofer, W. and Kreitz, N.}, 3388 booktitle = {Realizing teracomputing: proceedings of the tenth ECMWF Workshop on the Use of 3389 High Performance Computing in Meteorology: Reading, UK, 4-8 November, 2002}, 3390 pages = {279}, 3391 isbn = {981238376X}, 3392 year = {2003}, 3393 organization = {World Scientific Pub Co}, 3394 petsc_uses = {KSP} 3395} 3396 3397@Article{ lauter3, 3398 author = {M. Lauter}, 3399 year = {2004}, 3400 title = {GrossrAumige Zirkulationsstrukturen in einem nichtlinearen adaptiven 3401 AtmosphArenmodell}, 3402 journal = {Berichte zur Polar- und Meeresforschung}, 3403 petsc_uses = {KSP} 3404} 3405 3406@Article{ lauter2, 3407 author = {M. Lauter and D. Handorf and K. Dethloff}, 3408 year = {2004}, 3409 title = {Unsteady analytical solutions of the spherical shallow water equations}, 3410 journal = {Journal of computational physics}, 3411 petsc_uses = {KSP} 3412} 3413 3414@PhDThesis{ lauter1, 3415 author = {M. Lauter}, 3416 year = {2004}, 3417 title = {GrossAumige Zirkulationsstrukturen in einem nichtlinearen adaptiven 3418 AtmosphArenmodell}, 3419 institution = {UniversitAt Potsdam, 134 P., UniversitAt Potsdam}, 3420 petsc_uses = {KSP} 3421} 3422 3423@Article{ frickenhaus1, 3424 author = {S. Frickenhaus and W. Hiller and M. Best}, 3425 year = {2005}, 3426 title = {FoSSI : The Family of Simplified Solver Interfaces for the rapid development of 3427 parallel numerical atmosphere and ocean models}, 3428 journal = {Ocean Modelling}, 3429 volume = {10}, 3430 pages = {185--191}, 3431 petsc_uses = {KSP} 3432} 3433 3434@Article{ 0266-5611-24-3-034015, 3435 author = {I Epanomeritakis and V Ak\c{c}elik and O Ghattas and J Bielak}, 3436 title = {A Newton-CG method for large-scale three-dimensional elastic full-waveform 3437 seismic inversion}, 3438 journal = {Inverse Problems}, 3439 volume = {24}, 3440 number = {3}, 3441 pages = {034015 (26pp)}, 3442 url = {http://stacks.iop.org/0266-5611/24/034015}, 3443 year = {2008}, 3444 abstract = {We present a nonlinear optimization method for large-scale 3D elastic 3445 full-waveform seismic inversion. The method combines outer Gauss-Newton nonlinear 3446 iterations with inner conjugate gradient linear iterations, globalized by an 3447 Armijo backtracking line search, solved on a sequence of finer grids and higher 3448 frequencies to remain in the vicinity of the global optimum, inexactly terminated 3449 to prevent oversolving, preconditioned by L-BFGS/Frankel, regularized by a total 3450 variation operator to capture sharp interfaces, finely discretized by finite 3451 elements in the Lam\'{e} parameter space to provide flexibility and avoid bias, 3452 implemented in matrix-free fashion with adjoint-based computation of reduced 3453 gradient and reduced Hessian-vector products, checkpointed to avoid full spacetime 3454 waveform storage, and partitioned spatially across processors to parallelize the 3455 solutions of the forward and adjoint wave equations and the evaluation of 3456 gradient-like information. Several numerical examples demonstrate the grid 3457 independence of linear and nonlinear iterations, the effectiveness of the 3458 preconditioner, the ability to solve inverse problems with up to 17 million 3459 inversion parameters on up to 2048 processors, the effectiveness of multiscale 3460 continuation in keeping iterates in the basin of attraction of the global minimum, 3461 and the ability to fit the observational data while reconstructing the model with 3462 reasonable resolution and capturing sharp interfaces.}, 3463 petsc_uses = {KSP} 3464} 3465 3466% LiteralHTML: 3467% LiteralHTML: <a name="environmental"><H3><center>Environmental -- Subsurface Flow</center></H3> 3468% LiteralHTML: 3469% LiteralHTML: <td width="100%" colspan="2"><hr size="4" color="#FF5B5B"> </td> 3470% LiteralHTML:<font color="#FF0000"> 3471% LiteralHTML:Modeling surface flow of water is valuable for both flood control and 3472% LiteralHTML:agricultural and environmental reasons. For example, regenerating the 3473% LiteralHTML:Florida Everglades requires extensive understanding of the surface water 3474% LiteralHTML:characteristics over thousands of square miles. PETSc has been used 3475% LiteralHTML:for a variety of these simulations.</p> 3476% LiteralHTML:</font> 3477% LiteralHTML: 3478@Article{ mills2009modeling, 3479 title = {Modeling subsurface reactive flows using leadership-class computing}, 3480 author = {Mills, R.T. and Hammond, G.E. and Lichtner, P.C. and Sripathi, V. and 3481 Mahinthakumar, G.K. and Smith, B.F.}, 3482 journal = {Journal of Physics: Conference Series}, 3483 volume = {180}, 3484 pages = {012062}, 3485 year = {2009}, 3486 publisher = {IOP Publishing}, 3487 petsc_uses = {KSP} 3488} 3489 3490@Conference{ mills2007simulating, 3491 title = {{Simulating subsurface flow and transport on ultrascale computers using 3492 PFLOTRAN}}, 3493 author = {Mills, R.T. and Lu, C. and Lichtner, P.C. and Hammond, G.E.}, 3494 booktitle = {Journal of Physics: Conference Series}, 3495 volume = {78}, 3496 pages = {012051}, 3497 year = {2007}, 3498 organization = {IOP Publishing}, 3499 petsc_uses = {KSP} 3500} 3501 3502@InProceedings{ mills2009, 3503 title = {Modeling subsurface reactive flows using leadership-class computing}, 3504 author = {Mills, R.T. and Hammond, G.E. and Lichtner, P.C. and Sripathi, V. and 3505 Mahinthakmuar, G. and Smith, B.}, 3506 booktitle = {Journal of Physics: Conference Series}, 3507 volume = {180}, 3508 pages = {102062}, 3509 year = {2009}, 3510 organization = {IOP Publishing}, 3511 petsc_uses = {KSP} 3512} 3513 3514@Article{ guo2013parallel, 3515 title = {A parallel, fully coupled, fully implicit solution to reactive transport in 3516 porous media using the preconditioned {J}acobian-{F}ree {N}ewton-{K}rylov Method 3517 }, 3518 journal = {Advances in Water Resources }, 3519 volume = {53}, 3520 number = {0}, 3521 pages = {101 - 108}, 3522 year = {2013}, 3523 note = {}, 3524 issn = {0309-1708}, 3525 doi = {10.1016/j.advwatres.2012.10.010}, 3526 author = {Luanjing Guo and Hai Huang and Derek R. Gaston and Cody J. Permann and David 3527 Andrs and George D. Redden and Chuan Lu and Don T. Fox and Yoshiko Fujita}, 3528 keywords = {Reactive transport, Jacobian-Free Newton-Krylov, Physics-based block 3529 preconditioner}, 3530 petsc_uses = {KSP} 3531} 3532 3533@Unpublished{ stomp, 3534 title = {STOMP (Subsurface Transport Over Multiple Phases) webpage}, 3535 url = {http://stomp.pnl.gov/}, 3536 petsc_uses = {KSP} 3537} 3538 3539@InProceedings{ htfc2003, 3540 author = {L. Hluchy and V.D. Tran and D.Froehlich and W.Castaings}, 3541 title = {Methods and Experiences For Parallelizing Flood Models}, 3542 year = {2003}, 3543 booktitle = {Recent Advances in Parallel Virtual Machine and Message Passing Interface: 10th 3544 European PVM/MPI User's Group Meeting}, 3545 note = {Springer Lecture Notes in Computer Science, Volume 2840}, 3546 url = {http://www.springerlink.com/app/home/contribution.asp?wasp=2e9afcba8f614cd9a6f94a5294d1cbb0&referrer=parent&backto=issue,93,95;journal,588,1972;linkingpublicationresults,1:105633,1}, 3547 petsc_uses = {KSP} 3548} 3549 3550@InProceedings{ hulchy-tran-astalos-fmsip, 3551 author = {L. Hluchy and V.D. Tran and J. Astalos and M. Dobrucky and G. T. Nguyen and 3552 D.Froehlich}, 3553 title = {Flood Modeling System and Its Parallelization}, 3554 year = {2002}, 3555 booktitle = {Proceedings of the International Conference on Parallel Computing in Electrical 3556 Engineering}, 3557 url = {http://portal.acm.org/citation.cfm?id=824476.825951}, 3558 petsc_uses = {KSP} 3559} 3560 3561@InProceedings{ gy1, 3562 author = {J. P. Gwo and G. T. Yeh}, 3563 title = {High-Performance Simulation of Surface-Subsurface Coupled Flow and Reactive 3564 Transport at Watershed Scale}, 3565 year = {2004}, 3566 booktitle = {The International Conference on Computational Methods}, 3567 url = {http://www.sfwmd.gov/org/era/uncertainty_wkshp/GwoYeh.pdf}, 3568 petsc_uses = {KSP} 3569} 3570 3571@Conference{ cheng2009efficient, 3572 title = {{An efficient parallel method for large-scale groundwater flow equation based on 3573 PETSc}}, 3574 author = {Cheng, T. and Ji, X. and Wang, Q.}, 3575 booktitle = {Information, Computing and Telecommunication, 2009. YC-ICT'09. IEEE Youth 3576 Conference on}, 3577 pages = {190--193}, 3578 organization = {IEEE}, 3579 petsc_uses = {KSP} 3580} 3581 3582@Unpublished{ sfrsm, 3583 title = {The South Florida Regional Simulation Model and Hydrologic Simulation Engine}, 3584 url = {http://www.sfwmd.gov/org/pld/hsm/cerp_pres/hse_num.pdf}, 3585 note = {Simulates overland, groundwater and canal flows for south Florida. Uses PETSc for 3586 its linear solves}, 3587 petsc_uses = {KSP} 3588} 3589 3590% LiteralHTML: <td width="100%" colspan="2"><hr size="4" color="#FF5B5B"> </td> 3591@InProceedings{ bart_omar:sc05, 3592 author = {Volkan Ak{\c c}elik and George Biros and Andrei Dr{\u{a}}g{\u{a}}nescu and Omar 3593 Ghattas and Judith~C. Hill and Gart~G. van Bloemen Waanders}, 3594 title = {Dynamic data driven inversion for terascale simulations: real-time 3595 indentification of airborne contaminants}, 3596 booktitle = {Proceedings of SC2005}, 3597 organization = {IEEE/ACM}, 3598 address = {Seattle, WA}, 3599 year = {2005}, 3600 month = nov, 3601 url = {http://www.cs.cmu.edu/\~{ }oghattas/papers/sc05-inverse.pdf}, 3602 lab = {SNL}, 3603 petsc_uses = {KSP} 3604} 3605 3606@InProceedings{ anton-krassimir-lscc, 3607 author = {Anton Antonov and Krassimir Georgiev and Emilia Komsalova and Zahari Zlatev}, 3608 title = {Comparison of Two Local Refinement Methods for Large Scale Air Pollution 3609 Simulations}, 3610 booktitle = {Large-Scale Scientific Computing: 4th International Conference, LSSC 2003}, 3611 volume = {2907}, 3612 year = {2003}, 3613 publisher = {Springer-Verlag}, 3614 url = {http://www.springerlink.com/app/home/contribution.asp?wasp=65dfaebc36f6453d9120b8f9f86fecc5&referrer=parent&backto=issue,32,55;journal,618,2072;linkingpublicationresults,1:105633,1}, 3615 petsc_uses = {KSP} 3616} 3617 3618@InProceedings{ aa2001, 3619 author = {Anton Antonov}, 3620 title = {Object-Oriented Framework for Large Scale Air Pollution Modeling}, 3621 year = {2001}, 3622 booktitle = {Large-Scale Scientific Computing : Third International Conference, LSSC 2001, 3623 Sozopol, Bulgaria}, 3624 note = {Springer Lecture Notes in Computer Science, Volume 2179}, 3625 url = {http://www.springerlink.com/app/home/contribution.asp?wasp=3699c48fdb764bc7a3aa0539c7bf9f1d&referrer=parent&backto=issue,25,52;journal,1243,1972;linkingpublicationresults,1:105633,1}, 3626 petsc_uses = {KSP} 3627} 3628 3629% LiteralHTML: <td width="100%" colspan="2"><hr size="4" color="#FF5B5B"> </td> 3630@Article{ grassley-simmons-kercher-00, 3631 author = {William E. Glassley and Ardyth M. Simmons and James R. Kercher}, 3632 year = {2000}, 3633 title = {Mineralogical heterogeneity in fractured, porous media and its representation in 3634 reactive transport models}, 3635 journal = {Applied Geochemistry}, 3636 volume = {17}, 3637 pages = {699--708}, 3638 lab = {LLNL} 3639} 3640 3641@Article{ glassey-nitao-03, 3642 author = {William E. Glassley and John J. Nitao and Charles W. Grant and James W. Johnson 3643 and Carl I. Steefel and James R. Kercher}, 3644 year = {2003}, 3645 title = {The impact of climate change on vadose zone pore waters and its implication for 3646 long-term monitoring}, 3647 journal = {Computers and Geosciences}, 3648 volume = {29}, 3649 pages = {399-411}, 3650 lab = {LLNL}, 3651 petsc_uses = {KSP} 3652} 3653 3654@Article{ steefel-depaolo-lichtner-05, 3655 author = {Carl I. Steefel and Donald J. DePaolo and Peter C. Lichtner}, 3656 year = {2005}, 3657 title = {Reactive transport modeling: An essential tool and a new research approach for 3658 the Earth sciences}, 3659 journal = {Earth and Planetary Science Letters}, 3660 lab = {LLNL,LANL}, 3661 petsc_uses = {KSP} 3662} 3663 3664% LiteralHTML:<a name="scalinglarge"> 3665% LiteralHTML: <td width="100%" colspan="2"><hr size="4" color="#FF5B5B"> </td> 3666% LiteralHTML: <center><img alt="" 3667% LiteralHTML: src="images/scalinglarge.jpg"></center></p> 3668% LiteralHTML:<font color="#FF0000"> 3669% LiteralHTML: Sample <strong>strong scaling</strong> for the LANL PFLOTRAN flow and geochemical transport suite. (Courtesy of Richard Mills, ORNL) 3670@InProceedings{ kongstognergastonpetersonpermannslaughtermartineau2018, 3671 title = {A General-Purpose Hierarchical Mesh Partitioning Method with Node Balancing 3672 Strategies for Large-Scale Numerical Simulations}, 3673 author = {Fande Kong and Roy H. Stogner and Derek R. Gaston and John W. Peterson and Cody 3674 J. Permann and Andrew E. Slaughter and Richard C. Martineau}, 3675 booktitle = {2018 IEEE/ACM 9th Workshop on Latest Advances in Scalable Algorithms for 3676 Large-Scale Systems (scalA)}, 3677 pages = {65-72}, 3678 doi = {10.1109/ScalA.2018.00012}, 3679 month = nov, 3680 year = {2018}, 3681 petsc_uses = {KSP} 3682} 3683 3684@Article{ km2004, 3685 author = {A. Keese and H. G. Matthies}, 3686 journal = {Computers and Structures}, 3687 year = {2005}, 3688 volume = {83}, 3689 pages = {1033--1047}, 3690 title = {Hierarchical parallelisation for the solution of stochastic finite element 3691 equations}, 3692 url = {http://www.sciencedirect.com/science?_ob=ArticleURL&_udi=B6V28-4FPDPWM-1&_user=1722207&_rdoc=1&_fmt=&_orig=search&_sort=d&_docanchor=&view=c&_acct=C000053990&_version=1&_urlVersion=0&_userid=1722207&md5=89d48cd6fd5e80989372246d8dda400f}, 3693 petsc_uses = {KSP} 3694} 3695 3696@Unpublished{ hvl2002, 3697 title = {Numerical Modeling of NAPL Source Zone Treatment}, 3698 author = {Hammond, G.E., A.J. Valocchi and P.C. Lichtner}, 3699 note = {Poster at American Geophysical Union Fall 2002 Meeting, San Francisco, CA.}, 3700 url = {http://cee.uiuc.edu/transport/hammond/agu_2002.pdf}, 3701 year = {2002}, 3702 lab = {LANL}, 3703 petsc_uses = {KSP} 3704} 3705 3706@PhDThesis{ hammond2003, 3707 author = {Glenn E. Hammond}, 3708 title = {Innovative Methods for Solving Multicomponent Biogeochemical Groundwater 3709 Transport on Supercomputers}, 3710 school = {University of Illinois at Urbana-Champaign}, 3711 year = {2003}, 3712 url = {http://cee.uiuc.edu/transport/hammond/dissertation.pdf}, 3713 petsc_uses = {KSP} 3714} 3715 3716@Unpublished{ uk, 3717 title = {Parallel Least-Squares Finite Element Method for Large Eddy Simulation of Large 3718 Scale Environmental Flows and Transport Processes}, 3719 url = {http://es.epa.gov/ncer/progress/grants/96/high/tsang99.html}, 3720 note = {EPA funded work to simulate turbulent dispersion of toxic chemicals around 3721 buildings and in Green Bay. Used PETSc for its linear solvers}, 3722 year = {1999}, 3723 petsc_uses = {KSP} 3724} 3725 3726@InProceedings{ hammond2002, 3727 author = {Glenn E. Hammond and Albert J. Valocchi and Peter C. Lichtner}, 3728 title = {Modeling Multicomponent Reactive Transport on Parallel Computers Using 3729 {J}acobian-Free {N}ewton {K}rylov with Operator-Split Preconditioners}, 3730 year = {2002}, 3731 url = {http://www.cee.uiuc.edu/transport/publications/hammond/CMWR_2002.pdf}, 3732 booktitle = {Proceedings of the XIV International Conference on Computational Methods in Water 3733 Resources, Delft, The Netherlands.}, 3734 lab = {LANL}, 3735 petsc_uses = {KSP} 3736} 3737 3738@TechReport{ steefel1, 3739 author = {C. I. Steefel}, 3740 title = {Software for modeling multicomponent, multidimensional reactive transport}, 3741 year = {2001}, 3742 institution = {Lawrence Livermore National Laboratory}, 3743 number = {UCRL-MA-143182}, 3744 lab = {LLNL}, 3745 petsc_uses = {KSP} 3746} 3747 3748@Article{ steefel2, 3749 author = {C. I. Steefel and A. C. Lasaga}, 3750 title = {A coupled model for transport of multiple chemical-species and kinetic 3751 precipitation dissolution reactions with application to reactive flow in 3752 single-phase hydrothermal systems}, 3753 journal = {Americal Journal of Science}, 3754 year = {1994}, 3755 pages = {529-592}, 3756 volume = {294}, 3757 number = {5}, 3758 petsc_uses = {KSP} 3759} 3760 3761@TechReport{ steefel3, 3762 author = {C. I. Steefel and S. B. Yabusaki}, 3763 title = {OS3D/GIMRT, Software for Multicomponent-Multidimensional reactive transport: 3764 User's manual and programmer's guide}, 3765 year = {1996}, 3766 institution = {Pacific Northwest National Laboratory}, 3767 number = {PNNL-11166}, 3768 lab = {PNNL}, 3769 petsc_uses = {KSP} 3770} 3771 3772@Article{ 2005hvl, 3773 author = {G. E. Hammond and A.J. Valocchi and P.C. Lichtner}, 3774 title = {Application of {J}acobian-free {N}ewton-{K}rylov with physics-based 3775 preconditioning to biogeochemical transport}, 3776 journal = {Advances in Water Resources}, 3777 year = {2005}, 3778 pages = {359--376}, 3779 volume = {28}, 3780 url = { 3781 http://www.sciencedirect.com/science?_ob=IssueURL&_tockey=%23TOC%235953%232005%23999719995%23576651%23FLA%23Volume_28,_Issue_4,_Pages_315-427_(April_2005)&_auth=y&view=c&_acct=C000059129&_version=1&_urlVersion=0&_userid=2914253&md5=0d485527443c6192356cc508e1621002}, 3782 lab = {LANL}, 3783 petsc_uses = {KSP} 3784} 3785 3786@Article{ wang-zabar-05, 3787 author = {J Wang and N Zabaras}, 3788 journal = {Int. J. Heat and Mass Transfer}, 3789 title = {A Markov random field model of contamination source identification in porous 3790 media flow}, 3791 year = {2005}, 3792 petsc_uses = {KSP} 3793} 3794 3795@InBook{ kp1, 3796 author = {Jong G. Kim and Hyoung W. Park}, 3797 chapter = {Advanced Simulation Technique for Modeling Multiphase Fluid Flow in Porous 3798 Media}, 3799 url = {http://www.springerlink.com/app/home/contribution.asp?wasp=m5uc84pqrh1qrg8clyuh&referrer=parent&backto=issue,1,117;journal,206,1787;linkingpublicationresults,1:105633,1}, 3800 title = {Lecture Notes in Computer Science}, 3801 publisher = {Springer-Verlag}, 3802 volume = {3044}, 3803 year = {2004}, 3804 petsc_uses = {KSP} 3805} 3806 3807@Article{ 2001agusm...h32a06k, 3808 author = {{Kim}, J.~G. and {Kim}, J.}, 3809 title = {Parallel Implementation of Finite Element Groundwater Flow Model}, 3810 journal = {AGU Spring Meeting Abstracts}, 3811 year = {2001}, 3812 pages = {32-+}, 3813 petsc_uses = {KSP} 3814} 3815 3816@Article{ lzb2005, 3817 author = {A. M. Wasantha Lal and Randy Van Zee and Mark Belnap}, 3818 title = {CASE STUDY: A MODEL TO SIMULATE REGIONAL FLOW IN SOUTH FLORIDA}, 3819 journal = {Journal of Hydraulic Engineering}, 3820 year = {2005}, 3821 volume = {131}, 3822 number = {4}, 3823 pages = {247--258}, 3824 petsc_uses = {KSP} 3825} 3826 3827@Article{ rao2005, 3828 author = {Prasada Rao}, 3829 title = {A parallel RMA2 model for simulating large-scale free surface flows}, 3830 journal = {Environmental Modelling and Software}, 3831 year = {2005}, 3832 pages = {47--53}, 3833 petsc_uses = {KSP} 3834} 3835 3836@InProceedings{ pr1, 3837 author = {Prasada Rao}, 3838 title = {An Efficient Scalable Finite Element Model for Simulating Large Scale 3839 Hydrodynamic Flows}, 3840 year = {2003}, 3841 booktitle = {Proceedings of the American Society of Civil Engineers 16th Engineering Mechanics 3842 Conference}, 3843 url = {http://www.ce.washington.edu/em03/proceedings/papers/477.pdf}, 3844 petsc_uses = {KSP} 3845} 3846 3847@InProceedings{ lichtner2004, 3848 author = {Peter C. Lichtner and Andrew Wolfsberg}, 3849 title = {Modeling Thermal-Hydrological-Chemical ({THC}) Coupled Processes with 3850 Applications to Underground Nuclear Tests at the Nevada Test Site; A Grand 3851 Challenge Supercomputing Problem}, 3852 year = {2004}, 3853 booktitle = {MPU Workshop: Conceptual Model Development for Subsurface Reactive Transport 3854 Modeling of Inorganic Contaminants, Radionuclides and Nutrients}, 3855 note = {Also Los Alamos National Laboratory report: LA-UR-04-1826}, 3856 lab = {LANL}, 3857 petsc_uses = {KSP} 3858} 3859 3860% LiteralHTML: <td width="100%" colspan="2"><hr size="4" color="#FF5B5B"> </td> 3861@Article{ aba01:petsc-app, 3862 author = {Jason Abate and Peng Wang and Kamy Sepehrnoori}, 3863 title = {Parallel Compositional Reservior Simulation on Clusters of {PC}s}, 3864 journal = {Int. J. High Performance Computing Applications}, 3865 year = {2001}, 3866 volume = {15}, 3867 number = {1}, 3868 pages = {13--21}, 3869 petsc_uses = {KSP} 3870} 3871 3872@PhDThesis{ tjb200, 3873 author = {Thomas James Byer}, 3874 title = {Preconditioned Newton Methods for Simulation of Reservoirs with Surface 3875 Facilities}, 3876 school = {Stanford}, 3877 year = {2000}, 3878 petsc_uses = {KSP} 3879} 3880 3881@InProceedings{ puchyr2006, 3882 author = {Peter J. Puchyr}, 3883 title = {Experience with Parallel Computing for Reservoir and Geomechanics Simulation on a 3884 Win32 Cluster}, 3885 booktitle = {Proceedings of the Canadian International Petroleum Conference}, 3886 note = {Paper number CIPC2006-207}, 3887 year = {2006}, 3888 petsc_uses = {KSP} 3889} 3890 3891@InProceedings{ texas98, 3892 author = {P. Wang and S. Balay and K. Seperhrnoori and J. Wheeler and J. Abate and B. Smith 3893 and G. A. Pope}, 3894 title = {A Fully Implicit Parallel {EOS} Compositional Simulator for Large Scale Reservoir 3895 Simulation}, 3896 booktitle = {Proceedings of the 1999 Society of Petroleum Engineers 15th Reservoir Simulation 3897 Symposium}, 3898 note = {also available as Argonne preprint ANL/MCS-P743-1298}, 3899 url = {ftp://info.mcs.anl.gov/pub/tech_reports/reports/P743.pdf}, 3900 year = {1998}, 3901 petsc_uses = {KSP} 3902} 3903 3904% LiteralHTML: 3905% LiteralHTML: <a name="cfd"><H3><center>CFD</center></H3> 3906% LiteralHTML: 3907@Article{ farrellmitchellscottwechsung2021, 3908 title = {A {Reynolds-robust} preconditioner for the {Scott-Vogelius} discretization of the 3909 stationary incompressible {Navier-Stokes} equations}, 3910 author = {Patrick E Farrell and Lawrence Mitchell and L Ridgway Scott and Florian 3911 Wechsung}, 3912 journal = {The SMAI journal of computational mathematics}, 3913 volume = {7}, 3914 pages = {75--96}, 3915 year = {2021}, 3916 petsc_uses = {KSP} 3917} 3918 3919@Article{ adlerbensoncyrfarrellmaclachlantuminaro2021, 3920 title = {Monolithic Multigrid Methods for Magnetohydrodynamics}, 3921 author = {James H Adler and Thomas R Benson and Eric C Cyr and Patrick E Farrell and Scott 3922 P MacLachlan and Ray S Tuminaro}, 3923 journal = {SIAM Journal on Scientific Computing}, 3924 number = {0}, 3925 pages = {S70--S91}, 3926 year = {2021}, 3927 petsc_uses = {KSP} 3928} 3929 3930@Article{ farrellgaticalamichhaneoyarzuaruizbaier2021, 3931 title = {Mixed Kirchhoff stress–displacement–pressure formulations for incompressible 3932 hyperelasticity}, 3933 author = {Patrick E. Farrell and Luis F. Gatica and Bishnu P. Lamichhane and Ricardo 3934 Oyar\'ua and Ricardo Ruiz-Baier}, 3935 journal = {Computer Methods in Applied Mechanics and Engineering}, 3936 volume = {374}, 3937 pages = {113562}, 3938 issn = {0045-7825}, 3939 doi = {https://doi.org/10.1016/j.cma.2020.113562}, 3940 url = {https://www.sciencedirect.com/science/article/pii/S0045782520307477}, 3941 year = {2021}, 3942 petsc_uses = {KSP} 3943} 3944 3945@Article{ farrellmitchellwechsung2018, 3946 title = {An augmented {Lagrangian} preconditioner for the {3D} stationary incompressible 3947 {Navier-Stokes} equations at high {Reynolds} number}, 3948 author = {Patrick E Farrell and Lawrence Mitchell and Florian Wechsung}, 3949 journal = {SIAM Journal on Scientific Computing}, 3950 volume = {41}, 3951 number = {5}, 3952 eprint = {1810.03315}, 3953 pages = {A3073-A3096}, 3954 year = {2019}, 3955 petsc_uses = {KSP} 3956} 3957 3958@Article{ hevuikklaij2017, 3959 title = {Block-preconditioners for the incompressible {Navier}--{Stokes} equations 3960 discretized by a finite volume method}, 3961 author = {Xin He and Cornelis Vuik and Christiaan Klaij}, 3962 journal = {Journal of Numerical Mathematics}, 3963 volume = {25}, 3964 number = {2}, 3965 pages = {89--105}, 3966 year = {2017}, 3967 petsc_uses = {KSP} 3968} 3969 3970@InProceedings{ zou2015newton, 3971 title = {Newton--Krylov methods in applications of two-phase flow problems with phase 3972 appearance/disappearance}, 3973 author = {Zou, L and Zhao, H and Zhang, H}, 3974 booktitle = {ANS 2015 Annual Meeting, June}, 3975 volume = {7}, 3976 number = {11}, 3977 year = {2015}, 3978 petsc_uses = {KSP} 3979} 3980 3981@Article{ guermond2009nonlinear, 3982 title = {Nonlinear magnetohydrodynamics in axisymmetric heterogeneous domains using a 3983 Fourier/finite element technique and an interior penalty method}, 3984 author = {Guermond, J-L and Laguerre, Raphael and L{\'e}orat, Jacques and Nore, Caroline}, 3985 journal = {Journal of computational physics}, 3986 volume = {228}, 3987 number = {8}, 3988 pages = {2739--2757}, 3989 year = {2009}, 3990 publisher = {Elsevier}, 3991 petsc_uses = {KSP} 3992} 3993 3994@Article{ erzincanlisahin2015, 3995 title = {The numerical simulation of the wing kinematics effects on near wake topology and 3996 aerodynamic performance in hovering Drosophila flight}, 3997 author = {Belkis Erzincanli and Mehmet Sahin}, 3998 journal = {Computers \& Fluids}, 3999 volume = {122}, 4000 pages = {90--110}, 4001 year = {2015}, 4002 publisher = {Elsevier}, 4003 petsc_uses = {KSP} 4004} 4005 4006@Article{ ekensahin2015, 4007 title = {A parallel monolithic algorithm for the numerical simulation of large-scale fluid 4008 structure interaction problems}, 4009 author = {Ali Eken and Mehmet Sahin}, 4010 journal = {International Journal for Numerical Methods in Fluids}, 4011 year = {2015}, 4012 publisher = {Wiley Online Library}, 4013 petsc_uses = {KSP} 4014} 4015 4016@Article{ hwangsucai2015, 4017 title = {A parallel adaptive nonlinear elimination preconditioned inexact {Newton} method 4018 for transonic full potential equation}, 4019 author = {Feng-Nan Hwang and Yi-Cheng Su and Xiao-Chuan Cai}, 4020 journal = {Computers \& Fluids}, 4021 volume = {110}, 4022 number = {30}, 4023 pages = {96--107}, 4024 year = {2015}, 4025 doi = {10.1016/j.compfluid.2014.04.005}, 4026 petsc_uses = {KSP} 4027} 4028 4029@Article{ yanghwangcai2016, 4030 title = {Nonlinear Preconditioning Techniques for Full-Space Lagrange--Newton Solution of 4031 PDE-Constrained Optimization Problems}, 4032 author = {Haijian Yang and Feng-Nan Hwang and Xiao-Chuan Cai}, 4033 journal = {SIAM Journal on Scientific Computing}, 4034 volume = {38}, 4035 number = {5}, 4036 pages = {A2756--A2778}, 4037 year = {2016}, 4038 petsc_uses = {KSP} 4039} 4040 4041@Article{ khanaidun2011, 4042 author = {Irfan Khan and Cyrus K. Aidun}, 4043 title = {Direct numerical simulation of saturated deformable porous media using parallel 4044 hybrid Lattice-Boltzmann and finite element method}, 4045 journal = {Int. J. Numer. Meth. Eng.}, 4046 volume = {86}, 4047 pages = {1379--1395}, 4048 year = {2011}, 4049 petsc_uses = {KSP} 4050} 4051 4052@Article{ khanaidun2014, 4053 author = {Irfan Khan and Cyrus K. Aidun}, 4054 title = {Modeling the deformation of saturate porous media using direct numerical 4055 simulation}, 4056 journal = {Int. J. Multiphase Flow}, 4057 doi = {10.1016/j.ijmultiphaseflow.2014.12.003}, 4058 year = {2014}, 4059 petsc_uses = {KSP} 4060} 4061 4062@Article{ mofidi2014simulations, 4063 author = {A. Mofidi and P. M. Carrica}, 4064 title = {Simulations of Zigzag Maneuvers for a Container Ship with Direct Moving Rudder 4065 and Propeller}, 4066 journal = {Computers and Fluids}, 4067 pages = {191--203}, 4068 year = {2014}, 4069 petsc_uses = {KSP} 4070} 4071 4072@Article{ paik2014fluidstructure, 4073 author = {K. Paik and P. M. Carrica}, 4074 title = {Fluid-Structure Interaction for an Elastic Structure Interacting with Free 4075 Surface in a Rolling Tank}, 4076 journal = {Ocean Engineering}, 4077 pages = {201--212}, 4078 year = {2014}, 4079 petsc_uses = {KSP} 4080} 4081 4082@Article{ castro2013bubble, 4083 author = {A. M. Castro and P. M. Carrica}, 4084 title = {Bubble size distribution prediction for large-scale ship flows: {Model} 4085 evaluation and numerical issues}, 4086 journal = {International Journal of Multiphase Flow 57}, 4087 pages = {131--150}, 4088 year = {2013}, 4089 petsc_uses = {KSP} 4090} 4091 4092@Article{ carrica2013turn, 4093 author = {P. M. Carrica and F. Ismail and M. Hyman and S. Bhushan and F. Stern}, 4094 title = {Turn and Zigzag Maneuvers of a Surface Combatant Using a {URANS} Approach with 4095 Dynamic Overset Grids}, 4096 journal = {Journal of Marine Science and Technology}, 4097 pages = {166--181}, 4098 year = {2013}, 4099 petsc_uses = {KSP} 4100} 4101 4102@Article{ castro2013eulerian, 4103 author = {A. M. Castro and P. M. Carrica}, 4104 title = {Eulerian polydispersed modeling of bubbly flows around ships with application to 4105 {Athena} {R}/V,}, 4106 journal = {International Shipbuilding Progress}, 4107 pages = {403--433}, 4108 year = {2013}, 4109 petsc_uses = {KSP} 4110} 4111 4112@Article{ chase2013overset, 4113 author = {N. Chase and T. Michael and P. M. Carrica}, 4114 title = {Overset simulations of a {Submarine} in {Towed}, {Self}-{Propelled} and 4115 {Maneuvering} {Conditions}}, 4116 journal = {International Shipbuilding Progress}, 4117 pages = {171--205}, 4118 year = {2013}, 4119 petsc_uses = {KSP} 4120} 4121 4122@Article{ sadathosseini2013wu, 4123 author = {H. Sadat-Hosseini and P. -C. Wu and P. M. Carrica and H. Kim and Y. Toda and F. 4124 Stern}, 4125 title = {{CFD} Simulation and Validation of Added Resistance of {KVLCC}2 with Fixed and 4126 Free Surge Conditions in Short and Long Head Waves}, 4127 journal = {Ocean Engineering}, 4128 volume = {59}, 4129 pages = {240--273}, 4130 year = {2013}, 4131 petsc_uses = {KSP} 4132} 4133 4134@Article{ chase2013cfd, 4135 author = {N. Chase and P. M. Carrica}, 4136 title = {CFD Simulations of a Submarine Propeller and Application to Self-Propulsion of a 4137 Submarine}, 4138 journal = {Ocean Engineering}, 4139 pages = {68--80}, 4140 year = {2013}, 4141 petsc_uses = {KSP} 4142} 4143 4144@Article{ carrica2012cfd, 4145 author = {P. M. Carrica and H. Sadat-Hosseini and F. Stern}, 4146 title = {CFD Analysis of Broaching for a Model Surface Combatant with Explicit Simulation 4147 of Moving Rudders and Rotating Propellers}, 4148 journal = {Computers and Fluids 53}, 4149 pages = {117--132}, 4150 year = {2012}, 4151 petsc_uses = {KSP} 4152} 4153 4154@Article{ sakamoto2012urans, 4155 author = {N. Sakamoto and P. M. Carrica and F. Stern}, 4156 title = {URANS Simulations of Static and Dynamic Maneuvering for Surface Combatant-Part 1: 4157 Verification and Validation for Forces, Moment, and Hydrodynamic Derivatives}, 4158 publisher = {Journal of Marine Science and Technology}, 4159 pages = {422--445}, 4160 year = {2012}, 4161 petsc_uses = {KSP} 4162} 4163 4164@Article{ sakamoto2012uransb, 4165 author = {N. Sakamoto and P. M. Carrica and F. Stern}, 4166 title = {URANS Simulations of Static and Dynamic Maneuvering for Surface Combatant-Part 2: 4167 Analysis and Validation of Local Flow Characteristics}, 4168 journal = {Journal of Marine Science and Technology}, 4169 pages = {446--468}, 4170 year = {2012}, 4171 petsc_uses = {KSP} 4172} 4173 4174@Article{ li2012dynamic, 4175 author = {Y. Li and T. Xing and K. Paik and P. M. Carrica}, 4176 title = {Dynamic Overset {CFD} Simulations of Wind Turbine Aerodynamics}, 4177 journal = {Renewable Energy}, 4178 pages = {285--298}, 4179 year = {2012}, 4180 petsc_uses = {KSP} 4181} 4182 4183@Article{ huang2012a, 4184 author = {J. Huang and P. M. Carrica and F. Stern}, 4185 title = {A Method to Compute Ship Exhaust Plumes with Waves and Wind}, 4186 journal = {International Journal for Numerical Methods in Fluids}, 4187 pages = {160--180}, 4188 year = {2012}, 4189 petsc_uses = {KSP} 4190} 4191 4192@Article{ huang2012b, 4193 author = {J. Huang and P. M. Carrica and F. Stern}, 4194 title = {A geometry-based level set method for curvilinear overset grids with application 4195 to ship hydrodynamics}, 4196 journal = {International Journal for Numerical Methods in Fluids}, 4197 pages = {494--521}, 4198 year = {2012}, 4199 petsc_uses = {KSP} 4200} 4201 4202@Article{ carrica2011computations, 4203 author = {P. M. Carrica and H. Fu and F. Stern}, 4204 title = {Computations of self-propulsion free to sink and trim and of motions in head 4205 waves of the {KRISO} {Container} {Ship} ({KCS}) model}, 4206 journal = {Applied Ocean Research}, 4207 pages = {309--320}, 4208 year = {2011}, 4209 petsc_uses = {KSP} 4210} 4211 4212@Article{ bhushan2011scalability, 4213 author = {S. Bhushan and P. M. Carrica and J. Yang and F. Stern}, 4214 title = {Scalability and Validation Study for Large Scale Surface Combatant Computations 4215 Using {CFDShip}-Iowa}, 4216 journal = {International Journal of High Performance Computing Applications}, 4217 pages = {466--487}, 4218 year = {2011}, 4219 petsc_uses = {KSP} 4220} 4221 4222@Article{ castro2011full, 4223 author = {A. M. Castro and P. M. Carrica and F. Stern}, 4224 title = {Full scale self-propulsion computations using discretized propeller for the 4225 {KRISO} container ship {KCS}}, 4226 journal = {Computers and Fluids}, 4227 pages = {35--47}, 4228 year = {2011}, 4229 petsc_uses = {KSP} 4230} 4231 4232@Article{ kandasamy2011multifidelity, 4233 author = {M. Kandasamy and S. K. Ooi and P. M. Carrica and F. Stern and E. F. Campana and 4234 D. Peri and P. Osborne and J. Cote and N. Macdonald and N. de Waal}, 4235 title = {Multi-fidelity Optimization of a High-speed Foil-assisted Semi-planing Catamaran 4236 for Low Wake}, 4237 journal = {Journal of Marine Science and Technology}, 4238 pages = {143--156}, 4239 year = {2011}, 4240 petsc_uses = {KSP} 4241} 4242 4243@Article{ kandasamy2011cfd, 4244 author = {M. Kandasamy and S. K. Ooi and P. M. Carrica and F. Stern and E. F. Campana and 4245 D. Peri and P. Osborne and J. Cote and N. Macdonald and N. de Waal}, 4246 title = {CFD Validation Studies for a High-speed Foil-assisted Semi-planing Catamaran}, 4247 journal = {Journal of Marine Science and Technology}, 4248 pages = {157--167}, 4249 year = {2011}, 4250 petsc_uses = {KSP} 4251} 4252 4253@Article{ sadathosseini2011cfd, 4254 author = {H. Sadat-Hosseini and P. M. Carrica and F. Stern and N. Umeda and H. Hashimoto 4255 and S. Yamamura and A. Mastuda}, 4256 title = {CFD System-Based and {EFD} Study of Ship Dynamic Instability Events: Surf Riding, 4257 Periodic Motion and Broaching}, 4258 journal = {Ocean Engineering}, 4259 pages = {88--110}, 4260 year = {2011}, 4261 petsc_uses = {KSP} 4262} 4263 4264@Article{ mosaviraad2010development, 4265 author = {M. Mosaviraad and P. M. Carrica and F. Stern}, 4266 title = {Development and Validation of Harmonic Wave Group Single-Run Procedure for {RAO} 4267 with Comparison to Regular Wave and Transient Wave Group Procedures Using 4268 {URANS}}, 4269 journal = {Ocean Engineering}, 4270 pages = {653--666}, 4271 year = {2010}, 4272 petsc_uses = {KSP} 4273} 4274 4275@Article{ carrica2010largescale, 4276 author = {P. M. Carrica and J. Huang and R. Noack and D. Kaushik and B. Smith and F. 4277 Stern}, 4278 title = {Large-Scale {DES} Computations of the Forward Speed Diffraction and Pitch and 4279 Heave Problems for a Surface Combatant}, 4280 journal = {Computers and Fluids}, 4281 pages = {1095--1111}, 4282 year = {2010}, 4283 petsc_uses = {KSP} 4284} 4285 4286@Article{ carrica2010selfpropulsion, 4287 author = {P. M. Carrica and A. M. Castro and F. Stern}, 4288 title = {Self-Propulsion Computations Using Speed Controller and Discretized Propeller 4289 with Dynamic Overset Grids}, 4290 journal = {Journal of Marine Science and Technology}, 4291 pages = {316--330}, 4292 year = {2010}, 4293 petsc_uses = {KSP} 4294} 4295 4296@Article{ ismail2010evaluation, 4297 author = {F. Ismail and P. M. Carrica and T. Xing and F. Stern}, 4298 title = {Evaluation of Linear and Non-Linear Convection Schemes on Multidimensional 4299 Non-Orthogonal Grids with Applications to {KVLCC}2 Tanker}, 4300 journal = {International Journal of Numerical Methods in Fluids}, 4301 pages = {850--886}, 4302 year = {2010}, 4303 petsc_uses = {KSP} 4304} 4305 4306@Article{ kandasamy2010integral, 4307 author = {M. Kandasamy and S. K. Ooi and P. M. Carrica and F. Stern}, 4308 title = {Integral Force/Moment Waterjet Model for {CFD} Simulations}, 4309 journal = {Journal of Fluids Engineering}, 4310 pages = {101103}, 4311 year = {2010}, 4312 petsc_uses = {KSP} 4313} 4314 4315@Article{ kirk:2014de, 4316 author = {Kirk, Benjamin S and Stogner, Roy H and Bauman, Paul T and Oliver, Todd A}, 4317 title = {{Modeling hypersonic entry with the fully-implicit Navier--Stokes (FIN-S) 4318 stabilized finite element flow solver}}, 4319 journal = {Computers {\&} Fluids}, 4320 year = {2014}, 4321 volume = {92}, 4322 number = {0}, 4323 pages = {281--292}, 4324 month = mar, 4325 petsc_uses = {KSP} 4326} 4327 4328@Article{ carracciuolo20111382, 4329 title = {Computational simulations of {3D} large-scale time-dependent viscoelastic flows 4330 in high performance computing environment}, 4331 journal = {Journal of Non-Newtonian Fluid Mechanics }, 4332 volume = {166}, 4333 number = {23--24}, 4334 pages = {1382--1395}, 4335 year = {2011}, 4336 issn = {0377-0257}, 4337 doi = {10.1016/j.jnnfm.2011.08.014}, 4338 author = {L. Carracciuolo and D. Casaburi and L. D’Amore and G. D’Avino and P.L. 4339 Maffettone and A. Murli}, 4340 keywords = {Parallel computations, Viscoelastic flows, DEVSS-G, \{PETSc\}, Finite element 4341 method, High performance computing}, 4342 petsc_uses = {KSP} 4343} 4344 4345@Article{ bungartzgatzhammerliebmehlneckel11, 4346 author = {Bungartz, Hans-Joachim and Gatzhammer, Bernhard and Lieb, Michael and Mehl, 4347 Miriam and Neckel, Tobias}, 4348 title = {Towards multi-phase flow simulations in the PDE framework Peano}, 4349 journal = {Computational Mechanics}, 4350 volume = {48}, 4351 number = {3}, 4352 pages = {365-376}, 4353 year = {2011}, 4354 issn = {0178-7675}, 4355 doi = {10.1007/s00466-011-0626-1}, 4356 publisher = {Springer-Verlag}, 4357 keywords = {PDE framework; Octree-like Cartesian grids; Computational fluid dynamics; 4358 Thermohydraulics; Two-phase flow}, 4359 language = {English}, 4360 petsc_uses = {KSP} 4361} 4362 4363@Article{ bpr:cfl, 4364 author = {H.~M. B{\"u}cker and B. Pollul and A. Rasch}, 4365 title = {{On {CFL} Evolution Strategies for Implicit Upwind Methods in Linearized {E}uler 4366 Equations}}, 4367 journal = {International Journal for Numerical Methods in Fluids}, 4368 year = {2009}, 4369 volume = {59}, 4370 number = {1}, 4371 pages = {1--18}, 4372 doi = {10.1002/fld.1798}, 4373 petsc_uses = {KSP} 4374} 4375 4376@InBook{ bonfiglioli_campobasso_carpentieri_2010, 4377 author = {Bonfiglioli, A and Campobasso, M S and Carpentieri, B}, 4378 title = {Parallel unstructured three-dimensional turbulent flow analyses using efficiently 4379 preconditioned newton-krylov solver}, 4380 publisher = {Curran Associates}, 4381 year = {2010}, 4382 url = {http://www.proceedings.com/05932.html}, 4383 petsc_uses = {KSP} 4384} 4385 4386@Article{ bonfiglioli_rans_2005, 4387 author = {Paciorri, Renato and Bonfiglioli, Aldo and Di Mascio, Andrea and Favini, 4388 Bernardo}, 4389 title = {RANS simulations of a junction flow}, 4390 journal = {International Journal of Computational Fluid Dynamics}, 4391 volume = {19}, 4392 number = {2}, 4393 pages = {179-189}, 4394 year = {2005}, 4395 doi = {10.1080/10618560410001729126}, 4396 petsc_uses = {KSP} 4397} 4398 4399@InCollection{ bonfiglioli__carpentieri_rans_2008, 4400 author = {Bonfiglioli, A. and Carpentieri, B. and Sosonkina, M.}, 4401 affiliation = {University of Basilicata Dip.to di Ingegneria e Fisica dell’Ambiente Potenza 4402 Italy}, 4403 title = {Performance Analysis of Parallel Algebraic Preconditioners for Solving the RANS 4404 Equations Using Fluctuation Splitting Schemes}, 4405 booktitle = {Numerical Mathematics and Advanced Applications}, 4406 editor = {Kunisch, Karl and Of, Günther and Steinbach, Olaf}, 4407 publisher = {Springer Berlin Heidelberg}, 4408 isbn = {978-3-540-69777-0}, 4409 pages = {151-158}, 4410 doi = {10.1007/978-3-540-69777-0_17}, 4411 year = {2008}, 4412 petsc_uses = {KSP} 4413} 4414 4415@InCollection{ bonfiglioli__carpentieri_ens_2007, 4416 author = {Bonfiglioli, Aldo and Carpentieri, Bruno and Sosonkina, Masha}, 4417 affiliation = {Dip.to di Ingegneria e Fisica dell’Ambiente, University of Basilicata, Potenza, 4418 Italy}, 4419 title = {EulFS: A Parallel {CFD} Code for the Simulation of {Euler and Navier-Stokes} 4420 Problems on Unstructured Grids}, 4421 booktitle = {Applied Parallel Computing. State of the Art in Scientific Computing}, 4422 series = {Lecture Notes in Computer Science}, 4423 editor = {Kågström, Bo and Elmroth, Erik and Dongarra, Jack and Wasniewski, Jerzy}, 4424 publisher = {Springer Berlin / Heidelberg}, 4425 isbn = {978-3-540-75754-2}, 4426 pages = {676-685}, 4427 volume = {4699}, 4428 doi = {10.1007/978-3-540-75755-9_83}, 4429 year = {2007}, 4430 petsc_uses = {KSP} 4431} 4432 4433@Article{ terrelscottknepleykirby08, 4434 author = {Andy R. Terrel and L. Ridgway Scott and Matthew G. Knepley and Robert C. Kirby}, 4435 title = {Automated {FEM} Discretizations for the {Stokes} Equation}, 4436 journal = {BIT}, 4437 volume = {48}, 4438 number = {2}, 4439 year = {2008}, 4440 petsc_uses = {KSP} 4441} 4442 4443@Article{ martamadermartinsweidealonso07, 4444 author = {A. C. Marta and C. A. Mader and J. R. R. A. Martins and E. {Van der Weide} and J. 4445 J. Alonso}, 4446 title = {A methodology for the development of discrete adjoint solvers using automatic 4447 differentiation tools}, 4448 journal = {Computational Fluid Dyanmics}, 4449 volume = {21}, 4450 pages = {307--327}, 4451 year = {2007}, 4452 petsc_uses = {KSP} 4453} 4454 4455@TechReport{ avb2008, 4456 author = {V.R. Ambati and J.J.W. van der Vegt and O. Bokhove}, 4457 title = {Variational Space-time (Dis)continuous Galerkin Method for Linear Free Surface 4458 Waves}, 4459 year = {2008}, 4460 institution = {University of Twente, the Netherlands}, 4461 url = {http://eprints.eemcs.utwente.nl/11714/01/memo1863.pdf}, 4462 petsc_uses = {KSP} 4463} 4464 4465@InProceedings{ bdsm2005, 4466 author = {M. Bozkurttas and H. Dong and V. Seshadri and R. Mittal}, 4467 title = {Towards Numerical Simulation of Flapping Foils on Fixed Cartesian Grids}, 4468 booktitle = {43rd AIAA Aerospace Sciences Meeting and Exhibit}, 4469 year = {2005}, 4470 url = {http://project.seas.gwu.edu/~fsagmae/papers/AIAA_2005_0079.pdf}, 4471 petsc_uses = {KSP} 4472} 4473 4474@InProceedings{ ms2006, 4475 author = {S. Muller and Y. Stiriba}, 4476 title = {A MULTILEVEL FINITE VOLUME METHOD WITH MULTISCALE-BASED GRID ADAPTATION FOR 4477 STEADY COMPRESSIBLE FLOWS}, 4478 booktitle = {European Conference on Computational Fluid Dynamics: ECCOMAS CFD 2006}, 4479 year = {2006}, 4480 url = {http://www.numerical.rl.ac.uk/people/marioli/Archives/ECCOMAS-CFD-2006/documents/197.pdf}, 4481 petsc_uses = {KSP} 4482} 4483 4484@Article{ araujoteixeiracunhagroth08, 4485 author = {B. J. Ara\'ujo and J. C. F. Teixeira and A. M. Cunha and C. P. T. Groth}, 4486 title = {Parallel three-dimensional simulation of the injection molding process}, 4487 journal = {International Journal for Numerical Methods in Fluids}, 4488 year = {2008}, 4489 url = {http://www3.interscience.wiley.com/journal/119876958/abstract?CRETRY=1&SRETRY=0}, 4490 petsc_uses = {KSP} 4491} 4492 4493@PhDThesis{ a2008, 4494 author = {A. Cubero}, 4495 title = {a parallel coupled algorithm for collocated grids and its application to Large 4496 Eddy Simulation of a turbulent wake}, 4497 school = {University of Zaragoza (Spain)}, 4498 year = {2008}, 4499 petsc_uses = {KSP} 4500} 4501 4502@Article{ afa2007, 4503 author = {A. Cubero and N. Fueyo}, 4504 title = {A Compact Momentum Interpolation Method for unsteady flows and relaxation}, 4505 journal = {Numerical Heat Transfer, part B-Fundamentals}, 4506 volume = {56}, 4507 number = {6}, 4508 pages = {507--529}, 4509 year = {2007}, 4510 url = {http://www.informaworld.com/smpp/content~content=a782025305~db=all~order=page}, 4511 petsc_uses = {KSP} 4512} 4513 4514@TechReport{ af2007, 4515 title = {Preconditioning based on a partially implicit implementation of Momentum 4516 Interpolation for coupled solvers}, 4517 institution = {Fluid Mechanics Group of the University of Zaragoza (Spain)}, 4518 year = {2007}, 4519 author = {A. Cubero and N. Fueyo}, 4520 petsc_uses = {KSP} 4521} 4522 4523@InCollection{ dwight2004, 4524 author = {Richard Dwight}, 4525 title = {Robust Mesh Deformation using the Linear Elasticity Equations}, 4526 booktitle = {Computational Fluid Dynamics 2006}, 4527 editor = {H. Deconinck and E. Dick}, 4528 publisher = {Springer}, 4529 year = {2006}, 4530 url = {http://www.maths.man.ac.uk/\~{ 4531 }rdwight/pub/rdwight-ICCFD4-LinElastDeformation-2006.pdf}, 4532 petsc_uses = {KSP} 4533} 4534 4535@InProceedings{ dwight2006, 4536 author = {Richard Dwight and Joel Brezillon}, 4537 title = {Effect of Various Approximations of the Discrete Adjoint on Gradient-Based 4538 Optimization}, 4539 booktitle = {Proceedings of the 44th AIAA Aerospace Sciences Meeting and Exhibit, Reno NV. 4540 AIAA-2006-0690}, 4541 year = {2006}, 4542 url = {http://www.maths.man.ac.uk/\~{ }rdwight/pub/rdwight-AIAAReno-ApproxAdjoint.pdf}, 4543 petsc_uses = {KSP} 4544} 4545 4546@PhDThesis{ dwight2006a, 4547 author = {Richard Dwight}, 4548 title = {Efficiency Improvements of {RANS}-Based Analysis and Optimization using Implicit 4549 and Adjoint Methods on Unstructured Grids}, 4550 school = {School of Mathematics, University of Manchester}, 4551 year = {2006}, 4552 url = {http://www.maths.man.ac.uk/\~{ 4553 }rdwight/pub/rdwight-PhDThesis-ImplicitAndAdjoint.pdf}, 4554 petsc_uses = {KSP} 4555} 4556 4557@InProceedings{ lhdfrh, 4558 author = {M. Lauter and D. Handorf and K. Dethloff and S. Frickenhaus and N. Rakowsky and 4559 W. Hiller}, 4560 title = {An adaptive Lagrange-Galerkin shallow-water model on the sphere}, 4561 booktitle = {Workshop Proceedings Current Development in Shallow Water Models on the Sphere 4562 March, 10-14, 2003, Munich University of Technology, German}, 4563 year = {2003}, 4564 petsc_uses = {KSP} 4565} 4566 4567@InProceedings{ brios-ying-2002, 4568 author = {George Biros and Lexing Ying and Denis Zorin}, 4569 title = {The Embedded Boundary Integral Method (EBI) for the Incompressible 4570 {Navier-Stokes} equations}, 4571 booktitle = {IABEM 2002, International Association for Boundary Element Methods, UT Austin}, 4572 year = {2002}, 4573 petsc_uses = {KSP} 4574} 4575 4576@InProceedings{ mohsen-straatman-ins, 4577 author = {S.A. Mohsen Karimian and Anthony G. Straatman}, 4578 title = {Benchmarking of a {3D}, unstructured, finite volume code for incompressible 4579 {Navier-Stokes} equation on a cluster of distributed-memory computers}, 4580 booktitle = {Proceedings of the 19th International Symposium on High Performance Computing 4581 Systems and Applications}, 4582 pages = {11--16}, 4583 year = {2005}, 4584 url = { http://ieeexplore.ieee.org/search/wrapper.jsp?arnumber=1430046}, 4585 petsc_uses = {KSP} 4586} 4587 4588@TechReport{ bonglioli-icnmfd98, 4589 title = {Multidimensional Residual Distribution Schemes for the Pseudo-Compressible 4590 {Euler} and {Navier-Stokes} equations on Unstructured Meshes}, 4591 institution = {Universita della Basilicata via della Tecnica 3}, 4592 year = {1996}, 4593 author = {A. Bonglioli}, 4594 url = {http://www.unibas.it/utenti/bonfiglioli/icnmfd98.ps.gz}, 4595 petsc_uses = {KSP} 4596} 4597 4598@Article{ deng-piquet-ctf, 4599 author = {G. B. Deng and J. Piquet and X. Vasseur and M. Visonneau"}, 4600 title = {A new fully coupled method for computing turbulent flows}, 4601 journal = {Computers and Fluids}, 4602 volume = {30}, 4603 pages = {445--472}, 4604 year = {2001}, 4605 petsc_uses = {KSP} 4606} 4607 4608@InProceedings{ knepleysarinsameh99b, 4609 title = {Multilevel Preconditioning for Parallel {CFD}}, 4610 author = {Matthew G. Knepley and Vivek Sarin and Ahmed H. Sameh}, 4611 booktitle = {International Conference On Preconditioning Techniques For Large Sparse Matrix 4612 Problems In Industrial Applications}, 4613 address = {Minneapolis, MN}, 4614 year = {1999}, 4615 petsc_uses = {KSP} 4616} 4617 4618@InProceedings{ garbey1, 4619 author = {M. Garbey and B. Hadri and W. Shyy.}, 4620 title = {Fast Elliptic Solver for Incompressible {Navier Stokes} Flow and Heat Transfer 4621 Problems on the Grid}, 4622 booktitle = {Aerospace Sciences Meeting and Exhibit}, 4623 note = {Paper No. 2005-1386}, 4624 year = {2005}, 4625 petsc_uses = {KSP} 4626} 4627 4628@Article{ carrica2007unsteady, 4629 title = {An unsteady single-phase level set method for viscous free surface flows}, 4630 author = {Carrica, PM and Wilson, RV and Stern, F.}, 4631 journal = {International Journal for Numerical Methods in Fluids}, 4632 volume = {53}, 4633 number = {2}, 4634 pages = {229--256}, 4635 year = {2007}, 4636 publisher = {Chichester; New York: Wiley, c1981-}, 4637 petsc_uses = {KSP} 4638} 4639 4640@Article{ pctw2004, 4641 author = {M. S. Politano and P. M. Carrica and C. Turan and L. Weber}, 4642 title = {A Multidimensional Two-Phase Flow Model for the Total Dissolved Gas Downstream of 4643 Spillways}, 4644 journal = {Journal of Hydraulic Research}, 4645 note = {accepted for publication}, 4646 year = {2004}, 4647 petsc_uses = {KSP} 4648} 4649 4650@Article{ wcs2004, 4651 author = {R. V. Wilson and P. M. Carrica and F. Stern}, 4652 title = {Unsteady RANS Method for Ship Motions with Application to Roll for a Surface 4653 Combatant}, 4654 journal = {Computers and Fluids}, 4655 note = {in press}, 4656 year = {2004}, 4657 petsc_uses = {KSP} 4658} 4659 4660@Article{ cws2005, 4661 author = {P. M. Carrica and R. V. Wilson and F. Stern}, 4662 title = {Unsteady RANS Simulation of the Ship Forward Speed Diffraction Problem}, 4663 journal = {Computers and Fluids}, 4664 note = {accepted for publication}, 4665 year = {2005}, 4666 petsc_uses = {KSP} 4667} 4668 4669@Article{ chndss2010, 4670 author = {P. M. Carrica and J. Huang and R. Noack and D. Kaushik and B. Smith and F. 4671 Stern}, 4672 title = { Large-Scale {DES} Computations of the Forward Speed Diffraction and Pitch and 4673 Heave Problems for a Surface Combatant}, 4674 journal = {Computers and Fluids}, 4675 year = {2010}, 4676 volume = {39}, 4677 number = {7}, 4678 pages = {1095--1111}, 4679 petsc_uses = {KSP} 4680} 4681 4682@InProceedings{ chnkss2008, 4683 author = {P. M. Carrica and J. Huang and R. Noack and D. Kaushik and B. Smith and F. 4684 Stern}, 4685 title = {Toward Large-Scale Computations of Ship Motions with Dynamic Overset Curvilinear 4686 Grids}, 4687 booktitle = {Proceedings of the 27th Symposium on Naval Hydrodynamics, Seoul, Korea}, 4688 year = {2008}, 4689 petsc_uses = {KSP} 4690} 4691 4692@MastersThesis{ mtj, 4693 author = {M. T. Jozkowski}, 4694 title = {Application of Algebraic Multigrid Methods to the Solution of Stratified Flows 4695 About Submerged Bodies}, 4696 school = {The Pennsylvania State University}, 4697 year = {2005}, 4698 petsc_uses = {KSP} 4699} 4700 4701@Article{ pp, 4702 author = {E. G. Paterson and L. J. Peltier}, 4703 title = {Detached-Eddy Simulation of High Reynolds Number Beveled-Trailing-Edge Flows and 4704 Wakes}, 4705 journal = {ASME Journal of Fluids Engineering}, 4706 note = {In press}, 4707 year = {2005}, 4708 petsc_uses = {KSP} 4709} 4710 4711@Article{ eps, 4712 author = {B. A. Edge and E. G. Paterson and G. Settles}, 4713 title = {Computational Study of the Wake and Contaminant Transport of a Walking Human}, 4714 journal = {ASME Journal of Fluids Engineering}, 4715 note = {In press}, 4716 year = {2005}, 4717 petsc_uses = {KSP} 4718} 4719 4720@InProceedings{ rp, 4721 author = {B. Racine and E. G. Paterson}, 4722 title = {Computation of Maneuvering Coefficients for Non-Body-of-Revolution Submarines 4723 Using Unsteady {RANS} {CFD}}, 4724 booktitle = {35th AIAA Fluid Dynamics Conference and Exhibit}, 4725 year = {2005}, 4726 petsc_uses = {KSP} 4727} 4728 4729@InProceedings{ etpp, 4730 author = {B. A. Edge and M. F. Trujillo and E. G. Paterson and L. J. Peltier}, 4731 title = {Prediction of Forces and Moments on a Sonobuoy Configuration Using Overset Grids 4732 and DES}, 4733 booktitle = {7th Overset Composite Grid and Solution Technology Symposium}, 4734 year = {2004}, 4735 petsc_uses = {KSP} 4736} 4737 4738@InProceedings{ pp8, 4739 author = {E. G. Paterson and L. J. Peltier}, 4740 title = {Localized turbulence simulation for naval hydrodynamics: issues in using overset 4741 refinement grids and detached-eddy simulation}, 4742 booktitle = {7th Overset Composite Grid and Solution Technology Symposium}, 4743 year = {2004}, 4744 petsc_uses = {KSP} 4745} 4746 4747@InProceedings{ mzwp, 4748 author = {R. Meyer and F. J. Zajackowski and W. A. Straka,and E. G. Paterson}, 4749 title = {Experimental and Computational Study of Cavitation Inception on Co-Flow Nozzles}, 4750 booktitle = {25th Symposium on Naval Hydrodynamics}, 4751 year = {2004}, 4752 petsc_uses = {KSP} 4753} 4754 4755@InProceedings{ ppph, 4756 author = {E. G. Paterson and J. E. Poremba and L. J. Peltier and S. A. Hambric}, 4757 title = {A Physics-Based Simulation Methodology for Predicting Trailing-Edge Singing}, 4758 booktitle = {25th Symposium on Naval Hydrodynamics}, 4759 year = {2004}, 4760 petsc_uses = {KSP} 4761} 4762 4763@InProceedings{ ppd, 4764 author = {E. G. Paterson and L. J. Peltier}, 4765 title = {Detached-Eddy Simulation of High Reynolds Number Trailing-Edge Flows and Wakes}, 4766 booktitle = {Symposium on LES Advancements and Applications, ASME FED Summer Meeting}, 4767 year = {2004}, 4768 petsc_uses = {KSP} 4769} 4770 4771@InProceedings{ bp, 4772 author = {W. J. Baker and E. G. and Paterson}, 4773 title = {Simulation of Steady Circulation Control for the General Aviation Circulation 4774 Control Wing}, 4775 booktitle = {NASA/ONR Workshop on Circulation Control}, 4776 year = {2004}, 4777 petsc_uses = {KSP} 4778} 4779 4780@InProceedings{ pb, 4781 author = {E. G. Paterson and W. J. Baker}, 4782 title = {RANS and Detached-Eddy Simulation of the NCCR airfoil}, 4783 booktitle = {NASA/ONR Workshop on Circulation Control}, 4784 year = {2004}, 4785 petsc_uses = {KSP} 4786} 4787 4788@InProceedings{ pb3, 4789 author = {E. G. Paterson and W. J. Baker}, 4790 title = {Simulation of Steady and Pulsed Circulation Controlfor Marine-Vehicle Control 4791 Surfaces}, 4792 booktitle = {42nd AIAA Aerospace Sciences Meeting}, 4793 year = {2004}, 4794 petsc_uses = {KSP} 4795} 4796 4797@InProceedings{ gid1, 4798 author = {G. Frank and J. D'Elia}, 4799 title = {{CFD} Modelling of the Flow Around the {Ahmed} Vehicle Model}, 4800 year = {2004}, 4801 booktitle = {Proceedings of the 2nd Conference on Advances and Applications of GiD}, 4802 url = {http://www.gid.cimne.upc.es/2004/papers/p216.pdf}, 4803 petsc_uses = {KSP} 4804} 4805 4806@InBook{ b1, 4807 author = {A.Bonfiglioli}, 4808 chapter = {On the use of the PETSc library for unstructured {CFD} applications}, 4809 year = {2001}, 4810 title = {Science and Supercomputing at CINECA}, 4811 pages = {397--400}, 4812 petsc_uses = {KSP} 4813} 4814 4815@InProceedings{ b2004, 4816 author = {L. A. Barba}, 4817 title = {Computing high-Reynolds number vortical flows: a highly accurate method with a 4818 fully meshless formulation}, 4819 year = {2004}, 4820 booktitle = {International Conference on Parallel CFD, Grand Canary, May 2004}, 4821 note = {Submitted}, 4822 petsc_uses = {KSP} 4823} 4824 4825@InProceedings{ bl2004, 4826 author = {L. A. Barba and A. Leonard}, 4827 title = {Computation of Viscous Vortices with Fully Meshless Method}, 4828 year = {2004}, 4829 booktitle = {Proceedings of ICTAM meeting in Warsaw, August 2004}, 4830 note = {Submitted}, 4831 petsc_uses = {KSP} 4832} 4833 4834@Article{ vws1, 4835 author = {B. G. M. Van Wachem and J. C. Schouten}, 4836 title = {Experimental Validation of 3-D Lagrangian VOF Model: Bubble Shape and Rise 4837 Velocity}, 4838 institution = {Laboratory of Chemical Reactor Engineering, Department of Chemical Engineering 4839 and Chemistry, Eindhoven University of Technology, 5600 MB Eindhoven, The 4840 Netherlands}, 4841 journal = {AIChE}, 4842 volumne = {48}, 4843 number = {12}, 4844 month = dec, 4845 year = {2002}, 4846 petsc_uses = {KSP} 4847} 4848 4849@TechReport{ lbam1, 4850 author = {P. Leggiero and A. Bonfiglioli and P. Amodio and F. Mazzi}, 4851 title = {Precondizionatori paralleli per la fluidodinamica computazionale}, 4852 institution = {Dipartimento Interuniversitario di Matematica Universiti degli Studi-Politecnico 4853 di Bari Italy}, 4854 year = {2002}, 4855 number = {25/02}, 4856 petsc_uses = {KSP} 4857} 4858 4859@Article{ kees_miller_02, 4860 author = {C. E. Kees and C. T. Miller}, 4861 title = {Higher Order Time Integration Methods for Two-Phase Flow}, 4862 journal = {Advances in Water Resources}, 4863 year = {2002}, 4864 volume = {25}, 4865 number = {2}, 4866 pages = {159-177.}, 4867 petsc_uses = {KSP} 4868} 4869 4870@InProceedings{ lepotmeersessers2001, 4871 author = {I. Lepot and F. Meers and J.A. Essers}, 4872 title = {Multilevel Parallel High Order Schemes for Invisid Flow Computations on 3D 4873 Unstructured Meshes}, 4874 year = {2001}, 4875 booktitle = {ECCOMAS Computational Fluid Dynamics Conference 2001}, 4876 url = {http://www.ulg.ac.be/aerodyn}, 4877 petsc_uses = {KSP} 4878} 4879 4880@InProceedings{ knepley98, 4881 author = {Matthew Knepley and Denis Vanderstraeten}, 4882 title = {Parallel Building Blocks for Finite Element Simulations: Application to 4883 Solid-Liquid Mixture Flows}, 4884 booktitle = {Proceedings of Parallel CFD'97}, 4885 publisher = {Elsevier}, 4886 pages = {281--287}, 4887 year = {1998}, 4888 petsc_uses = {KSP} 4889} 4890 4891@InProceedings{ pcfd97, 4892 author = {William D. Gropp and David E. Keyes and Lois Curfman McInnes and M. D. Tidriri}, 4893 title = {Parallel Implicit {PDE} Computations: Algorithms and Software}, 4894 publisher = {Elsevier}, 4895 year = {1998}, 4896 booktitle = {Proceedings of Parallel CFD'97}, 4897 pages = {333-344}, 4898 petsc_uses = {KSP} 4899} 4900 4901@InProceedings{ knepleysamehsari98, 4902 author = {Matthew Knepley and Ahmed H. Sameh and Vivek Sarin}, 4903 title = {Parallel Simulation of Particulate Flows}, 4904 booktitle = {Solving Irregularly Structured Problems in Parallel}, 4905 editors = {A. Ferreira et al}, 4906 year = {1998}, 4907 series = {Lecture Notes in Computer Science}, 4908 volume = {1457}, 4909 pages = {226--237}, 4910 petsc_uses = {KSP} 4911} 4912 4913@Article{ gkmt98, 4914 author = {William D. Gropp and David E. Keyes and Lois Curfman McInnes and M. D. Tidriri}, 4915 title = {Globalized {N}ewton-{K}rylov-{S}chwarz Algorithms and Software for Parallel 4916 Implicit {CFD}}, 4917 journal = {Int. J. High Performance Computing Applications}, 4918 year = {2000}, 4919 volume = {14}, 4920 url = {ftp://info.mcs.anl.gov/pub/tech_reports/reports/P788.ps.Z}, 4921 pages = {102-136}, 4922 petsc_uses = {KSP} 4923} 4924 4925@InProceedings{ agkks-sc99, 4926 author = {W. K. Anderson and W. D. Gropp and D. K. Kaushik and D. E. Keyes and B. F. 4927 Smith}, 4928 title = {Achieving High Sustained Performance in an Unstructured Mesh {CFD} Application}, 4929 booktitle = {ACM/IEEE Proc. of SC 99: High Performance Networking and Computing}, 4930 editor = {}, 4931 publisher = {}, 4932 url = {ftp://info.mcs.anl.gov/pub/tech_reports/reports/P776.ps.Z}, 4933 year = {1999}, 4934 note = {Winner of Gordon Bell Special Prize at SC 99}, 4935 petsc_uses = {KSP} 4936} 4937 4938@Article{ gkks01, 4939 author = {W. D. Gropp and D. K. Kaushik and D. E. Keyes and B. F. Smith}, 4940 title = {High Performance Parallel Implicit {CFD}}, 4941 journal = {Journal of Parallel Computing}, 4942 year = {2001}, 4943 volume = {27}, 4944 pages = {337-362}, 4945 url = {http://www.mcs.anl.gov/petsc-fun3d/Papers/manke.pdf}, 4946 petsc_uses = {KSP} 4947} 4948 4949@Article{ cristea-sofonea-02, 4950 author = {Artur Cristea and Victor Sofonea}, 4951 title = {Finite Difference lattice Boltzmann model for Liquid Vapour Systems}, 4952 journal = {Proceedings of the Romanian Academy, Series A: Mathematics, Physics, Technical 4953 Sciences, Information Sciences}, 4954 volume = {3}, 4955 number = {3}, 4956 year = {2002}, 4957 petsc_uses = {KSP} 4958} 4959 4960@Article{ cristea2, 4961 author = {Artur Cristea and Victor Sofonea}, 4962 title = {Two component lattice Boltzmann model with flux limiter techniques}, 4963 journal = {Proceedings of the Romanian Academy, Series A: Mathematics, Physics, Technical 4964 Sciences, Information Sciences}, 4965 volume = {4}, 4966 number = {1}, 4967 year = {2003}, 4968 pages = {59--64}, 4969 petsc_uses = {KSP} 4970} 4971 4972@Article{ cristea1, 4973 author = {Artur Cristea and Victor Sofonea}, 4974 title = {Two component lattice Boltzmann model with flux limiters}, 4975 journal = {Central European Journal of Physics}, 4976 volume = {2}, 4977 number = {2}, 4978 year = {2004}, 4979 pages = {382--396}, 4980 petsc_uses = {KSP} 4981} 4982 4983@Article{ sofnea-lamura1, 4984 author = {Victor Sofonea and Antonio Lamura and Giuseppe Gonnella and Artur Cristea}, 4985 title = {Finite-difference lattice Boltzmann model with flux limiters for liquid-vapor 4986 systems}, 4987 journal = {Physical Review E}, 4988 volume = {70}, 4989 number = {4}, 4990 year = {2004}, 4991 pages = {046702-1 / 046702-9}, 4992 petsc_uses = {KSP} 4993} 4994 4995@InProceedings{ gkks01b, 4996 author = {W. D. Gropp and D. K. Kaushik and D. E. Keyes and B. F. Smith}, 4997 title = {Latency, Bandwidth, and Concurrent Issue Limitations in High-Performance {CFD}}, 4998 booktitle = {Proceedings of the First MIT Conference on Computational Fluid and Solid 4999 Mechanics}, 5000 editor = {}, 5001 location = {Cambridge, MA}, 5002 year = {2001}, 5003 month = jun, 5004 url = {http://www.mcs.anl.gov/petsc-fun3d/Papers/mit01.pdf}, 5005 petsc_uses = {KSP} 5006} 5007 5008@InProceedings{ gkks00, 5009 author = {W. D. Gropp and D. K. Kaushik and D. E. Keyes and B. F. Smith}, 5010 title = {Understanding the Parallel Scalability of An Implicit Unstructured Mesh {CFD} 5011 Code}, 5012 booktitle = {Proceedings of the 7th International Conference on High Performance Computing 5013 (HiPC '2000)}, 5014 editor = {}, 5015 location = {Bangalore, India}, 5016 year = {2000}, 5017 pages = {395--404}, 5018 url = {http://www.mcs.anl.gov/petsc-fun3d/Papers/hipc00.pdf}, 5019 petsc_uses = {KSP} 5020} 5021 5022@InProceedings{ gkks-sc00, 5023 author = {W. D. Gropp and D. K. Kaushik and D. E. Keyes and B. F. Smith}, 5024 title = {Performance Modeling and Tuning of an Unstructured Mesh {CFD} Application}, 5025 booktitle = {Proceedings of SC2000}, 5026 editor = {}, 5027 publisher = {IEEE Computer Society}, 5028 year = {2000}, 5029 url = {http://www.mcs.anl.gov/petsc-fun3d/Papers/sc00.pdf}, 5030 petsc_uses = {KSP} 5031} 5032 5033@InProceedings{ knepleysamehsarin99, 5034 author = {Matthew Knepley and Ahmed H. Sameh and Vivek Sarin}, 5035 title = {Design of Large Scale Parallel Simulations}, 5036 booktitle = {Proceedings of Parallel CFD'99}, 5037 editors = {A. {Ecer et al.}}, 5038 publisher = {Elsevier}, 5039 year = {1999}, 5040 petsc_uses = {KSP} 5041} 5042 5043@InProceedings{ gkks-pcfd99, 5044 author = {William D. Gropp and Dinesh K. Kaushik and David E. Keyes and Barry F. Smith}, 5045 title = {Towards Realistic Performance Bounds for Implicit {CFD} codes}, 5046 booktitle = {Proceedings of Parallel CFD'99}, 5047 editors = {A. {Ecer et al.}}, 5048 publisher = {Elsevier}, 5049 url = {http://www.cs.odu.edu/~keyes/papers/pcfd99_gkks.pdf}, 5050 year = {1999}, 5051 petsc_uses = {KSP} 5052} 5053 5054@InProceedings{ kks97, 5055 author = {D. K. Kaushik and D. E. Keyes and B. F. Smith}, 5056 title = {On the Interaction of Architecture and Algorithm in the Domain-Based 5057 Parallelization of an Unstructured Grid Incompressible Flow Code}, 5058 booktitle = {Proceedings of the 10th International Conference on Domain Decomposition 5059 Methods}, 5060 editor = {J. Mandel et al.}, 5061 pages = {311--319}, 5062 publisher = {Wiley}, 5063 note = {}, 5064 year = {1997}, 5065 petsc_uses = {KSP} 5066} 5067 5068@InProceedings{ kks99, 5069 author = {D. K. Kaushik and D. E. Keyes and B. F. Smith}, 5070 title = {{N}ewton-{K}rylov-{S}chwarz Methods for Aerodynamic Problems: Compressible and 5071 Incompressible Flows on Unstructured Grids}, 5072 booktitle = {Proceedings of the 11th International Conference on Domain Decomposition 5073 Methods}, 5074 editors = {C.-H. {Lai et al.}}, 5075 publisher = {Domain Decomposition Press, Bergen}, 5076 url = {ftp://info.mcs.anl.gov/pub/tech_reports/reports/P745.ps.Z}, 5077 year = {1999}, 5078 petsc_uses = {KSP} 5079} 5080 5081@InCollection{ kks97_cfd, 5082 author = {D. E. Keyes and D. K. Kaushik and B. F. Smith}, 5083 title = {Perspectives for {CFD} on Petaflops Systems}, 5084 booktitle = {CFD Review 1998}, 5085 editor = {M. Hafez and K. Oshima}, 5086 publisher = {World Scientific, Singapore}, 5087 pages = {1079--1096}, 5088 note = {}, 5089 year = {1998}, 5090 petsc_uses = {KSP} 5091} 5092 5093@Article{ hm99, 5094 author = {P. D. Hovland and L. C. McInnes}, 5095 title = {Parallel Simulation of Compressible Flow Using Automatic Differentiation and 5096 {PETSc}}, 5097 year = {2000}, 5098 journal = {Parallel Computing}, 5099 url = {ftp://info.mcs.anl.gov/pub/tech_reports/reports/P796.ps.Z}, 5100 note = {special issue of Parallel Computing on ``Parallel Computing in Aerospace''}, 5101 petsc_uses = {KSP} 5102} 5103 5104@InProceedings{ cruzbarbaknepley08, 5105 author = {Felipe A. Cruz and Lorena A. Barba and Matthew G. Knepley}, 5106 title = {Fast Multipole Method for particle interactions: an open source parallel library 5107 component}, 5108 booktitle = {Proceedings of ParCFD2008}, 5109 year = {2008}, 5110 editor = {Tromeur-Dervout et. al.}, 5111 publisher = {Elsevier}, 5112 petsc_uses = {KSP} 5113} 5114 5115@Article{ hwangcai05, 5116 author = {F.-N. Hwang and X.-C. Cai}, 5117 title = {A parallel nonlinear additive {Schwarz} preconditioned inexact {Newton} algorithm 5118 for incompressible {Navier-Stokes} equations}, 5119 journal = {J. Comput. Phys.}, 5120 volume = {204}, 5121 year = {2005}, 5122 pages = {666--691}, 5123 petsc_uses = {KSP} 5124} 5125 5126@Article{ barbaleonard07, 5127 author = {Lorena A Barba and Anthony Leonard}, 5128 title = {Emergence and evolution of tripole vortices from net-circulation initial 5129 conditions}, 5130 journal = {Phys. Fluids}, 5131 volume = {19}, 5132 pages = {017101}, 5133 year = {2007}, 5134 doi = {10.1063/1.2409734}, 5135 petsc_uses = {KSP} 5136} 5137 5138@Article{ barba07, 5139 author = {Lorena A Barba}, 5140 title = {Non-shielded multipolar vortices at high Reynolds number}, 5141 journal = {Phys. Rev. E}, 5142 volume = {73}, 5143 pages = {065303}, 5144 year = {2006}, 5145 doi = {10.1103/PhysRevE.73.065303}, 5146 petsc_uses = {KSP} 5147} 5148 5149@Article{ schofield2010multi, 5150 title = {Multi-material incompressible flow simulation using the moment-of-fluid method}, 5151 author = {Schofield, S.P. and Christon, M.A. and Dyadechko, V. and Garimella, R.V. and 5152 Lowrie, R.B. and Swartz, B.K.}, 5153 journal = {International Journal for Numerical Methods in Fluids}, 5154 volume = {63}, 5155 number = {8}, 5156 pages = {931--952}, 5157 year = {2010}, 5158 publisher = {Wiley Online Library}, 5159 petsc_uses = {KSP} 5160} 5161 5162% LiteralHTML: 5163% LiteralHTML: <a name="wave"><H3><center>Wave propagation and the Helmholtz equation</center></H3> 5164% LiteralHTML: 5165% LiteralHTML: article{DeGersem99, 5166% LiteralHTML: author = {Ji Wng and Yu Wang and Wen-ke Hu and Jian-ke Du}, 5167% LiteralHTML: title = {The high performance of finite element analysis and applications of surface acoustic waves in finite elastic solids}, 5168% LiteralHTML: } 5169@Article{ nagler2014, 5170 title = {Sound transmission through a poroelastic layered panel}, 5171 author = {Loris Nagler and Ping Rong and Martin Schanz and Otto von Estorff}, 5172 journal = {Computational Mechanics}, 5173 volume = {53}, 5174 number = {4}, 5175 pages = {549--560}, 5176 issn = {1432-0924}, 5177 doi = {10.1007/s00466-013-0916-x}, 5178 year = {2014}, 5179 petsc_uses = {KSP} 5180} 5181 5182@Article{ sheikh2013, 5183 author = {Sheikh, A. H. and Lahaye, D. and Vuik, C.}, 5184 title = {On the convergence of shifted {L}aplace preconditioner combined with multilevel 5185 deflation}, 5186 journal = {Numerical Linear Algebra with Applications}, 5187 volume = {20}, 5188 number = {4}, 5189 issn = {1099-1506}, 5190 doi = {10.1002/nla.1882}, 5191 pages = {645--662}, 5192 keywords = {Helmholtz equation, shifted Laplace preconditioner, multigrid deflation, Fourier 5193 analysis}, 5194 year = {2013}, 5195 petsc_uses = {KSP} 5196} 5197 5198@InProceedings{ silence, 5199 author = {J.M. and Alonso and G. Garcia and V. Hernandez and F.D. Denia and F.J. 5200 Fuenmayor}, 5201 title = {A parallel computing approach for solving the Helmholtz equation in 3D domains: 5202 Application to the study of acoustic behaviour of silencers}, 5203 year = {2004}, 5204 booktitle = {Eurppean Congress on Computational Methods in Applied Sciences and Engineering 5205 (ECCOMAS)}, 5206 petsc_uses = {KSP} 5207} 5208 5209@Article{ degersem99, 5210 author = {H. De Gersem and Domenico Lahaye and S. Vandewalle and K. Hameyer}, 5211 title = {Comparison of Quasi Minimal Residual and Bi-Conjugate Gradient Iterative Methods 5212 to Solve Complex Symmetric Systems Arising from Time-Harmonic Simulations}, 5213 journal = {COMPEL}, 5214 year = {1999}, 5215 volume = {18}, 5216 number = {3}, 5217 pages = {298--310}, 5218 bibdate = {}, 5219 petsc_uses = {KSP} 5220} 5221 5222@InProceedings{ widlund-wave-98, 5223 author = {Olof B. Widlund}, 5224 title = {Schwarz Methods for {H}elmholtz's Equation}, 5225 booktitle = {Mathematical and Numerical Aspects of Wave Propagation}, 5226 editor = {John A. DeSanto}, 5227 year = {1998}, 5228 publisher = {SIAM}, 5229 pages = {620--622}, 5230 address = {Philadelphia}, 5231 note = {Proceedings of the Fourth International Conference on Mathematical and Numerical 5232 Aspects of Wave Propagation, Golden, Colorado, June 1--5}, 5233 petsc_uses = {KSP} 5234} 5235 5236@InProceedings{ toselli-wave-98, 5237 author = {Andrea Toselli}, 5238 title = {Overlapping {S}chwarz Methods for {M}axwell's Equations in Conductive Media}, 5239 booktitle = {Mathematical and Numerical Aspects of Wave Propagation}, 5240 editor = {John A. DeSanto}, 5241 year = {1998}, 5242 publisher = {SIAM}, 5243 address = {Philadelphia}, 5244 pages = {540--542}, 5245 note = {Proceedings of the Fourth International Conference on Mathematical and Numerical 5246 Aspects of Wave Propagation, Golden, Colorado, June 1--5}, 5247 petsc_uses = {KSP} 5248} 5249 5250@InProceedings{ mcinnes-wave-98, 5251 author = {L. C. McInnes and R. Susan-Resiga and H. M. Atassi and D. E. Keyes}, 5252 title = {Parallel Solution of {H}elmholtz Problems using Additive {S}chwarz Methods}, 5253 booktitle = {Mathematical and Numerical Aspects of Wave Propagation}, 5254 editor = {John A. DeSanto}, 5255 year = {1998}, 5256 publisher = {SIAM}, 5257 address = {Philadelphia}, 5258 pages = {623--625}, 5259 note = {Proceedings of the Fourth International Conference on Mathematical and Numerical 5260 Aspects of Wave Propagation, Golden, Colorado, June 1--5}, 5261 petsc_uses = {KSP} 5262} 5263 5264@InProceedings{ mska98, 5265 author = {L. C. McInnes and R. Susan-Resiga and D. E. Keyes and H. M. Atassi}, 5266 title = {Additive {S}chwarz Methods with Nonreflecting Boundary Conditions for the 5267 Parallel Computation of {H}elmholtz Problems}, 5268 booktitle = {Proceedings of the 10th Intl. Conf. on Domain Decomposition Methods}, 5269 editor = {J. Mandel et al.}, 5270 publisher = {AMS}, 5271 pages = {349--357}, 5272 year = {1998}, 5273 petsc_uses = {KSP} 5274} 5275 5276@InProceedings{ ccew98, 5277 author = {X.-C. Cai and M. A. Casarin, Jr. and F. W. Elliott, Jr. and O. B. Widlund}, 5278 title = {Overlapping {S}chwarz Algorithms for Solving {H}elmholtz's Equation}, 5279 booktitle = {Proceedings of the 10th Intl. Conf. on Domain Decomposition Methods}, 5280 editor = {J. Mandel et al.}, 5281 publisher = {AMS}, 5282 pages = {437-445}, 5283 year = {1998}, 5284 petsc_uses = {KSP} 5285} 5286 5287@InProceedings{ ra98a, 5288 author = {R. Susan-Resiga and H. M. Atassi}, 5289 title = {Parallel Computing Using {S}chwarz Domain Decomposition Method for Aeroacoustic 5290 Problems}, 5291 booktitle = {Proceedings of the 4th AIAA/CEAS Aeroacoustics Conference}, 5292 publisher = {AIAA}, 5293 pages = {86-96}, 5294 note = {AIAA paper 98-2218}, 5295 year = {1998}, 5296 petsc_uses = {KSP} 5297} 5298 5299@InProceedings{ ar98c, 5300 author = {H. M. Atassi and R. Susan-Resiga}, 5301 title = {Parallel Computation of Harmonic Waves using Domain Decomposition, Part {I}: 5302 General Formulation}, 5303 booktitle = {Proceedings of the ASME Noise Control and Acoustics Division}, 5304 publisher = {ASME}, 5305 note = {NCA-25}, 5306 pages = {375-379}, 5307 year = {1998}, 5308 petsc_uses = {KSP} 5309} 5310 5311@InProceedings{ ra98b, 5312 author = {R. Susan-Resiga and H. M. Atassi}, 5313 title = {Parallel Computation of Harmonic Waves using Domain Decomposition, Part {II}: 5314 Numerical Implementation and Applications}, 5315 booktitle = {Proceedings of the ASME Noise Control and Acoustics Division}, 5316 publisher = {ASME}, 5317 note = {NCA-25}, 5318 pages = {381 -388}, 5319 year = {1998}, 5320 petsc_uses = {KSP} 5321} 5322 5323@InProceedings{ cai-dd10-98, 5324 author = {Xiao-Chuan Cai and Mario A. Casarin and Frank W. Elliott, Jr. and Olof B. 5325 Widlund}, 5326 title = {Overlapping {S}chwarz methods for solving {H}elmholtz's Equation}, 5327 booktitle = {Domain Decomposition Methods 10}, 5328 editors = {Jan Mandel and Charbel Farhat and Xiao-Chuan Cai}, 5329 series = {Contemporary Mathematics}, 5330 volume = {218}, 5331 publisher = {American Mathematical Society}, 5332 address = {Providence, Rhode Island}, 5333 year = {1998}, 5334 pages = {437--445}, 5335 petsc_uses = {KSP} 5336} 5337 5338@InProceedings{ alghamdi2011petclaw, 5339 title = {Pet{C}law: A Scalable Parallel Nonlinear Wave Propagation Solver for {P}ython}, 5340 booktitle = {Proceedings of SpringSim 2011}, 5341 publisher = {ACM}, 5342 author = {Amal Alghamdi and Aron Ahmadia and David I. Ketcheson and Matthew G. Knepley and 5343 Kyle T. Mandli and Lisandro Dalcin}, 5344 year = {2011}, 5345 petsc_uses = {KSP} 5346} 5347 5348@Article{ pyclaw2012, 5349 author = {David I. Ketcheson and Kyle T. Mandli and Aron J. Ahmadia and Amal Alghamdi and 5350 Manuel Quezada de Luna and Matteo Parsani and Matthew G. Knepley and Matthew 5351 Emmett}, 5352 title = {{PyClaw}: Accessible, Extensible, Scalable Tools for Wave Propagation Problems}, 5353 journal = {SIAM Journal on Scientific Computing}, 5354 volume = {34}, 5355 number = {4}, 5356 pages = {C210--C231}, 5357 note = {\url{http://arxiv.org/abs/1111.6583}}, 5358 year = {2012}, 5359 petsc_uses = {KSP} 5360} 5361 5362% LiteralHTML: 5363% LiteralHTML: <a name="optimization"><H3><center>Optimization</center></H3> 5364% LiteralHTML: 5365@Article{ sojkahorakhaplacermak2018, 5366 title = {The impact of enabling multiple subdomains per MPI process in the TFETI domain 5367 decomposition method}, 5368 author = {Radim Sojka and David Hor{\'a}k and V{\'a}clav Hapla and Martin {\v{C}}erm{\'a}k}, 5369 journal = {Applied Mathematics and Computation}, 5370 volume = {319}, 5371 pages = {586--597}, 5372 year = {2018}, 5373 petsc_uses = {KSP} 5374} 5375 5376@Article{ chencai2014, 5377 title = {A parallel two-level domain decomposition based one-shot method for shape 5378 optimization problems}, 5379 author = {Rongliang Chen and Xiao‐Chuan Cai}, 5380 journal = {International Journal for Numerical Methods in Engineering}, 5381 volume = {99}, 5382 number = {13}, 5383 year = {2014}, 5384 doi = {10.1002/nme.4711}, 5385 petsc_uses = {KSP} 5386} 5387 5388@PhDThesis{ prudencio2005, 5389 author = {Ernesto Prudencio}, 5390 title = {Parallel Fully Coupled {Lagrange-Newton-Krylov-Schwarz} Algorithms and Software 5391 for Optimization Problems Constrained by Partial Differential Equations}, 5392 school = {University of Colorado, Boulder}, 5393 year = {2005}, 5394 petsc_uses = {KSP} 5395} 5396 5397@Article{ prudenciocai2007, 5398 title = {Parallel multilevel restricted {Schwarz} preconditioners with pollution removing 5399 for {PDE}-constrained optimization}, 5400 author = {Ernesto Prudencio and X. C. Cai}, 5401 journal = {SIAM J. Sci. Comp.}, 5402 volume = {29}, 5403 number = {3}, 5404 pages = {964--985}, 5405 year = {2007}, 5406 petsc_uses = {KSP} 5407} 5408 5409@Article{ prudenciobyrdcai2006, 5410 author = {Ernesto Prudencio and R. Byrd and X. C. Cai}, 5411 title = {Parallel full space {SQP Lagrange-Newton-Krylov-Schwarz} algorithms for 5412 {PDE}-constrained Optimization Problems}, 5413 journal = {SIAM J. Sci. Comp.}, 5414 volume = {27}, 5415 pages = {1305--1328}, 5416 year = {2006}, 5417 petsc_uses = {KSP} 5418} 5419 5420@InProceedings{ prudenciobyrdcai2004, 5421 title = {Domain decomposition methods for {PDE}-constrained optimization problems}, 5422 author = {Ernesto Prudencio and R. Byrd and X. C. Cai}, 5423 booktitle = {VECPAR 2004}, 5424 editor = {M. Dayde and J. Dongarra and V. Hernandex and J. Palma}, 5425 publisher = {Springer}, 5426 pages = {569--582}, 5427 year = {2004}, 5428 petsc_uses = {KSP} 5429} 5430 5431@Article{ belhamadia-fortin-pcp, 5432 author = {Youssef Belhamadia and Andre Fortin and Eric Chamberland}, 5433 title = {Three-dimensional anisotropic mesh adaptation for phase change problems}, 5434 journal = {Journal of Computational Physics}, 5435 volume = {201}, 5436 pages = {753-770}, 5437 year = {2004}, 5438 url = {http://portal.acm.org/citation.cfm?id=1055817.1055834#references}, 5439 petsc_uses = {KSP} 5440} 5441 5442@Article{ biros00, 5443 author = {George Biros and Omar Ghattas}, 5444 title = {A {Lagrange-Newton-Krylov-Schur} Method for {PDE} Constrained Optimization}, 5445 journal = {SIAG-Opt Views and News}, 5446 volume = {11}, 5447 number = {2}, 5448 year = {2000}, 5449 month = aug, 5450 url = {http://www.cs.cmu.edu/\~{ }oghattas/papers/siag-opt/siag-opt.pdf}, 5451 petsc_uses = {KSP} 5452} 5453 5454@Article{ bmm01, 5455 author = {Steve Benson and Lois Curfman McInnes and Jorge Mor\'{e}}, 5456 journal = {ACM Transactions on Mathematical Software}, 5457 title = {A case study in the performance and scalability of optimization algorithms}, 5458 year = {2001}, 5459 volume = {27}, 5460 number = {3}, 5461 pages = {361--376}, 5462 petsc_uses = {KSP} 5463} 5464 5465@InProceedings{ oghattas1999, 5466 author = {George Biros and Omar Ghattas}, 5467 title = {Parallel preconditioners for {KKT} systems arising in optimal control of viscous 5468 incompressible flows}, 5469 booktitle = {Proceedings of Parallel CFD '99, Williamsburg, Virginia, USA, May 23-26, 1999}, 5470 url = {http://www.cs.cmu.edu/\~{ }oghattas/papers/pcfd99/pcfd99.pdf}, 5471 year = {1999}, 5472 petsc_uses = {KSP} 5473} 5474 5475@InProceedings{ hkms00, 5476 title = {Using Automatic Differentiation for Second-order Matrix-free Methods in 5477 PDE-constrained Optimization}, 5478 author = {P. D. Hovland and D. E. Keyes and L. C. McInnes and W. Samyono}, 5479 url = {http://www.icase.edu/\~{ }keyes/papers/ad2000.ps}, 5480 booktitle = {Automatic Differentiation of Algorithms: From Simulation to Optimization}, 5481 editor = {George Corliss and Christ\`{e}le Faure and Andreas Griewank and Laurent 5482 Hasco\"{e}t and Uwe Naumann}, 5483 publisher = {Springer}, 5484 year = {2002}, 5485 petsc_uses = {KSP} 5486} 5487 5488% old version: replace with biros2005pln1 5489@TechReport{ bg011, 5490 author = {George Biros and Omar Ghattas}, 5491 title = {Parallel Lagrange-Newton-Krylov-Schur Methods for PDE-Constrained Optimization. 5492 Part I: The Krylov-Schur Solver}, 5493 institution = {Laboratory for Mechanics, Algorithms, and Computing, Carnegie Mellon University}, 5494 year = {2001}, 5495 url = {http://www.cs.cmu.edu/\~{ }oghattas/papers/lnks/lnks1.pdf}, 5496 petsc_uses = {KSP} 5497} 5498 5499% old version: replace with biros2005pln2 5500@TechReport{ bg012, 5501 author = {George Biros and Omar Ghattas}, 5502 title = {Parallel {Lagrange-Newton-Krylov-Schur} Methods for {PDE}-Constrained 5503 Optimization. Part II: The {Lagrange-Newton} Solver, and its Application to 5504 Optimal Control of Steady Viscous Flows}, 5505 institution = {Laboratory for Mechanics, Algorithms, and Computing, Carnegie Mellon University}, 5506 year = {2001}, 5507 url = {http://www.cs.cmu.edu/\~{ }oghattas/papers/lnks/lnks2.pdf}, 5508 petsc_uses = {KSP} 5509} 5510 5511% LiteralHTML: 5512% LiteralHTML: <a name="fastmethods"><H3><center>Fast Algorithms</center></H3> 5513% LiteralHTML: 5514@InProceedings{ ly2003, 5515 author = {Lexing Ying and G. Biros and D. Zorin and H. Langston}, 5516 title = {A New Parallel Kernel-independent Fast Multipole Method}, 5517 booktitle = {Proceedings of the ACM/IEEE conference on Supercomputing 2003}, 5518 year = {2003}, 5519 note = {Winner of the Best Student Paper at SC2003}, 5520 petsc_uses = {KSP} 5521} 5522 5523@Article{ yokotabarbaknepley10, 5524 author = {Rio Yokota and L A Barba and Matthew G Knepley}, 5525 title = {{PetRBF} -- A parallel {O(N)} algorithm for radial basis function interpolation}, 5526 journal = {Computer Methods in Applied Mechanics and Engineering}, 5527 volume = {199}, 5528 number = {25-28}, 5529 pages = {1793--1804}, 5530 url = {http://arxiv.org/abs/0909.5413v1}, 5531 note = {\url{http://arxiv.org/abs/0909.5413v1}}, 5532 year = {2010}, 5533 petsc_uses = {KSP} 5534} 5535 5536@Article{ cruzknepleybarba10, 5537 author = {Felipe A. Cruz and Matthew G Knepley and L A Barba}, 5538 title = {{PetFMM} -- A dynamically load-balancing parallel fast multipole library}, 5539 journal = {International Journal of Numerical Methods in Engineering}, 5540 volume = {85}, 5541 number = {4}, 5542 pages = {403--428}, 5543 url = {http://arxiv.org/abs/0905.2637}, 5544 note = {\url{http://arxiv.org/abs/0905.2637}}, 5545 year = {2010}, 5546 petsc_uses = {KSP} 5547} 5548 5549% LiteralHTML: 5550% LiteralHTML: <a name="otherapps"><H3><center>Other Application Areas</center></H3> 5551% LiteralHTML: 5552@Article{ buchanpainumplebysmedleystevenson2012, 5553 title = {A sub-grid scale finite element agglomeration multigrid method with application 5554 to the Boltzmann transport equation}, 5555 author = {AG Buchan and CC Pain and AP Umpleby and RP Smedley-Stevenson}, 5556 journal = {International Journal for Numerical Methods in Engineering}, 5557 volume = {92}, 5558 number = {3}, 5559 pages = {318--342}, 5560 year = {2012}, 5561 publisher = {Wiley Online Library}, 5562 petsc_uses = {KSP} 5563} 5564 5565@Article{ magoulesahamedsuzuki2015, 5566 title = {Green computing on graphics processing units}, 5567 author = {Fr{\'e}d{\'e}ric Magoul{\`e}s and Abal-Kassim Cheik Ahamed and Atsushi Suzuki}, 5568 journal = {Concurrency and Computation: Practice and Experience}, 5569 year = {2015}, 5570 publisher = {Wiley Online Library}, 5571 petsc_uses = {KSP} 5572} 5573 5574@InProceedings{ yanrhodes11, 5575 author = {Yan, Baoqiang and Rhodes, Philip J.}, 5576 title = {IDEA -- An API for Parallel Computing with Large Spatial Datasets}, 5577 booktitle = {Proceedings of the 2011 International Conference on Parallel Processing}, 5578 series = {ICPP '11}, 5579 pages = {355--364}, 5580 year = {2011}, 5581 isbn = {978-0-7695-4510-3}, 5582 numpages = {10}, 5583 doi = {10.1109/ICPP.2011.70}, 5584 acmid = {2066965}, 5585 publisher = {IEEE Computer Society}, 5586 address = {Washington, DC, USA}, 5587 keywords = {cluster, parallelization, spatial dataset, dependency, data partitioning}, 5588 petsc_uses = {KSP} 5589} 5590 5591@Article{ hakansson2013mdstochasticliouville, 5592 author = {Hakansson, Par and Nguyen, ThaoNguyen and Nair, Prasanth B. and Edge, Ruth and 5593 Stulz, Eugen}, 5594 title = {Cu(ii)-porphyrin molecular dynamics as seen in a novel EPR/Stochastic Liouville 5595 equation study}, 5596 journal = {Phys. Chem. Chem. Phys.}, 5597 year = {2013}, 5598 volume = {15}, 5599 issue = {26}, 5600 pages = {10930-10941}, 5601 publisher = {The Royal Society of Chemistry}, 5602 doi = {10.1039/C3CP50788B}, 5603 petsc_uses = {KSP} 5604} 5605 5606@Article{ hakansson2011stochasticliouville, 5607 author = {Hakansson, Par and Nair, Prasanth B.}, 5608 title = {Implicit numerical schemes for the stochastic Liouville equation in Langevin 5609 form}, 5610 journal = {Phys. Chem. Chem. Phys.}, 5611 year = {2011}, 5612 volume = {13}, 5613 issue = {20}, 5614 pages = {9578-9589}, 5615 publisher = {The Royal Society of Chemistry}, 5616 doi = {10.1039/C1CP20400A}, 5617 petsc_uses = {KSP} 5618} 5619 5620@InProceedings{ wang:lee:scidac2011, 5621 author = {Lei Wang and Jungho Lee and Mihai Anitescu and Anter El Azab and Lois Curfman 5622 McInnes and Todd Munson and Barry Smith}, 5623 title = {A Differential Variational Inequality Approach for the Simulation of 5624 Heterogeneous Materials}, 5625 booktitle = {Proceedings of SciDAC 2011 Conference}, 5626 year = {2011}, 5627 petsc_uses = {KSP} 5628} 5629 5630@Article{ bourdinlarsenrichardson2011, 5631 author = {Blaise Bourdin and Christopher Larsen and Casey Richardson}, 5632 title = {A time-discrete model for dynamic fracture based on crack regularization}, 5633 journal = {International Journal of Fracture}, 5634 volume = {168}, 5635 issue = {2}, 5636 pages = {133--143}, 5637 doi = {10.1007/s10704-010-9562-x}, 5638 year = {2011}, 5639 petsc_uses = {KSP} 5640} 5641 5642@Book{ bourdinfrancfortmarigo, 5643 author = {Blaise Bourdin and Gilles Francfort and Jean-Jacques Marigo}, 5644 title = {The Variational Approach to Fracture}, 5645 publisher = {Springer}, 5646 year = {2008}, 5647 petsc_uses = {KSP} 5648} 5649 5650@Article{ bourdinfrancfortmarigo2008, 5651 author = {Blaise Bourdin and Gilles Francfort and Jean-Jacques Marigo}, 5652 title = {The Variational Approach to Fracture}, 5653 journal = {J. Elasticity}, 5654 volume = {91}, 5655 issue = {1}, 5656 pages = {1--148}, 5657 doi = {10.1007/s10659-007-9107-3}, 5658 year = {2008}, 5659 petsc_uses = {KSP} 5660} 5661 5662@Article{ lahtinen2008spectrum, 5663 title = {Spectrum of the non-abelian phase in Kitaev's honeycomb lattice model}, 5664 author = {Lahtinen, V. and Kells, G. and Carollo, A. and Stitt, T. and Vala, J. and Pachos, 5665 J.K.}, 5666 journal = {Annals of Physics}, 5667 volume = {323}, 5668 number = {9}, 5669 pages = {2286--2310}, 5670 year = {2008}, 5671 publisher = {Elsevier}, 5672 petsc_uses = {KSP} 5673} 5674 5675@InProceedings{ roark2004discriminative, 5676 title = {Discriminative language modeling with conditional random fields and the 5677 perceptron algorithm}, 5678 author = {Roark, B. and Saraclar, M. and Collins, M. and Johnson, M.}, 5679 booktitle = {Proceedings of the 42nd Annual Meeting on Association for Computational 5680 Linguistics}, 5681 pages = {47}, 5682 year = {2004}, 5683 organization = {Association for Computational Linguistics}, 5684 petsc_uses = {KSP} 5685} 5686 5687@Article{ roark2007discriminative, 5688 title = {Discriminative n-gram language modeling}, 5689 author = {Roark, B. and Saraclar, M. and Collins, M.}, 5690 journal = {Computer Speech \& Language}, 5691 volume = {21}, 5692 number = {2}, 5693 pages = {373--392}, 5694 year = {2007}, 5695 publisher = {Elsevier}, 5696 petsc_uses = {KSP} 5697} 5698 5699@Conference{ garcia2011parallel, 5700 title = {{Parallel performance of the PETSc Krylov methods applied to linear systems of 3D 5701 nanodevice simulators}}, 5702 author = {Garcia-Rivera, A. and Valin, R. and Seoane, N. and Garcia-Loureiro, A. and 5703 Aldegunde, M.}, 5704 booktitle = {Electron Devices (CDE), 2011 Spanish Conference on}, 5705 pages = {1--4}, 5706 organization = {IEEE}, 5707 petsc_uses = {KSP} 5708} 5709 5710@Conference{ wesley2006parallel, 5711 title = {{A parallel artificial neural network implementation}}, 5712 author = {Wesley-Smith, I.}, 5713 booktitle = {Proceedings of The National Conference On Undergraduate Research (NCUR)}, 5714 year = {2006}, 5715 petsc_uses = {KSP} 5716} 5717 5718@Article{ hcsw1, 5719 author = {F.-N. Hwang and S.-R. Cai and Y.-L. Shao and J.-S. Wu}, 5720 title = {Parallel Newton-Krylov-Schwarz algorithms for the three-dimensional 5721 Poisson-Boltzmann equation in numerical simulation of colloidal particle 5722 interactions}, 5723 journal = {Computer Physics Communications}, 5724 volumne = {181}, 5725 year = {2010}, 5726 pages = {1529--1537}, 5727 petsc_uses = {KSP} 5728} 5729 5730@Article{ hh1, 5731 author = {C.-Y. Huang and F.-N. Hwang}, 5732 title = {Parallel pseudo-transient Newton-Krylov-Schwarz continuation algorithms for 5733 bifurcation analysis of incompressible sudden expansion flows}, 5734 journal = {Applied Numerical Mathematics}, 5735 volume = {60}, 5736 year = {2010}, 5737 pages = {738--751}, 5738 petsc_uses = {KSP} 5739} 5740 5741@Article{ hwhw1, 5742 author = {F.-N. Hwang and Z.-H. Wei and T.-M. Huang and W. Wang}, 5743 title = {A parallel additive Schwarz preconditioned Jacobi-Davidson algorithm for 5744 polynomial eigenvalue problems in quantum dot simulation}, 5745 journal = {Journal of Computational Physics}, 5746 volume = {229}, 5747 year = {2010}, 5748 pages = {2932--2947}, 5749 petsc_uses = {KSP} 5750} 5751 5752@Article{ wei2011parallel, 5753 title = {{A Parallel Scalable PETSc-Based Jacobi-Davidson Polynomial Eigensolver with 5754 Application in Quantum Dot Simulation}}, 5755 author = {Wei, Z.H. and Hwang, F.N. and Huang, T.M. and Wang, W.}, 5756 journal = {Domain Decomposition Methods in Science and Engineering XIX}, 5757 pages = {157--164}, 5758 year = {2011}, 5759 publisher = {Springer}, 5760 petsc_uses = {KSP} 5761} 5762 5763@Article{ flores2007sequential, 5764 title = {{Sequential and parallel resolution of the two-group transient neutron diffusion 5765 equation using second-degree iterative methods}}, 5766 author = {Flores-S{\'a}nchez, O. and Vidal, V. and Garc{\'\i}a, V. and Flores-S{\'a}nchez, P.}, 5767 journal = {High Performance Computing for Computational Science-VECPAR 2006}, 5768 pages = {426--438}, 5769 year = {2007}, 5770 publisher = {Springer}, 5771 petsc_uses = {KSP} 5772} 5773 5774@InProceedings{ gordonbell09, 5775 author = {Dinesh Kaushik and Michael Smith and Allan Wollaber and Barry Smith and Andrew 5776 Siegel and Won Sik Yang}, 5777 title = {Enabling High Fidelity Neutron Transport Simulations on Petascale Architectures}, 5778 booktitle = {ACM/IEEE Proceedings of SC2009: High Performance Networking and Computing}, 5779 note = {{SC'09 Gordon Bell} Prize Finalist}, 5780 year = {2009}, 5781 petsc_uses = {KSP} 5782} 5783 5784@Article{ knepleykarpeevdavidovitseisenberggillespie10, 5785 author = {Matthew G. Knepley and Dmitry A. Karpeev and Seth Davidovits and Robert~S. 5786 Eisenberg and Dirk Gillespie}, 5787 title = {An Efficient Algorithm for Classical Density Functional Theory in Three 5788 Dimensions: Ionic Solutions}, 5789 journal = {Journal of Physical Chemistry}, 5790 volume = {132}, 5791 number = {12}, 5792 pages = {124101--124111}, 5793 url = {http://arxiv.org/abs/0910.1531}, 5794 year = {2010}, 5795 petsc_uses = {KSP} 5796} 5797 5798@Article{ knepleykarpeeveisenberggillespie09, 5799 author = {{Knepley}, M.~G. and {Karpeev}, D.~A. and {Eisenberg}, R.~S. and {Gillespie}, 5800 D.}, 5801 title = {{Energetics of Calcium Selectivity: A Three-Dimensional Classical Density 5802 Functional Theory Approach}}, 5803 journal = {Biophysical Journal}, 5804 month = feb, 5805 volume = {96}, 5806 pages = {661}, 5807 doi = {10.1016/j.bpj.2008.12.3494}, 5808 year = {2009}, 5809 petsc_uses = {KSP} 5810} 5811 5812@Article{ scx2008, 5813 author = {SUWITO AND XIAO-CHUAN CAI AND YUNPING XI}, 5814 title = {PARALLEL FINITE ELEMENT METHOD FOR COUPLED CHLORIDE MOISTURE DIFFUSION IN 5815 CONCRETE}, 5816 journal = {INTERNATIONAL JOURNAL OF NUMERICAL ANALYSIS AND MODELING}, 5817 volume = {3}, 5818 number = {4}, 5819 year = {2006}, 5820 url = {http://www.math.ualberta.ca/ijnam/Volume-3-2006/No-4-06/2006-04-06.pdf}, 5821 petsc_uses = {KSP} 5822} 5823 5824@TechReport{ kdgs2008, 5825 year = {2008}, 5826 school = {Centro Internacional de Methodos Numericos en Ingenieria, Argentina}, 5827 title = {High Performance Simulations of Electrokinetic Flow and Transport in Microfluidic 5828 Chips}, 5829 author = {Pablo A. Klera and Lisandro D. Dalcin and Fabio A. Guarnieria and Mario A. 5830 Stortia}, 5831 url = {http://www.cimec.org.ar/ojs/index.php/cmm/article/view/1383}, 5832 petsc_uses = {KSP} 5833} 5834 5835@Article{ springerlink:10.1007/s10915-011-9551-x, 5836 author = {Schauer, Marco and Roman, Jose and Quintana-Ortí, Enrique and Langer, Sabine}, 5837 affiliation = {Institut für Angewandte Mechanik, Technische Universität Carolo-Wilhelmina zu 5838 Braunschweig, Spielmannstraße 11, 38106 Braunschweig, Germany}, 5839 title = {Parallel Computation of 3-D Soil-Structure Interaction in Time Domain with a 5840 Coupled FEM/SBFEM Approach}, 5841 journal = {Journal of Scientific Computing}, 5842 publisher = {Springer Netherlands}, 5843 issn = {0885-7474}, 5844 keyword = {Mathematics and Statistics}, 5845 pages = {1-22}, 5846 doi = {10.1007/s10915-011-9551-x}, 5847 petsc_uses = {KSP} 5848} 5849 5850@TechReport{ jj2007, 5851 author = {Boris Jeremic and Guanzhou Jie}, 5852 title = {Parallel Finite Element Computations for Soil-Foundation-Structure Interaction 5853 Problems Report}, 5854 institution = {UCD CompGeoMech 02--2007}, 5855 year = {2007}, 5856 url = {http://sokocalo.engr.ucdavis.edu/~jeremic/wwwpublications/CV-R23.pdf}, 5857 petsc_uses = {KSP} 5858} 5859 5860@Unpublished{ kuiper08, 5861 title = {Fast 3D frequency-dependent Radiative Transfer for Magneto-Hydrodynamics}, 5862 author = {Rolf Kuiper}, 5863 institution = {Max-Planck-Institute for Astronomy}, 5864 url = {http://www.mpia.de/~kuiper/MAKEMAKE.html}, 5865 year = {2008}, 5866 petsc_uses = {KSP} 5867} 5868 5869@Article{ williamson2012multidimensional, 5870 title = {Multidimensional multiphysics simulation of nuclear fuel behavior}, 5871 author = {Williamson, R.L. and Hales, J.D. and Novascone, S.R. and Tonks, M.R. and Gaston, 5872 D.R. and Permann, C.J. and Andrs, D. and Martineau, R.C.}, 5873 journal = {Journal of Nuclear Materials}, 5874 volume = {423}, 5875 number = {1}, 5876 pages = {149--163}, 5877 year = {2012}, 5878 publisher = {Elsevier}, 5879 petsc_uses = {KSP} 5880} 5881 5882@InProceedings{ kucukboyaci2015cobra, 5883 title = {COBRA-TF parallelization and application to PWR reactor core subchannel DNB 5884 analysis}, 5885 author = {Kucukboyaci, Vefa and Sung, Yixing and Salko, Robert}, 5886 booktitle = {Joint International Conference on Mathematics and Computation, Supercomputing in 5887 Nuclear Applications and the Monte Carlo Method}, 5888 pages = {1--18}, 5889 year = {2015}, 5890 petsc_uses = {KSP} 5891} 5892 5893@Article{ hales2012solving, 5894 title = {Solving Nonlinear Solid Mechanics Problems with the {J}acobian-{F}ree {N}ewton 5895 {K}rylov Method}, 5896 author = {Hales, J.D. and Novascone, S.R. and Williamson, R.L. and Gaston, D.R. and Tonks, 5897 M.R.}, 5898 journal = {Computer Modeling in Engineering \& Sciences(CMES)}, 5899 volume = {84}, 5900 number = {2}, 5901 pages = {123--153}, 5902 year = {2012}, 5903 publisher = {Tech Science Press}, 5904 petsc_uses = {KSP} 5905} 5906 5907@InProceedings{ srksyp2008, 5908 author = {M. A. Smith and C. Rabiti and D. Kaushik and B. Smith and W. S. Yang and G. 5909 Palmiotti}, 5910 title = {Fast reactor core simulations using the {UNIC} code}, 5911 booktitle = {Proceedings of the International Conference on the Physics of Reactors, Nuclear 5912 Power: A Sustainable Resource}, 5913 year = {2008}, 5914 petsc_uses = {KSP} 5915} 5916 5917@InProceedings{ psrlkssl2007, 5918 author = {G. Palmiotti and M. A. Smith and C. Rabiti and M. Leclere and D. Kaushik and A. 5919 Siegel and B. Smith and E. E. Lewis}, 5920 title = {{UNIC}: Ultimate Neutronic Investigation Code}, 5921 booktitle = {Joint International Topical Meeting on Mathematics and Computation and 5922 Supercomputing in Nuclear Applications}, 5923 year = {2007}, 5924 petsc_uses = {KSP} 5925} 5926 5927@InProceedings{ sprkssl2007, 5928 author = {M. A. Smith and G. Palmiotti and C. Rabiti and D. Kaushik and A. Siegel and B. 5929 Smith and E. E. Lewis}, 5930 title = {{PNFE} Component of the {UNIC} Code}, 5931 booktitle = {Joint International Topical Meeting on Mathematics and Computation and 5932 Supercomputing in Nuclear Applications}, 5933 year = {2007}, 5934 petsc_uses = {KSP} 5935} 5936 5937@InProceedings{ dc-oop-03, 5938 author = {H. Digonnet and T. Coupez}, 5939 title = {Object-oriented programming for fast-and-easy development of parallel 5940 applications in forming processes simulation}, 5941 booktitle = {Proceedings of the Second MIT Conference on Computational Fluid and Solid 5942 Mechanics}, 5943 year = {2003}, 5944 petsc_uses = {KSP} 5945} 5946 5947@InProceedings{ dc-cfm-03, 5948 author = {H. Digonnet and T. Coupez}, 5949 title = {Calcul parallele en mise en forme des materiaux}, 5950 booktitle = {XVIeme Congres Francais de Mecanique}, 5951 year = {2003}, 5952 petsc_uses = {KSP} 5953} 5954 5955@InProceedings{ dsc-pcsev-04, 5956 author = {H. Digonnet and L. Silva and T. Coupez}, 5957 title = {Parallel computation for solving efficiently viscoelastic fluid flow problems}, 5958 booktitle = {Proceedings of ECCOMAS 2004}, 5959 year = {2004}, 5960 petsc_uses = {KSP} 5961} 5962 5963@InProceedings{ dsc-pca3fs-04, 5964 author = {H. Digonnet and L. Silva and T. Coupez}, 5965 title = {Parallel computation applied to 3D FE simulation of polymer injection molding}, 5966 booktitle = {Proceedings of WCCM VI}, 5967 year = {2004}, 5968 petsc_uses = {KSP} 5969} 5970 5971@InProceedings{ dbcs-cpaac-05, 5972 author = {H. Digonnet and O. Basset and T. Coupez and L. Silva}, 5973 title = {Calcul parallele appliqu aux coulements de fluides complexe}, 5974 booktitle = {Proceedings of Eme Congres Francais de Mecanique}, 5975 year = {2005}, 5976 petsc_uses = {KSP} 5977} 5978 5979@Article{ sz2010, 5980 author = {B. Smith and H. Zhang}, 5981 title = {Sparse Triangular Solves for {ILU} Revisited: Data Layout Crucial to Better 5982 Performance}, 5983 journal = {International Journal of High Performance Computing Applications}, 5984 volume = {25}, 5985 number = {4}, 5986 pages = {386--391}, 5987 year = {2011}, 5988 petsc_uses = {KSP} 5989} 5990 5991@Article{ zssz2006, 5992 author = {H. Zhang and B. Smith and M. Sternberg and P. Zapol}, 5993 title = {{SIPs}: Shift-and-Invert Parallel Spectral Transformations}, 5994 journal = {TOMS}, 5995 url = {http://math.nist.gov/toms/Current.html#v33n2}, 5996 volumne = {33}, 5997 number = {2}, 5998 year = {2007}, 5999 petsc_uses = {KSP} 6000} 6001 6002@Article{ gs2006, 6003 author = {Fang Jin and Nivedita R. Gupta and Kathleen J. Stebe}, 6004 title = {The detachment of a viscous drop in a viscous solution in the presence of a 6005 soluble surfactant}, 6006 journal = {Phys. Fluids}, 6007 volume = {18}, 6008 year = {2006}, 6009 url = {http://scitation.aip.org/dbt/dbt.jsp?KEY=PHFLE6&Volume=LASTVOL&Issue=LASTISS}, 6010 petsc_uses = {KSP} 6011} 6012 6013@Article{ jmemsci, 6014 author = {Bo Zhou and Adam Powell}, 6015 title = {Phase Field Simulations of Liquid-Liquid Demixing During Immersion Precipitation 6016 of Polymeric Membranes in 2D and 3D}, 6017 journal = {J. Membrane Sci.}, 6018 volume = {268}, 6019 number = {2}, 6020 pages = {150--164}, 6021 year = {2006}, 6022 month = jan, 6023 day = {15}, 6024 doi = {10.1016/j.memsci.2005.05.030}, 6025 petsc_uses = {KSP} 6026} 6027 6028@InProceedings{ vbde2002, 6029 author = {Anke Veser and Wolfgang Breitung and Sergey Dorofeev and Alexander Efimenko}, 6030 title = {Flame Acceleration Distance in Obstacle-Laden Tubes}, 6031 booktitle = {Proceedings of the NINTH INTERNATIONAL CONFERENCE ON NUMERICAL COMBUSTION}, 6032 url = {http://web.ing.unisannio.it/icnc2002/CP21Turbulent_Combustion-Deflagrations_Jets_&_Fires.pdf}, 6033 year = {2002}, 6034 petsc_uses = {KSP} 6035} 6036 6037@InProceedings{ wid2005, 6038 author = {Alexander I. Bobenko and Peter Schrader}, 6039 title = {Discrete Willmore Flow}, 6040 booktitle = {Eurographics Symposium on Geometry Processing}, 6041 url = {http://www.math.tu-berlin.de/\~{ }bobenko/Papers/Willmore.pdf}, 6042 year = {2005}, 6043 editor = {M. Desbrun and H. Pottmann}, 6044 petsc_uses = {KSP} 6045} 6046 6047@Article{ stj2003, 6048 author = {A. Scascighini and A. Troxler and R. Jeltsch}, 6049 journal = {International Journal for Numerical Methods in Fluids}, 6050 volume = {41}, 6051 issue = {4}, 6052 title = {A numerical method for inverse design based on the inverse Euler equations}, 6053 year = {2003}, 6054 pages = {339--355}, 6055 url = {http://www3.interscience.wiley.com/cgi-bin/abstract/102521480/ABSTRACT}, 6056 petsc_uses = {KSP} 6057} 6058 6059@PhDThesis{ as2001, 6060 author = {ANDREA SCASCIGHINI}, 6061 title = {A Numerical Method for the Design of Internal Flow Configurations Based on the 6062 Inverse Euler Equations}, 6063 school = {SWISS FEDERAL INSTITUTE OF TECHNOLOGY, ZURICH}, 6064 year = {2001}, 6065 url = {http://www.sam.math.ethz.ch/\~{ }andrea/}, 6066 petsc_uses = {KSP} 6067} 6068 6069@Article{ hb2005, 6070 author = {E. McKay Hyde and Oscar P. Bruno}, 6071 journal = {Journal of Computational Physics}, 6072 volume = {202}, 6073 title = {A fast, higher-order solver for scattering by penetrable bodies in three 6074 dimensions}, 6075 year = {2005}, 6076 pages = {236--261}, 6077 url = {http://www.acm.caltech.edu/\~{ }bruno/hyde_bruno_3d_jcp.pdf}, 6078 petsc_uses = {KSP} 6079} 6080 6081@MastersThesis{ d2002, 6082 author = {Matthew F Dixon}, 6083 title = {PARALLEL SOLUTION OF HIGH ORDER FINITE DIFFERENCE SCHEMES FOR PRICING 6084 MULTI-DIMENSIONAL AMERICAN OPTIONS}, 6085 school = {READING UNIVERSITY}, 6086 year = {2002}, 6087 url = {http://www.ma.ic.ac.uk/\~{ }mdixion/papers/MScThesis.pdf.gz}, 6088 petsc_uses = {KSP} 6089} 6090 6091@TechReport{ gzb, 6092 author = {David Gleich and Leonid Zhukov and Pavel Berkhin}, 6093 title = {Fast Parallel PageRank: A Linear System Approach}, 6094 institution = {Stanford University}, 6095 year = {2004}, 6096 url = {http://www.gg.caltech.edu/\~{ }zhukov/papers/ParallelPageRank-paper.pdf}, 6097 petsc_uses = {KSP} 6098} 6099 6100@PhDThesis{ yergeau-99, 6101 author = {Daniel W. Yergeau}, 6102 title = {A DIAL-AN-OPERATOR APPROACH TO SIMULATION OF IMPURITY DIFFUSION IN 6103 SEMICONDUCTORS}, 6104 school = {Stanford}, 6105 year = {1999}, 6106 url = {http://www-tcad.stanford.edu/tcad/pubs/theses/yergeau.pdf}, 6107 petsc_uses = {KSP} 6108} 6109 6110@InProceedings{ rathkopf-miller-00, 6111 author = {J.A. Rathkopf and D.S. Miller and J.M. Owen and L.M. Stuart and M.R. Zika and 6112 P.G. Eltgroth and N.K. Madsen and K.P. McCandless and P.F. Nowak and M.K. Nemanic 6113 and N.A. Gentile and N.D. Keen and T.S. Palmer}, 6114 title = {{KULL}: {LLNL}'s {ASCI} Inertial Confinement Fusion Simulation Code}, 6115 year = {2000}, 6116 booktitle = {Physor 2000 American Nuclear Society Topical Meeting on Advances in Reactor 6117 Physics and Mathematics and Computation into the Next Millennium}, 6118 url = {http://www.llnl.gov/tid/lof/documents/pdf/237860.pdf}, 6119 lab = {LLNL}, 6120 petsc_uses = {KSP} 6121} 6122 6123@Article{ bonfi-palma-pas-05, 6124 author = {A. Bonfiglioli and P. De Palma and G. Pascazio and M. Napolitano}, 6125 journal = {Journal of Turbomachinery}, 6126 volume = {127}, 6127 title = {An Implicit Fluctuation Splitting Scheme for Turbomachinery Flows}, 6128 year = {2005}, 6129 pages = {395-401}, 6130 petsc_uses = {KSP} 6131} 6132 6133@InProceedings{ fettig-sobh-05, 6134 author = {John Fettig and Nahil Sobh and Dmitriy V. Melnikov and Jean-Pierre Leburton}, 6135 title = {High Performance Algorithms for Scalable Spin-Qubit Circuits with Quantum Dots}, 6136 year = {2005}, 6137 booktitle = {Proceedings of the 5th International Conference on Linux Clusters}, 6138 url = {http://www.linuxclustersinstitute.org/Linux-HPC-Revolution/Archive/PDF05/28-Fettig_J.pdf}, 6139 petsc_uses = {KSP} 6140} 6141 6142@TechReport{ melnikov-matagne-05, 6143 author = {Dmitriy V. Melnikov and Philippe Matagne and Jean-Pierre Leburton and D.G. 6144 Austing and G. Yu and S. Tarucha and John Fettig and Nahil Sobh}, 6145 title = {Spin configurations in circular and rectangular vertical quantum dots in a 6146 magnetic field: Three-dimensional self-consistent simulation}, 6147 year = {2005}, 6148 number = {Arxiv preprint cond-mat/0506585}, 6149 url = {http://arxiv.org/pdf/cond-mat/0506585}, 6150 petsc_uses = {KSP} 6151} 6152 6153@InProceedings{ richard-smedley-03, 6154 author = {Richard P. Smedley-Stevenson}, 6155 title = {PARALLEL THERMAL RADIATION TRANSPORT IN TWO DIMENSIONS}, 6156 year = {2003}, 6157 booktitle = {18th International Conference on Transport Theory (18 ICTT)}, 6158 url = {http://www.iprj.uerj.br/\~{ }ricardob/Evento_Cientifico_html/poster03j.pdf}, 6159 petsc_uses = {KSP} 6160} 6161 6162@Article{ guan-godoy-ravaioli-03, 6163 author = {D. Guan and A. Godoy and U. Ravaioli and F. Gamiz}, 6164 journal = {Journal of Computational Electronics}, 6165 volume = {2}, 6166 title = {Comparison Between Non-Equilibrium Green's Function and Monte Carlo Simulations 6167 for Transport in a Silicon Quantum Wire Structure}, 6168 year = {2003}, 6169 pages = {335--339}, 6170 petsc_uses = {KSP} 6171} 6172 6173@Article{ ovtchinnikovcai04, 6174 author = {S. Ovtchinnikov and X.-C. Cai}, 6175 journal = {Numer. Lin. Alg. Applics}, 6176 volume = {11}, 6177 title = {One-level Newton-Krylov-Schwarz algorithm for unsteady nonlinear radiation 6178 diffusion problem}, 6179 year = {2004}, 6180 pages = {867--881}, 6181 petsc_uses = {KSP} 6182} 6183 6184@Article{ mixedstress, 6185 title = {Floating Solids: Combining Phase Field and Fluid-Structure Interactions}, 6186 author = {Adam Powell and David Dussault}, 6187 journal = {Appl. Numer. Anal. Comp. Math.}, 6188 volume = {2}, 6189 number = {1}, 6190 year = {2005}, 6191 pages = {157--166}, 6192 petsc_uses = {KSP} 6193} 6194 6195@Article{ dhh2005, 6196 author = {G. Deli\'ege and F. Henrotte and K. Hameyer}, 6197 title = {Accuracy analysis of the thrust force in 2D-3D finite element models}, 6198 journal = {International Journal for Computation and Mathematics in Electrical and 6199 Electronic Engineering (COMPEL)}, 6200 year = {2005}, 6201 petsc_uses = {KSP} 6202} 6203 6204@Article{ dhh2004, 6205 author = {G. Deli\'ege and F. Henrotte and W. Deprez and K. Hameyer}, 6206 title = {Finite element modelling of ion convection by electrostatic forces}, 6207 journal = {IEE Proceedings Science, Measurement and Technology}, 6208 year = {2004}, 6209 volume = {151}, 6210 number = {6}, 6211 petsc_uses = {KSP} 6212} 6213 6214@Article{ adams-07b, 6215 author = {Adams M.F.}, 6216 title = {Algebraic Multigrid Techniques for Strongly Indefinite Linear Systems from Direct 6217 Frequency Response Analysis in Solid Mechanics}, 6218 journal = {Computional Mechanics}, 6219 year = {2007}, 6220 volume = {39}, 6221 number = {4}, 6222 pages = {497-507}, 6223 petsc_uses = {KSP} 6224} 6225 6226@InProceedings{ wc2004, 6227 author = {A. Wheelock and D. Cooke}, 6228 title = {Computational Modeling of Ion Beam-Neutralizer Interactions in Two and Three 6229 Dimensions}, 6230 year = {2004}, 6231 booktitle = {40th AIAA/ASME/SAE/ASEE Joint Propulsion Conference and Exhibit}, 6232 url = {http://www.aiaa.org/content.cfm?pageid=406&gTable=Paper&gID=19282}, 6233 petsc_uses = {KSP} 6234} 6235 6236@InProceedings{ allard-gouranton-ipts2002, 6237 author = {Jeremie Allard and Valerie Gouranton and Emmanuel Melin and Bruno Raffin}, 6238 title = {Parallelizing Pre-rendering Computations on a Net Juggler PC Cluster}, 6239 year = {2002}, 6240 booktitle = {Immersive Projection Technology Symposium}, 6241 url = {http://www-id.imag.fr/\~{ }allardj/files/ipts2002.pdf}, 6242 petsc_uses = {KSP} 6243} 6244 6245@Article{ icc, 6246 author = {D Ioan and G Ciuprina and C Ciobotaru}, 6247 title = {Hybrid and concurrent algorithms for nonlinear magnetic field problems}, 6248 journal = {IEEE Transactions on Magnetics}, 6249 year = {2000}, 6250 url = {http://ieeexplore.ieee.org/Xplore/login.jsp?url=/iel5/20/19005/00877735.pdf}, 6251 petsc_uses = {KSP} 6252} 6253 6254@InProceedings{ hs1, 6255 author = {Brian J. Henz and Dale R. Shires}, 6256 title = {Development and Performance Analysis of a Parallel Finite Element Application 6257 Implemented in an Object-Oriented Programming Framework}, 6258 year = {2003}, 6259 booktitle = {PDPTA 2003}, 6260 pages = {1286-1292}, 6261 note = {Resin Transfer Modeling}, 6262 petsc_uses = {KSP} 6263} 6264 6265@TechReport{ b2000, 6266 author = {Rickard Bergstrom}, 6267 title = {Least-Squares Finite Element Methods for Electromagnetic Applications}, 6268 year = {2000}, 6269 institution = {Chalmers}, 6270 number = {2000-05}, 6271 url = {http://www.phi.chalmers.se/pub/preprints/ps/phiprint-2000-05.ps}, 6272 petsc_uses = {KSP} 6273} 6274 6275@Article{ fs2004, 6276 author = {Petri Fast and Michael J. Shelley}, 6277 title = {A Moving Overset Grid Method for Interface Dynamics Applied to Non-Newtonian Hele 6278 Shaw Flow}, 6279 journal = {Journal of Computational Physics}, 6280 year = {2004}, 6281 volume = {195}, 6282 url = {http://www.math.nyu.edu/faculty/shelley/papers/FS2004.pdf}, 6283 pages = {117-142}, 6284 petsc_uses = {KSP} 6285} 6286 6287@MastersThesis{ wallach, 6288 author = {Hanna Wallach}, 6289 title = {Efficient Training of Conditional Random Fields}, 6290 school = {University of Edinburgh}, 6291 year = {2002}, 6292 url = {http://scholar.google.com/url?sa=U&q=http://www.hcrc.ed.ac.uk/\~{ 6293 }osborne/msc-projects/wallach.ps.gz}, 6294 petsc_uses = {KSP} 6295} 6296 6297@Article{ something, 6298 author = {T Rylander and A Bondeson}, 6299 title = {Stability of explicit-implicit hybrid time-stepping schemes for Maxwells 6300 equations}, 6301 journal = {Journal of Computational Physics}, 6302 year = {2002}, 6303 volume = {179}, 6304 pages = {426-438}, 6305 petsc_uses = {KSP} 6306} 6307 6308@TechReport{ uf1, 6309 author = {Uwe Fabricius}, 6310 title = {Comparison of two implementations of AMG-preconditioned CG considering an 6311 electrostatic problem}, 6312 year = {2004}, 6313 institution = {Friedrich Alexander Universitat Erlangen Nurnberg Germany}, 6314 url = {http://www10.informatik.uni-erlangen.de/de/Publications/TechnicalReports/TechRep04-1.pdf}, 6315 number = {04-1}, 6316 petsc_uses = {KSP} 6317} 6318 6319@InBook{ sg1, 6320 author = {Natalia Seoane and A.J.Garca-Loureiro}, 6321 chapter = {Analysis of Parallel Numerical Libraries to Solve the 3D Electron Continuity 6322 Equation}, 6323 url = {http://www.springerlink.com/app/home/contribution.asp?wasp=h0xlulyhugck3y2gnt2l&referrer=parent&backto=issue,79,112;journal,212,1787;linkingpublicationresults,1:105633,1}, 6324 title = {Lecture Notes in Computer Science}, 6325 publisher = {Springer-Verlag}, 6326 volume = {3037}, 6327 year = {2004}, 6328 petsc_uses = {KSP} 6329} 6330 6331@Article{ nikyilmazgivisheikhipope10, 6332 author = {M. B. Nik and S. L. Yilmaz and P. Givi and M. R. H. Sheikhi and S. B. Pope}, 6333 title = {Simulation of Sandia Flame D Using Velocity-Scalar Filtered Density Function}, 6334 journal = {AIAA Journal}, 6335 volume = {48}, 6336 number = {7}, 6337 pages = {1513--1522}, 6338 year = {2010}, 6339 petsc_uses = {KSP} 6340} 6341 6342@Article{ nikyilmazsheikhigivi10, 6343 author = {Mehdi B. Nik and Server L. Yilmaz and Mohammad Reza H. Sheikhi and Peyman Givi}, 6344 title = {Grid Resolution Effects on VSFMDF/LES}, 6345 journal = {Flow, Turbulence and Combustion}, 6346 doi = {10.1007/s10494-010-9272-5}, 6347 year = {2010}, 6348 petsc_uses = {KSP} 6349} 6350 6351@Article{ idema2013towards, 6352 title = {Towards faster solution of large power flow problems}, 6353 author = {Idema, Reijer and Papaefthymiou, Georgios and Lahaye, Domenico and Vuik, Cornelis 6354 and van der Sluis, Lou}, 6355 journal = {Power Systems, IEEE Transactions on}, 6356 volume = {28}, 6357 number = {4}, 6358 pages = {4918--4925}, 6359 year = {2013}, 6360 publisher = {IEEE}, 6361 petsc_uses = {KSP} 6362} 6363 6364@Article{ 6026245, 6365 author = {Idema, R. and Lahaye, D.J.P. and Vuik, C. and Van der Sluis, L.}, 6366 journal = {Power Systems, IEEE Transactions on}, 6367 title = {Scalable Newton-Krylov Solver for Very Large Power Flow Problems}, 6368 year = {2012}, 6369 month = feb, 6370 volume = {27}, 6371 number = {1}, 6372 pages = {390-396}, 6373 doi = {10.1109/TPWRS.2011.2165860}, 6374 issn = {0885-8950}, 6375 petsc_uses = {KSP} 6376} 6377 6378@Book{ idema2014computational, 6379 title = {Computational Methods in Power System Analysis}, 6380 author = {Idema, Reijer and Lahaye, Domenico JP}, 6381 year = {2014}, 6382 publisher = {Springer}, 6383 petsc_uses = {KSP} 6384} 6385 6386@PhDThesis{ abhyankar2011thesis, 6387 author = {Shrirang Abhyankar}, 6388 title = {Development of an implicitly coupled electromechanical and electromagnetic 6389 transients simulator for power systems}, 6390 school = {Illinois Institute of Technology}, 6391 year = {2011}, 6392 petsc_uses = {KSP} 6393} 6394 6395@InProceedings{ abhyankarhipcna11-1, 6396 author = {Shrirang Abhyankar and Barry Smith and Hong Zhang and A. Flueck}, 6397 title = {Using {PETSc} to develop scalable applications for next-generation power grid}, 6398 year = {2011}, 6399 booktitle = {Proceedings of the 1st International Workshop on High Performance Computing, 6400 Networking and Analytics for the Power Grid}, 6401 url = {http://www.mcs.anl.gov/uploads/cels/papers/P1957-0911.pdf}, 6402 publisher = {ACM}, 6403 petsc_uses = {KSP} 6404} 6405 6406@InProceedings{ abhyankarhipcna11-2, 6407 author = {Shrirang Abhyankar and Alexander Flueck and Xu Zhang and Hong Zhang}, 6408 title = {Development of a parallel three-phase transient stability simulator for power 6409 systems}, 6410 year = {2011}, 6411 booktitle = {Proceedings of the 1st International Workshop on High Performance Computing, 6412 Networking and Analytics for the Power Grid}, 6413 publisher = {ACM}, 6414 petsc_uses = {KSP} 6415} 6416 6417@InProceedings{ abhyankarpesgeneral2012, 6418 author = {Shrirang Abhyankar and A. Flueck}, 6419 title = {An implicitly-coupled solution approach for combined electromechanical and 6420 electromagnetic transients simulation}, 6421 year = {2012}, 6422 booktitle = {Proceedings of the IEEE PES General Meeting}, 6423 publisher = {IEEE}, 6424 petsc_uses = {KSP} 6425} 6426 6427@Article{ idemalahayevuiksluis2012, 6428 author = {Reijer Idema and Domenico Lahaye and Cornelis Vuik and Lou van der Sluis}, 6429 title = {Scalable Newton-Krylov solver for very large Power Flow problems}, 6430 journal = {IEEE Transactions on Power Systems}, 6431 year = {2012}, 6432 volume = {27}, 6433 pages = {390-396}, 6434 petsc_uses = {KSP} 6435} 6436 6437@Article{ korrestzavellasgalinas2013, 6438 author = {George N. Korres and Anastasios Tzavellas and Evangelos Galinas}, 6439 title = {A distributed implementation of multi-area power system state estimation on a 6440 cluster of computers }, 6441 journal = {Electric Power Systems Research }, 6442 volume = {102}, 6443 number = {0}, 6444 pages = {20 - 32}, 6445 year = {2013}, 6446 issn = {0378-7796}, 6447 doi = {10.1016/j.epsr.2013.04.002}, 6448 petsc_uses = {KSP} 6449} 6450 6451% LiteralHTML: <td width="100%" colspan="2"><hr size="4" color="#FF5B5B"> </td> 6452% LiteralHTML:<font color="#FF0000"> 6453% LiteralHTML: Material failure, for example, cracking of steel beams resulting 6454% LiteralHTML: in bridge collapse and corrosion, is a little understood phenomena. Thus simulations 6455% LiteralHTML: are important for prediction and prevention. PETSc has been used 6456% LiteralHTML: in a variety of studies of material failure.</p> 6457% LiteralHTML:</font> 6458% LiteralHTML: 6459@InProceedings{ gray2, 6460 author = {Yuan He and Joshua Gray and Richard Braatz and Richard Alkire}, 6461 title = {Modulized Coupled Simulation of Localized Pit Initiation in Stainless Steel}, 6462 year = {2004}, 6463 booktitle = {American Institute of Chemical Engineers 2004 Annual Meeting}, 6464 petsc_uses = {KSP} 6465} 6466 6467@InProceedings{ gray1, 6468 author = {J. Gray and and C. Homescu and L. Petzold and Richard Alkire}, 6469 title = {Algorithms and Computing Architectures for Solving Differential-Algebraic 6470 Equation Systems Typically Encountered in Models of Corrosion Pit Initiation}, 6471 year = {2003}, 6472 booktitle = {Abstracts of the Electrochemical Society 204th meeting}, 6473 petsc_uses = {KSP} 6474} 6475 6476@InProceedings{ crack2, 6477 author = {Erin Lesulauro and Anthony R. Ingraffea and Gerd Heber and Paul A. Wawrzynek}, 6478 title = {A multiscale modeling approach to crack initiation in metallic polycrystals}, 6479 booktitle = {44th AIAA/ASME/ASCE/AHS/ASC Structures, Structural Dynamics, and Materials 6480 Conference}, 6481 url = {http://md1.csa.com/partners/viewrecord.php?requester=gs&collection=TRD&recid=A0325099AH}, 6482 year = {2003}, 6483 petsc_uses = {KSP} 6484} 6485 6486@TechReport{ hdams1, 6487 author = {Gerd Heber and Andrew J. Dolgert and Maxirn Alt and Karen A. Mazurkiewicz and 6488 Lynd Stringer}, 6489 title = {Fracture Mechanics on the Intel Itanium Architecture}, 6490 year = {2001}, 6491 institution = {Intel Corporation}, 6492 url = {http://cedar.intel.com/media/pdf/scs/cptconitanium.pdf}, 6493 petsc_uses = {KSP} 6494} 6495 6496@InProceedings{ ihwi, 6497 author = {E. Iesulauro and G. Heber and P. A. Wawrzynek and A. R. Ingraffea}, 6498 title = {Modeling of 3D Metallic Polycrystals and Simulation of Crack Initiation}, 6499 booktitle = {International Conference ON Computational Engineering and Sciences}, 6500 year = {2002}, 6501 url = {http://www.cfg.cornell.edu/\~{ }erin/erin/ices02_iesulauro.pdf}, 6502 petsc_uses = {KSP} 6503} 6504 6505@InProceedings{ crack, 6506 author = {Bruce Carter and Chuin-Shan Chen and L. Paul Chew and Nikos Chrisochoides and 6507 Guang R. Gao and Gerd Heber and Antony R. Ingraffea and Roland Krause and Chris 6508 Myers and Demian Nave and Keshav Pingali and Paul Stodghill and Stephen Vavasis 6509 and Paul A. Wawrzynek}, 6510 title = {Parallel FEM Simulation of Crack Propagation}, 6511 booktitle = {Proceedings of Irregular 2000}, 6512 url = {http://www.cs.cornell.edu/stodghil/papers/irregular00.ps}, 6513 year = {2000}, 6514 petsc_uses = {KSP} 6515} 6516 6517@InProceedings{ beaudoin98, 6518 author = {A. J. Beaudoin}, 6519 title = {Use of Polycrystal Plasticity Theory in Assessing Material Performance}, 6520 booktitle = {Simulation of materials processing: Theory, methods, and applications - 6521 Proceedings of the Sixth International Conference, NUMIFORM'98}, 6522 editor = {J. Hu\'etink and F. P. T. Baaijens}, 6523 optvolume = {}, 6524 optnumber = {}, 6525 optseries = {}, 6526 year = {1998}, 6527 optorganization={}, 6528 publisher = {A. A. Balkema Publishers}, 6529 address = {Rotterdam, Netherlands}, 6530 month = jun, 6531 optpages = {}, 6532 petsc_uses = {KSP} 6533} 6534 6535% LiteralHTML: <td width="100%" colspan="2"><hr size="4" color="#FF5B5B"> </td> 6536@TechReport{ defordheld1, 6537 author = {JF DeFord and BL Held}, 6538 title = {RF3P-A New Parallel Driven Frequency Electromagnetic Solver}, 6539 year = {2002}, 6540 institution = {Simulation Technology and Applied Research}, 6541 url = {http://www.staarinc.com/support/papers/aces2002.pdf}, 6542 note = {Discusses their parallel commercial solver that uses PETSc}, 6543 petsc_uses = {KSP} 6544} 6545 6546@PhDThesis{ sande2003, 6547 author = {Hans Vande Sande}, 6548 title = {Modelling and Finite Element Simulation of Non-Linear and Anisotropic 6549 Quasi-Static Electromagnetic Systems}, 6550 school = {Katholieke Universiteit Leuven, Belgium}, 6551 year = {2003}, 6552 petsc_uses = {KSP} 6553} 6554 6555@Article{ sdchh2004, 6556 author = {H. Vande Sande and W. Deprez and J. De Coster and F. Henrotte and K. Hameyer}, 6557 title = {Reducing the Computation Time of Non-Linear Problems by an Adaptive Linear System 6558 Tolerance}, 6559 journal = {IEEE Transactions on Magnetics}, 6560 year = {2004}, 6561 volume = {40}, 6562 pages = {1306--1309}, 6563 petsc_uses = {KSP} 6564} 6565 6566@Article{ holst-lindblom-etal:2004, 6567 author = {Michael Holst and Lee Lindblom and Robert Owen and Harald P. Pfeiffer and Mark A. 6568 Scheel and Lawrence E. Kidder}, 6569 title = {Optimal constraint projection for hyperbolic evolution systems, }, 6570 journal = {Phys. Rev. D}, 6571 year = {2004}, 6572 volume = {70}, 6573 pages = {084017}, 6574 petsc_uses = {KSP} 6575} 6576 6577@Article{ marm2005, 6578 author = {Matthew Anderson and Richard A. Matzner}, 6579 title = {Extended Lifetime in Computational Evolution of Isolated Black Holes}, 6580 journal = {Foundations of Physics}, 6581 volume = {35}, 6582 pages = {1572--9516}, 6583 year = {2005}, 6584 petsc_uses = {KSP} 6585} 6586 6587@Article{ cook-pfeiffer:2004, 6588 author = {Cook, Gregory B. and Pfeiffer, Harald P.}, 6589 title = {Excision boundary conditions for black hole initial data}, 6590 journal = {Phys. Rev. D}, 6591 volume = {70}, 6592 pages = {104016--24}, 6593 year = {2004}, 6594 petsc_uses = {KSP} 6595} 6596 6597@Article{ pfeiffer-kidder-etal:2005, 6598 author = {Harald P. Pfeiffer and Lawrence E. Kidder and Mark A. Scheel and Deirdre 6599 Shoemaker}, 6600 title = {Initial data for {E}instein's equations with superposed gravitational waves}, 6601 journal = {Phys. Rev. D}, 6602 year = {2005}, 6603 volume = {71}, 6604 pages = {024020}, 6605 petsc_uses = {KSP} 6606} 6607 6608@Article{ pfeiffer-kidder-etal:2003, 6609 author = {Pfeiffer, Harald P. and Kidder, Lawrence E. and Scheel, Mark A. and Teukolsky, 6610 Saul A.}, 6611 title = {A multidomain spectral method for solving elliptic equations}, 6612 journal = {CPC}, 6613 year = {2003}, 6614 volume = {152}, 6615 pages = {253--273}, 6616 note = {Solves nonlinear coupled 3-D elliptic equations that arise in general relativity. 6617 For a related online version, see arXiv:gr-qc/0202096}, 6618 petsc_uses = {KSP} 6619} 6620 6621@Article{ pfeiffer-cook-teukolsky:2002, 6622 author = {Pfeiffer, Harald P. and Cook, Gregory B. and Teukolsky, Saul A.}, 6623 title = {Comparing initial-data sets for binary black hole}, 6624 journal = {PRD}, 6625 year = {2002}, 6626 volume = {66}, 6627 pages = {024047}, 6628 note = {for a related online version, seearXiv:gr-qc/0203085}, 6629 petsc_uses = {KSP} 6630} 6631 6632@PhDThesis{ pfeiffer:2003, 6633 author = {Pfeiffer, Harald P.}, 6634 title = {Initial Data for Black Hole Evolutions}, 6635 school = {Cornell University}, 6636 year = {2003}, 6637 petsc_uses = {KSP} 6638} 6639 6640@TechReport{ h1, 6641 author = {Erik Schnetter}, 6642 title = {A fast apparent horizon algorithm}, 6643 year = {2002}, 6644 number = {Arxiv preprint gr-qc/0206003}, 6645 url = {http://arxiv.org/pdf/gr-qc/0206003}, 6646 petsc_uses = {KSP} 6647} 6648 6649@Article{ h2, 6650 author = {Erik Schnetter}, 6651 title = {Finding apparent horizons and other 2-surfaces of constant expansion}, 6652 year = {2003}, 6653 journal = {Class. Quantum Grav.}, 6654 pages = {4719-4737}, 6655 volume = {20}, 6656 url = {http://www.iop.org/EJ/article/0264-9381/20/22/001/cqg3_22_001.pdf}, 6657 petsc_uses = {KSP} 6658} 6659 6660@Article{ adams-03a, 6661 author = {Adams, M.~F.}, 6662 journal = {Numerical Linear Algebra with Applications}, 6663 number = {2-3}, 6664 pages = {141-153}, 6665 title = {Algebraic multigrid methods for constrained linear systems with applications to 6666 contact problems in solid mechanics}, 6667 volume = {11}, 6668 year = {2004}, 6669 petsc_uses = {KSP} 6670} 6671 6672@Article{ vandesande1, 6673 author = {H. Vande Sande and H. De Gersem and F. Henrotte and K. Hameyer}, 6674 journal = {IEEE TRANSACTIONS ON MAGNETICS}, 6675 year = {2003}, 6676 volume = {39}, 6677 pages = {1709--1712}, 6678 title = {Solving Nonlinear Magnetic Problems Using Newton Trust Region Methods}, 6679 petsc_uses = {KSP} 6680} 6681 6682@InProceedings{ vbde1, 6683 author = {Rajesh Rawat and Jennifer P. Spinti and Wing Yee and Philip J. Smith}, 6684 year = {2002}, 6685 title = {Parallelization and Integration of a Large Scale Hydrocarbon Pool Fire in the 6686 Uintah PSE}, 6687 booktitle = {In Proceedings of Ninth Internation Conference on Numerical Combustion - ICNC 6688 2002}, 6689 pages = {49-55}, 6690 url = {http://web.ing.unisannio.it/icnc2002/CP21Turbulent_Combustion-Deflagrations_Jets_&_Fires.pdf}, 6691 note = {Extended abstract}, 6692 petsc_uses = {KSP} 6693} 6694 6695@Unpublished{ ep1, 6696 title = {An Inherently-Parallel Method for Solving Discretized Diffusion Equations}, 6697 author = {Bradley R. Eccleston and Todd S. Palmer}, 6698 institution = {Department of Nuclear Engineering, Oregon State University}, 6699 url = {http://www.physics.orst.edu/\~{ }bertrand/stuff/Year_Two_Report.pdf}, 6700 note = {Funded under the ASCI Level III: Computational Transport Issues for Large-Scale 6701 Parallel Simulations}, 6702 year = {1999}, 6703 petsc_uses = {KSP} 6704} 6705 6706@InProceedings{ teo2007scalable, 6707 title = {A scalable modular convex solver for regularized risk minimization}, 6708 author = {Teo, C.H. and Smola, A. and Vishwanathan, SVN and Le, Q.V.}, 6709 booktitle = {Proceedings of the 13th ACM SIGKDD international conference on Knowledge 6710 discovery and data mining}, 6711 pages = {727--736}, 6712 year = {2007}, 6713 organization = {ACM}, 6714 petsc_uses = {KSP} 6715} 6716 6717@InProceedings{ rm02, 6718 author = {Robert Malouf}, 6719 year = {2002}, 6720 title = {A comparison of algorithms for maximum entropy Parameter estimation}, 6721 booktitle = {In Proceedings of the Sixth Conference on Natural Language Learning 6722 (CoNLL-2002)}, 6723 pages = {49-55}, 6724 url = {http://bulba.sdsu.edu/malouf/papers/conll02.pdf}, 6725 petsc_uses = {KSP} 6726} 6727 6728@Unpublished{ hrv02, 6729 title = {Computing the Lambda Modes of a Nuclear Reactor with {SLEPc} and {PETSc}}, 6730 author = {V. Hernandex and J. E. Roman and V. Vidal}, 6731 note = {Submitted to CMMSE}, 6732 petsc_uses = {KSP} 6733} 6734 6735@Article{ tmh2001, 6736 author = {Manfred Gilli and Evis Kellezi and Giorgio Pauletto}, 6737 journal = {Journal of Economic Dynamics and Control}, 6738 year = {2002}, 6739 volume = {26}, 6740 pages = {1499-1515}, 6741 title = {Solving finite difference schemes arising in trivariate option pricing}, 6742 petsc_uses = {KSP} 6743} 6744 6745@InProceedings{ a2, 6746 author = {C.J.Palansuriya and C-H.Lai and C.S.Ierotheou and K.A.Pericleous and D.E.Keyes}, 6747 title = {Comparison of three algorithms for nonlinear metal cutting problems}, 6748 booktitle = {Proceedings of the 11th International Conference on Domain Decomposition 6749 Methods}, 6750 editor = {C.-H. Lai et al.}, 6751 publisher = {Domain Decomposition Press, Bergen}, 6752 url = {http://www.ddm.org/DD11/Palansuriya.ps.gz}, 6753 year = {1999}, 6754 petsc_uses = {KSP} 6755} 6756 6757@Unpublished{ mmmdcmaa-web-page, 6758 title = {{M}ulti-{M}odel {M}ulti-{D}omain {C}omputational {M}ethods in {A}erodynamics and 6759 {A}coustics {W}eb Page}, 6760 url = {http://www.cs.odu.edu/\~{ }keyes/nsf}, 6761 author = {David E. Keyes}, 6762 institution = {Old Dominion University}, 6763 petsc_uses = {KSP} 6764} 6765 6766@Conference{ liu2010parallelization, 6767 title = {{Parallelization of Thermal Recovery Simulation Based on PETSc}}, 6768 author = {Liu, L. and Xue, W. and Shu, J. and Ma, L.}, 6769 booktitle = {International Symposium on Parallel and Distributed Processing with 6770 Applications}, 6771 pages = {528--535}, 6772 year = {2010}, 6773 organization = {IEEE}, 6774 petsc_uses = {KSP} 6775} 6776 6777@Unpublished{ oil-reservoir-sim-web-page, 6778 title = {{N}ew {G}eneration {F}ramework for {P}etroleum, {R}eservoir {S}imulation}, 6779 url = {http://www.pe.utexas.edu/CPGE/new_generation}, 6780 institution = {University of Texas at Austin and Argonne National Laboratory}, 6781 key = {University of Texas at Austin and Argonne National Laboratory}, 6782 petsc_uses = {KSP} 6783} 6784 6785@Article{ tmh2001b, 6786 author = {V. Thiagarajan and K. Milfeld and KT. Milfeld}, 6787 journal = {IEEE TRANSACTIONS ON MAGNETICS }, 6788 year = {2001}, 6789 volume = {37}, 6790 pages = {143--146}, 6791 title = {Adapting EMAP3D to parallel processing}, 6792 petsc_uses = {KSP} 6793} 6794 6795@Article{ harbury98, 6796 author = {HK Harbury and W Porod}, 6797 journal = {VLSI Design}, 6798 year = {1998}, 6799 volume = {6}, 6800 pages = {47--51}, 6801 title = {Parallel computation for electronic waves in quantum corrals}, 6802 petsc_uses = {KSP} 6803} 6804 6805@Article{ bludszuwei98, 6806 author = {Mark Bludszuweit}, 6807 journal = {Journal of Lightwave Technology}, 6808 year = {1998}, 6809 volume = {16}, 6810 number = {7}, 6811 pages = {1336--42}, 6812 title = {Mixed Finite Element Beam Propagation Method}, 6813 petsc_uses = {KSP} 6814} 6815 6816@Article{ s1, 6817 author = {J. L. Friedman and N. Stergioulas}, 6818 journal = {Astrophysics Journal}, 6819 year = {1998}, 6820 volume = {492}, 6821 number = {301}, 6822 pages = {}, 6823 title = {}, 6824 petsc_uses = {KSP} 6825} 6826 6827@Article{ s1a, 6828 author = {S. M. Morsink and N. Stergioulas and S. Blattnig}, 6829 journal = {Astrophysics Journal}, 6830 year = {1999}, 6831 volume = {510}, 6832 number = {854}, 6833 pages = {}, 6834 title = {}, 6835 petsc_uses = {KSP} 6836} 6837 6838@PhDThesis{ s2, 6839 author = {N. Stergioulas}, 6840 title = {Ph. D. thesis}, 6841 year = {1996}, 6842 institution = {University of Wisconsin-Milwaukee}, 6843 petsc_uses = {KSP} 6844} 6845 6846@InProceedings{ coral1, 6847 author = {L. Kettunen and K. Forsman and D. Levine and W. Gropp}, 6848 title = {Solutions of TEAM Problem \#13 Using Integral Equations in a Sequential and 6849 Parallel Computing Environment}, 6850 booktitle = {Proceedings of the Miami TEAM Workshop}, 6851 location = {Florida International University, Department of Electrical Engineering and 6852 Computing Science}, 6853 month = nov, 6854 year = {1993}, 6855 petsc_uses = {KSP} 6856} 6857 6858@InProceedings{ coral2, 6859 author = {L. Kettunen and K. Forsman and D. Levine and W. Gropp}, 6860 title = {Solutions of TEAM Problems 13 and 20 Using a Volume Integral Formulation}, 6861 booktitle = {Proceedings of Aix-les-Bains TEAM Workshop}, 6862 month = dec, 6863 year = {1994}, 6864 petsc_uses = {KSP} 6865} 6866 6867@InProceedings{ coral3, 6868 author = {L. Kettunen and K. Forsman and D. Levine and W. Gropp}, 6869 title = {Computational Electromagnetics and Parallel Dense Matrix Computations}, 6870 booktitle = {Proceedings of the SIAM Parallel Processing for Scientific Computing Conference}, 6871 location = {Florida International University, Department of Electrical Engineering and 6872 Computing Science}, 6873 year = {1995}, 6874 petsc_uses = {KSP} 6875} 6876 6877@InProceedings{ mijalkovic, 6878 author = {Slobodan Mijalkovi\'{c}}, 6879 title = {Evaluation of Multigrid as a Solver for Stress Analysis Problems in Semiconductor 6880 Process Simulation}, 6881 booktitle = {Multigrid Methods VI: Proceedings of the Sixth European Multigrid Conference Held 6882 Gent, Belgium, September 27--30, 1999.}, 6883 editor = {Erik Dick, Kris Riemslagh, Jan Vierendeels}, 6884 optvolume = {14}, 6885 optseries = {Lecture Notes in Computational Science and Engineering}, 6886 year = {2000}, 6887 publisher = {Springer}, 6888 address = {Berlin}, 6889 optpages = {179--184}, 6890 petsc_uses = {KSP} 6891} 6892 6893@Article{ bludszuwei98a, 6894 author = {Mark Bludszuweit}, 6895 journal = {Journal of Lightwave Technology}, 6896 year = {1998}, 6897 volume = {16}, 6898 number = {7}, 6899 pages = {1336--42}, 6900 title = {Mixed Finite Element Beam Propagation Method}, 6901 petsc_uses = {KSP} 6902} 6903 6904@Article{ gilli-pauletto-1998, 6905 author = {Manfred Gilli and Giorgio Pauletto}, 6906 title = {Parallel {K}rylov Methods for Econometric Model Simulation}, 6907 journal = {Computational Economics}, 6908 year = {2000}, 6909 volume = {16}, 6910 pages = {173--186}, 6911 petsc_uses = {KSP} 6912} 6913 6914% LiteralHTML: 6915% LiteralHTML: <a name="packages"></a><H3><center>Software Packages that use or interface to PETSc</center></H3> 6916% LiteralHTML: 6917@Article{ collierdalcincalo2013, 6918 title = {{PetIGA}: High-Performance Isogeometric Analysis}, 6919 author = {Nathan Collier and Lisandro Dalcin and Victor M. Calo}, 6920 journal = {arxiv}, 6921 year = {2013}, 6922 number = {1305.4452}, 6923 note = {\url{http://arxiv.org/abs/1305.4452}}, 6924 petsc_uses = {KSP} 6925} 6926 6927@Article{ collierdalcinvignalcortescalo2016, 6928 title = {PetIGA: A framework for high-performance isogeometric analysis}, 6929 author = {Lisandro Dalcin and Nathan Collier and Philippe Vignal and AMA C{\^o}rtes and 6930 Victor M. Calo}, 6931 journal = {Computer Methods in Applied Mechanics and Engineering}, 6932 year = {2016}, 6933 petsc_uses = {KSP} 6934} 6935 6936@Misc{ petiga-web-page, 6937 author = {N. Collier and L. Dalcin and V.M. Calo}, 6938 title = {{PetIGA} {W}eb page}, 6939 url = {https://bitbucket.org/dalcinl/petiga/}, 6940 howpublished = {\url{https://bitbucket.org/dalcinl/petiga/}}, 6941 year = {2014}, 6942 petsc_uses = {KSP} 6943} 6944 6945@Article{ logg07, 6946 author = {Logg, Anders}, 6947 title = {Automating the Finite Element Method}, 6948 journal = {Archives of Computational Methods in Engineering}, 6949 volume = {14}, 6950 number = {2}, 6951 pages = {93-138}, 6952 year = {2007}, 6953 doi = {10.1007/s11831-007-9003-9}, 6954 publisher = {Kluwer Academic Publishers}, 6955 issn = {1134-3060}, 6956 language = {English}, 6957 petsc_uses = {KSP} 6958} 6959 6960@Article{ jezequelcouturierdenis12, 6961 author = {Jezequel, Fabienne and Couturier, Rapha\"el and Denis, Christophe}, 6962 title = {Solving large sparse linear systems in a grid environment: the GREMLINS code 6963 versus the PETSc library}, 6964 journal = {The Journal of Supercomputing}, 6965 volume = {59}, 6966 number = {3}, 6967 pages = {1517-1532}, 6968 year = {2012}, 6969 issn = {0920-8542}, 6970 doi = {10.1007/s11227-011-0563-y}, 6971 publisher = {Springer US}, 6972 keywords = {Asynchronous iterations; Grid computing; Iterative method; Multisplitting method; 6973 Sparse linear solver}, 6974 language = {English}, 6975 petsc_uses = {KSP} 6976} 6977 6978@Unpublished{ feap-web-page, 6979 title = {FEAP: A Finite Element Analysis Program}, 6980 url = {http://www.ce.berkeley.edu/projects/feap/}, 6981 author = {FEAP Team}, 6982 note = {Uses PETSc linear solvers - iterative and direct}, 6983 petsc_uses = {KSP} 6984} 6985 6986@Unpublished{ parpre-web-page, 6987 title = {{ParPre} {W}eb {P}age}, 6988 url = {http://www.cs.utk.edu/\~{ }eijkhout/parpre.html}, 6989 institution = {University of Tennessee}, 6990 author = {Victor Eijkhout}, 6991 note = {This is no longer supported. A set of preconditioners built on PETSc}, 6992 petsc_uses = {KSP} 6993} 6994 6995@Unpublished{ pism, 6996 title = {{PISM}: a Parallel Ice Sheet Model}, 6997 author = {{PISM Team}}, 6998 abstract = {We have developed a numerical model of ice sheets called PISM (a Parallel Ice 6999 Sheet Model). The thickness, temperature, velocity and age of the ice are all 7000 simulated, as is the deformation of the earth underneath the ice. New techniques 7001 for fast ice dynamics, earth deformation, and verification have are included.}, 7002 note = {\url{http://www.pism-docs.org/}}, 7003 petsc_uses = {KSP} 7004} 7005 7006@Unpublished{ oofem, 7007 title = {OOFEM - an object oriented finite element package}, 7008 author = {Borek Patzak}, 7009 url = {http://www.oofem.org}, 7010 petsc_uses = {KSP} 7011} 7012 7013@Unpublished{ dks2openfvm, 7014 title = {OpenFVM - a finite volume based general purpose CFD solver}, 7015 author = {Open source development}, 7016 url = {http://openfvm.sourceforge.net/}, 7017 petsc_uses = {KSP} 7018} 7019 7020@Unpublished{ sundar-2008w, 7021 title = {DENDRO: a parallel geometric multigrid library for trilinear finite elements on 7022 octree meshes}, 7023 author = {H. Sundar and R.S. Sampath and S.S. Adavani and C. Davatzikos and G. Biros}, 7024 institution = {University of Pennsylvania}, 7025 url = {http://www.seas.upenn.edu/~csela/dendro/html/index.html}, 7026 petsc_uses = {KSP} 7027} 7028 7029@Unpublished{ khatiwala07-software, 7030 title = {A computational framework for simulation of biogeochemical tracers in the ocean}, 7031 author = {Khatiwala, S.}, 7032 institution = {Columbia University}, 7033 url = {http://www.ldeo.columbia.edu/\~{ }spk}, 7034 petsc_uses = {KSP} 7035} 7036 7037@InBook{ jiaolima99, 7038 author = {Xiangmin Jiao and Xiang-Yang Li and Xiaosong Ma}, 7039 chapter = {SIFFEA:Scalable Integrated Framework for Finite Element Analysis}, 7040 url = {http://portal.acm.org/citation.cfm?id=646895.709725}, 7041 title = {Lecture Notes in Computer Science}, 7042 publisher = {Springer-Verlag}, 7043 volume = {1732}, 7044 year = {1999}, 7045 petsc_uses = {KSP} 7046} 7047 7048@Article{ crow1, 7049 author = {C. S. Crow IV}, 7050 title = {DistSolve: An Open Source Web Service for Solving Sparse Systems of Equations}, 7051 journal = {Hopkins Undergraduate Research Journal}, 7052 year = {2003}, 7053 url = {http://www.jhu.edu/hurj/issue2/09D%20Crow%20DistSolve.pdf}, 7054 petsc_uses = {KSP} 7055} 7056 7057@Unpublished{ petsc-python, 7058 title = {PETSc for Python}, 7059 author = {L. Dalcin}, 7060 url = {https://petsc.org/main/petsc4py}, 7061 note = {Provides Python bindings for PETSc}, 7062} 7063 7064@Unpublished{ cfdship, 7065 title = {{CFDShip-Iowa}}, 7066 author = {Pablo M. Carrica and Robert V. Wilson and Fred Stern}, 7067 institution = {University of Iowa}, 7068 url = {http://www.iihr.uiowa.edu/\~{ }cfdship/}, 7069 note = {CFDShip-Iowa is a multiblock free surface flow solver that uses overset 7070 structured grids, designed for ship applications}, 7071 petsc_uses = {KSP} 7072} 7073 7074@Unpublished{ bvw, 7075 title = {Multiflow}, 7076 author = {Berend van Wachem}, 7077 institution = {Mechanical Engineering - Chalmers University of Technology}, 7078 url = {http://www.tfd.chalmers.se/\~{ }berend/page3.html}, 7079 note = {MultiFlow is a curvlinear, multiblock, multiprocessor flowsolver for multiphase 7080 flows.}, 7081 petsc_uses = {KSP} 7082} 7083 7084@Unpublished{ dks2, 7085 title = {FENA - A Finite Element Model for the North Atlantic}, 7086 author = {Jens Schroeter}, 7087 institution = {Alfred-Wegener-Institute for Polar and Marine Research}, 7088 url = {http://www.awi-bremerhaven.de/Modelling/INVERSE/FENAdesc/FENAdesc.html}, 7089 petsc_uses = {KSP} 7090} 7091 7092@TechReport{ piwonski2010idea, 7093 title = {The Idea and Concept of {Metos3D}: {A} Marine Ecosystem Toolkit for Optimization 7094 and Simulation in {3-D}}, 7095 author = {Piwonski, J. and Slawig, T.}, 7096 year = {2010}, 7097 institution = {Christian-Albrechts-Universit\"at zu Kiel}, 7098 url = {http://www.informatik.uni-kiel.de/uploads/tx_publication/tr_1016_01.pdf}, 7099 petsc_uses = {KSP} 7100} 7101 7102@Unpublished{ metos3d-web, 7103 title = {{Metos3D}: {A} Marine Ecosystem Toolkit for Optimization and Simulation in 3-D}, 7104 author = {Piwonski, J. and Slawig, T.}, 7105 institution = {Christian-Albrechts-Universit\"at zu Kiel}, 7106 url = {http://www.informatik.uni-kiel.de/en/algorithmic-optimal-control/software/metos3d/}, 7107 petsc_uses = {KSP} 7108} 7109 7110@Unpublished{ magpar, 7111 author = {W. Scholz}, 7112 title = {Magpar: Parallel Micromagnetics Code}, 7113 institution = {Vienna University of Technology}, 7114 url = {http://magnet.atp.tuwien.ac.at/scholz/magpar/}, 7115 petsc_uses = {KSP} 7116} 7117 7118@Misc{ libmesh:sourceforge, 7119 author = {}, 7120 title = {{libMesh}:a C++ framework for the numerical simulation of partial differential 7121 equations on serial and parallel platforms}, 7122 note = {[Online]}, 7123 url = {http://libmesh.github.io}, 7124 petsc_uses = {KSP} 7125} 7126 7127@Misc{ moose-web-page, 7128 title = {Multiphysics {O}bject-{O}riented {S}imulation {E}nvironment ({MOOSE})}, 7129 author = {David Andrs and Cody Permann and Andrew Slaughter and Richard Martineau and Derek 7130 Gaston and John Peterson and Jason Miller}, 7131 institution = {Idaho National Laboratory}, 7132 howpublished = {\url{http://mooseframework.org}}, 7133 petsc_uses = {KSP} 7134} 7135 7136@Article{ gaston2009moose, 7137 title = {MOOSE: {A} parallel computational framework for coupled systems of nonlinear 7138 equations}, 7139 author = {Gaston, D. and Newman, C. and Hansen, G. and Lebrun-Grandi{\'e}, D.}, 7140 journal = {Nuclear Engineering and Design}, 7141 volume = {239}, 7142 number = {10}, 7143 pages = {1768--1778}, 7144 year = {2009}, 7145 publisher = {Elsevier}, 7146 petsc_uses = {KSP} 7147} 7148 7149@Article{ tonks2012object, 7150 title = {An object-oriented finite element framework for multiphysics phase field 7151 simulations}, 7152 author = {Tonks, M.R. and Gaston, D. and Millett, P.C. and Andrs, D. and Talbot, P.}, 7153 journal = {Computational Materials Science}, 7154 volume = {51}, 7155 number = {1}, 7156 pages = {20--29}, 7157 year = {2012}, 7158 publisher = {Elsevier}, 7159 petsc_uses = {KSP} 7160} 7161 7162@Misc{ pylithmanual, 7163 author = {Brad Aagaard and Sue Kientz and Matthew G. Knepley and Surendra Somala and Leif 7164 Strand and Charles Williams}, 7165 title = {{PyLith} User Manual Version 2.0.0}, 7166 year = {2014}, 7167 url = {http://geodynamics.org/cig/software/github/pylith/v2.0.0/pylith-2.0.0_manual.pdf}, 7168 petsc_uses = {KSP} 7169} 7170 7171@Misc{ pylith-web-page, 7172 author = {Brad Aagaard and Matthew G. Knepley and Charles Williams}, 7173 title = {{PyLith}}, 7174 year = {2012}, 7175 url = {http://geodynamics.org/resources/pylith/}, 7176 howpublished = {\url{http://geodynamics.org/resources/pylith/}}, 7177 petsc_uses = {KSP} 7178} 7179 7180@Misc{ galemanual, 7181 author = {Walter Landry and Luke Hodkinson and Susan Kientz}, 7182 title = {Gale User Manual Version 2.0.0}, 7183 year = {2011}, 7184 url = {http://geodynamics.org/cig/software/gale/gale.pdf}, 7185 petsc_uses = {KSP} 7186} 7187 7188@Unpublished{ underworld, 7189 author = {Louis Moresi}, 7190 title = {{UnderWorld}: A Geodynamics Modelling Code}, 7191 institution = {Monash University}, 7192 url = {http://www.mcc.monash.edu/twiki/view/Codes}, 7193 petsc_uses = {KSP} 7194} 7195 7196@Article{ moresi2007computational, 7197 title = {Computational approaches to studying non-linear dynamics of the crust and 7198 mantle}, 7199 author = {Moresi, L. and Quenette, S. and Lemiale, V. and Meriaux, C. and Appelbe, B. and 7200 M{\"u}hlhaus, H.B.}, 7201 journal = {Physics of the Earth and Planetary Interiors}, 7202 volume = {163}, 7203 number = {1-4}, 7204 pages = {69--82}, 7205 year = {2007}, 7206 publisher = {Elsevier}, 7207 petsc_uses = {KSP} 7208} 7209 7210@Article{ pitt2009chaste, 7211 title = {Chaste: a test-driven approach to software development for biological modelling}, 7212 author = {Pitt-Francis, J. and Pathmanathan, P. and Bernabeu, M.O. and Bordas, R. and 7213 Cooper, J. and Fletcher, A.G. and Mirams, G.R. and Murray, P. and Osborne, J.M. 7214 and Walter, A. and others}, 7215 journal = {Computer Physics Communications}, 7216 volume = {180}, 7217 number = {12}, 7218 pages = {2452--2471}, 7219 year = {2009}, 7220 publisher = {Elsevier}, 7221 petsc_uses = {KSP} 7222} 7223 7224@Misc{ fenicsproject, 7225 title = {{The FEniCS project}}, 7226 author = {Logg, A. and {\O}lgaard, K. and Rognes, M.E. and Wells, G.N. and Jansson, J. and 7227 Kirby, R.C. and Knepley, M.G. and Lindbo, D. and Skavhaug, O.}, 7228 note = {A continually updated technical report. \url{http://fenicsproject.org}}, 7229 url = {http://fenicsproject.org}, 7230 year = {2011}, 7231 petsc_uses = {KSP} 7232} 7233 7234@Unpublished{ snark, 7235 title = {Snark: A suite of software for geoscientific applications and a philosophy of 7236 scientific software development}, 7237 institution = {Victorian Partnership for Advanced Computing}, 7238 url = {http://vpac.org/Snark}, 7239 petsc_uses = {KSP} 7240} 7241 7242@Misc{ imoose:sourceforge, 7243 author = {Guido Arians and Thomas Bauer and Christian Kaehler and Wolfgang Mai and 7244 Christoph Monzel and Dirk {van Riesen} and Christoph Schlensok}, 7245 title = {Innovative Modern Object-Oriented Solving Environment - {iMOOSE}}, 7246 note = {[Online]}, 7247 url = {http://imoose.sourceforge.net}, 7248 petsc_uses = {KSP} 7249} 7250 7251@Unpublished{ fossi, 7252 author = {Stephan Frickenhaus}, 7253 title = {FoSSI: Family of Simplified Solver Interfaces, offers scalable access to 7254 MPI-parallel solvers from CSR-matrix format frequently used in sequential/vector 7255 codes}, 7256 institution = {AWI-Bremerhaven, Germanny}, 7257 url = {http://www.awi.de/en/research/scientific_computing/research_topics_of_scientific_computing/fossi/}, 7258 petsc_uses = {KSP} 7259} 7260 7261@Unpublished{ fun3dweb, 7262 author = {Dinesh Kaushik}, 7263 title = {PETSC-FUN3D Benchmark Page}, 7264 institution = {ODU/ANL}, 7265 url = {http://www.mcs.anl.gov/petsc-fun3d}, 7266 note = {CFD Benchmark of some solvers in PETSc}, 7267 petsc_uses = {KSP} 7268} 7269 7270@Unpublished{ scirun, 7271 author = {SCIRun Development Team}, 7272 title = {SCIRun}, 7273 institution = {University of Utah}, 7274 url = {http://www.sci.utah.edu/stories/2001/jul_scirun120.html}, 7275 note = {SCIRun now uses PETSc linear solvers}, 7276 petsc_uses = {KSP} 7277} 7278 7279@Misc{ prometheus, 7280 author = {Mark F. Adams}, 7281 title = {Prometheus - A scalable unstructured finite element solver}, 7282 institution = {Berkeley}, 7283 howpublished = {\url{http://www.cs.berkeley.edu/~madams/prometheus}}, 7284 url = {http://www.cs.berkeley.edu/\~{ }madams/prometheus}, 7285 petsc_uses = {KSP} 7286} 7287 7288@Unpublished{ illuminator, 7289 author = {Adam C. Powell, IV}, 7290 title = {Illuminator Distributed Visualization Library}, 7291 url = {http://lyre.mit.edu/\~{ }powell/Illuminator.html}, 7292 petsc_uses = {KSP} 7293} 7294 7295@Unpublished{ rheoplast, 7296 title = {RheoPlast Phase Field Multi-Physics Code}, 7297 author = {Adam Powell and David Dussault and Bo Zhou}, 7298 url = {http://lyre.mit.edu/\~{ }powell/rheoplast.html}, 7299 petsc_uses = {KSP} 7300} 7301 7302@Misc{ tao-web-page, 7303 title = {{Toolkit for Advanced Optimization (TAO)} {W}eb Page}, 7304 author = {Alp Dener and Adam Denchfield and Todd Munson and Jason Sarich and Stefan Wild 7305 and Steve Benson and Lois Curfman McInnes and Jorge Mor{\'e}}, 7306 institution = {Mathematics and Computer Science Division, Argonne National Laboratory}, 7307 howpublished = {\url{http://www.mcs.anl.gov/tao}}, 7308 petsc_uses = {KSP} 7309} 7310 7311@TechReport{ tao-user-ref, 7312 title = {{Toolkit for Advanced Optimization (TAO) users manual}}, 7313 author = {Alp Dener and Adam Denchfield and Todd Munson and Jason Sarich and Stefan Wild 7314 and Steve Benson and Lois Curfman McInnes}, 7315 institution = {Argonne National Laboratory}, 7316 year = {2019}, 7317 number = {ANL/MCS-TM-322 - Rev 3.12}, 7318 petsc_uses = {KSP} 7319} 7320 7321% url = "http://www.mcs.anl.gov/tao", 7322@Unpublished{ mefpp-web-page, 7323 title = {{MEF++} {W}eb {P}age}, 7324 url = {http://www.giref.ulaval.ca/ressources/projets/mefpp.html}, 7325 institution = {Groupe Interdisiplinaire de Recherche en Elements Finis}, 7326 author = {Eric Chamberland}, 7327 note = {A finite element code for fluid dynamics, solid mechanics, thermal and 7328 multiphysics}, 7329 petsc_uses = {KSP} 7330} 7331 7332@Unpublished{ tipetsc-titanium, 7333 title = {Ti-PETSc - an interface to PETSc from Titanium}, 7334 institution = {Berkeley}, 7335 author = {He, Yun and Liblit, Bun and Lin, Chang}, 7336 url = {https://citeseerx.ist.psu.edu/document?repid=rep1&type=pdf&doi=9f7959be13337c735d52e5c0b0994bdea6d75a96}, 7337 year = {1999}, 7338 petsc_uses = {KSP}, 7339} 7340 7341@Unpublished{ ptatin-web-page, 7342 title = {ptatin3d}, 7343 author = {Jed Brown and Laetitia {Le Pourhiet} and Dave A. May and Patrick Sanan}, 7344 url = {https://bitbucket.org/jedbrown/ptatin3d}, 7345 year = {2018}, 7346 petsc_uses = {KSP} 7347} 7348 7349@Misc{ multiphase-web-page, 7350 author = {Q. Zou}, 7351 title = {Multiphase flow with {PETSc}}, 7352 institution = {LANL}, 7353 howpublished = {\url{http://cnls-www.lanl.gov/~qzou}}, 7354 url = {http://cnls-www.lanl.gov/\~{ }qzou}, 7355 lab = {LANL}, 7356 petsc_uses = {KSP} 7357} 7358 7359@Misc{ electromag-web-page, 7360 title = {{EMSolve Web} page}, 7361 institution = {LLNL}, 7362 howpublished = {http://www.llnl.gov/casc/emsolve}, 7363 url = {http://www.Llnl.gov/casc/emsolve}, 7364 author = {Daniel {White et al.}}, 7365 lab = {LLNL}, 7366 petsc_uses = {KSP} 7367} 7368 7369@Unpublished{ fe-software-web-page, 7370 institution = {Kuleuven}, 7371 title = {Finite element software}, 7372 url = {http://www.esat.kuleuven.ac.be/elen/research/software-development}, 7373 petsc_uses = {KSP} 7374} 7375 7376@Misc{ petsc-web-page, 7377 author = {Satish Balay and Shrirang Abhyankar and Mark~F. Adams and Steven Benson and Jed 7378 Brown and Peter Brune and Kris Buschelman and Emil~M. Constantinescu and Lisandro 7379 Dalcin and Alp Dener and Victor Eijkhout and Jacob Faibussowitsch and William~D. 7380 Gropp and V\'{a}clav Hapla and Tobin Isaac and Pierre Jolivet and Dmitry Karpeev 7381 and Dinesh Kaushik and Matthew~G. Knepley and Fande Kong and Scott Kruger and 7382 Dave~A. May and Lois Curfman McInnes and Richard Tran Mills and Lawrence Mitchell 7383 and Todd Munson and Jose~E. Roman and Karl Rupp and Patrick Sanan and Jason Sarich 7384 and Barry~F. Smith and Stefano Zampini and Hong Zhang and Hong Zhang and Junchao 7385 Zhang}, 7386 title = {{PETS}c {W}eb page}, 7387 url = {https://petsc.org/}, 7388 howpublished = {\url{https://petsc.org/}}, 7389 year = {2023} 7390} 7391 7392@Unpublished{ petsc-debian-package, 7393 author = {Adam C. Powell, IV}, 7394 title = {Debian package for PETSc}, 7395 url = {http://lyre.mit.edu/\~{ }powell/petsc.html}, 7396 petsc_uses = {KSP} 7397} 7398 7399@Unpublished{ cactus, 7400 title = {Cactus Website}, 7401 url = {http://www.cactuscode.org/}, 7402 note = {Provides two interface to the PETSc solvers}, 7403 petsc_uses = {KSP} 7404} 7405 7406@Unpublished{ petsc-fem, 7407 author = {Mario Storti and Norberto Nigro}, 7408 title = {PETSc-FEM: A General Purpose, Parallel, Multi-Physics FEM Program}, 7409 institution = {Centro Internacional de Metodos Computacionales en Ingenieria (CIMEC)}, 7410 url = {http://www.cimec.org.ar/petscfem}, 7411 petsc_uses = {KSP} 7412} 7413 7414@Misc{ fidap, 7415 title = {FIDAP 8.5}, 7416 howpublished = {\url{http://www.fluent.com}}, 7417 url = {http://www.fluent.com}, 7418 note = {Fluent's commercial finite element fluid code uses PETSc for parallel linear 7419 solves.}, 7420 key = {FIDAP 8.5}, 7421 petsc_uses = {KSP} 7422} 7423 7424@Unpublished{ slepc, 7425 author = {Carmen Campos and Jos\'e E. Rom\'an and Eloy Romero and Andr\'es Tom\'as and 7426 Vicente Hern\'andez and Vicent Vidal}, 7427 title = {{SLEPc} Website}, 7428 url = {http://slepc.upv.es/}, 7429 note = {Scalable Library for Eigenvalue Problem Computations}, 7430 petsc_uses = {KSP} 7431} 7432 7433@TechReport{ slepc-users-manual, 7434 author = {Carmen Campos and Jos\'e E. Rom\'an and Eloy Romero and Andr\'es Tom\'as and 7435 Vicente Hern\'andez and Vicent Vidal}, 7436 title = {{SLEPc} Users Manual}, 7437 number = {DISC-II/24/02}, 7438 url = {http://slepc.upv.es/}, 7439 note = {Scalable Library for Eigenvalue Problem Computations}, 7440 petsc_uses = {KSP} 7441} 7442 7443@Misc{ deal.ii, 7444 title = {deal.II}, 7445 howpublished = {\url{http://www.dealii.org}}, 7446 url = {http://www.dealii.org}, 7447 note = {deal.II is a C++ library targeting adaptive finite elements and error estimation. 7448 It allows PETSc linear algebra and solvers to be used underneath.}, 7449 key = {deal.II 5.0}, 7450 petsc_uses = {KSP} 7451} 7452 7453@Article{ bangerth2007deal, 7454 title = {{deal.II---A general-purpose object-oriented finite element library}}, 7455 author = {Bangerth, W. and Hartmann, R. and Kanschat, G.}, 7456 journal = {ACM Transactions on Mathematical Software (TOMS)}, 7457 volume = {33}, 7458 number = {4}, 7459 pages = {24--es}, 7460 issn = {0098-3500}, 7461 year = {2007}, 7462 publisher = {ACM}, 7463 petsc_uses = {KSP} 7464} 7465 7466@Misc{ globalarrays, 7467 author = {Jarek {Nieplocha et al.}}, 7468 title = {Global Arrays}, 7469 institution = {Pacific Northwest National Laboratories}, 7470 howpublished = {\url{http://www.emsl.pnl.gov/docs/global}}, 7471 url = {http://www.emsl.pnl.gov/docs/global}, 7472 note = {Global arrays can use PETSc linear solvers}, 7473 lab = {PNNL}, 7474 petsc_uses = {KSP} 7475} 7476 7477% LiteralHTML: 7478% LiteralHTML: <a name="software"><H3><center>Software Engineering</center></H3> 7479% LiteralHTML: 7480@Article{ petsccommunity2022, 7481 title = {The Community is the Infrastructure: A Short Discussion of the {PETSc} User 7482 Community}, 7483 author = {Mark Adams and Satish Balay and Jed Brown and Victor Eijkhout and Jacob 7484 Faibussowitsch and Fande Kong and Matthew Knepley and Scott Kruger and Oana Marin 7485 and Richard Mills and Todd Munson and Patrick Sanan and Barry Smith and Hong Zhang 7486 and Hong Zhang and Junchao Zhang}, 7487 journal = {Computing in Science and Engineering}, 7488 volume = {24}, 7489 number = {03}, 7490 pages = {6--15}, 7491 issn = {1558-366X}, 7492 doi = {10.1109/MCSE.2022.3169974}, 7493 publisher = {IEEE Computer Society}, 7494 address = {Los Alamitos, CA, USA}, 7495 month = may, 7496 year = {2022}, 7497 url = {https://figshare.com/articles/conference_contribution/The_Community_is_the_Infrastructure_A_Short_Discussion_of_the_PETSc_User_Community/16523043}, 7498 petsc_uses = {KSP} 7499} 7500 7501@Article{ brownknepleysmith14, 7502 author = {Jed Brown and Matthew G. Knepley and Barry Smith}, 7503 title = {Run-time extensibility and librarization of simulation software}, 7504 journal = {IEEE Computing in Science and Engineering}, 7505 month = jan, 7506 volume = {17}, 7507 number = {1}, 7508 pages = {38--45}, 7509 doi = {10.1109/MCSE.2014.95}, 7510 year = {2015}, 7511 petsc_uses = {KSP} 7512} 7513 7514@TechReport{ ass2012, 7515 author = {Shrirang Abhyankar and Barry Smith and Kerry Stevens}, 7516 title = {Preliminary implementation of Hybrid {MPI}/pthread programming model in {PETSc}}, 7517 institution = {Argonne National Laboratory}, 7518 type = {Preprint}, 7519 year = {2012}, 7520 number = {ANL/MCS-P2011-0112}, 7521 petsc_uses = {KSP} 7522} 7523 7524@TechReport{ clearyknepley99, 7525 author = {Andrew Cleary and Matthew G. Knepley}, 7526 title = {Solvers as Operators}, 7527 institution = {Lawrence Livermore National Laboratory}, 7528 type = {Technical Report}, 7529 number = {UCRL-ID-135342}, 7530 year = {1999}, 7531 petsc_uses = {KSP} 7532} 7533 7534@TechReport{ smcabbkz2012, 7535 author = {Barry Smith and Lois Curfman McInnes and Emil Constantinescu and Mark Adams and 7536 Satish Balay and Jed Brown and Matthew Knepley and Hong Zhang}, 7537 title = {{PETSc's} software strategy for the design space of composable extreme-scale 7538 solvers}, 7539 institution = {Argonne National Laboratory}, 7540 type = {Preprint}, 7541 note = {{DOE} Exascale Research Conference, April 16-18, 2012, Portland, OR}, 7542 year = {2012}, 7543 number = {ANL/MCS-P2059-0312}, 7544 petsc_uses = {KSP} 7545} 7546 7547@InProceedings{ mhwpmhs2009, 7548 author = {R. T. Mills and F. M. Hoffman and P. H. Worley and K. S. Pwerumalla and A. Mirin 7549 and G. E. Hammond and B. Smith}, 7550 title = {Coping at the User-Level with Resource Limitations in the {Cray} Message Passing 7551 Toolkit {MPI} at Scale}, 7552 booktitle = {Cray Users Group Conference}, 7553 year = {2009}, 7554 petsc_uses = {KSP} 7555} 7556 7557@InProceedings{ msmhls2010, 7558 author = {R. T. Mills and V. Sripathi and G. Mahinthakumar and G. Hammond and P. C. 7559 Lichtner and B. F. Smith}, 7560 title = {Engineering {PFLOTRAN} for Scalable Performance on {Cray} {XT} and {IBM} 7561 {BlueGene} Architectures}, 7562 booktitle = {Proceedings of SciDAC 2010 Annual Meeting}, 7563 year = {2010}, 7564 petsc_uses = {KSP} 7565} 7566 7567@InCollection{ msk2013, 7568 author = {Victor Minden and Barry F. Smith and Matthew G. Knepley}, 7569 title = {Preliminary Implementation of {PETSc} Using {GPUs}}, 7570 booktitle = {GPU Solutions to Multi-scale Problems in Science and Engineering}, 7571 series = {Lecture Notes in Earth System Sciences}, 7572 editor = {David A. Yuen and Long Wang and Xuebin Chi and Lennart Johnsson and Wei Ge and 7573 Yaolin Shi}, 7574 doi = {10.1007/978-3-642-16405-7_7}, 7575 publisher = {Springer Berlin Heidelberg}, 7576 pages = {131--140}, 7577 year = {2013}, 7578 isbn = {978-3-642-16404-0}, 7579 petsc_uses = {KSP} 7580} 7581 7582@InCollection{ knepleyyuen13, 7583 author = {Matthew G. Knepley and David A. Yuen}, 7584 title = {Why Scientists and Engineers need {GPU}s today}, 7585 booktitle = {GPU Solutions to Multi-scale Problems in Science and Engineering}, 7586 series = {Lecture Notes in Earth System Sciences}, 7587 editor = {David A. Yuen and Long Wang and Xuebin Chi and Lennart Johnsson and Wei Ge and 7588 Yaolin Shi}, 7589 doi = {10.1007/978-3-642-16405-7_1}, 7590 publisher = {Springer Berlin Heidelberg}, 7591 pages = {131--140}, 7592 year = {2013}, 7593 isbn = {978-3-642-16404-0}, 7594 petsc_uses = {KSP} 7595} 7596 7597@InCollection{ karpeevknepleybrune13, 7598 author = {Dmitry A. Karpeev and Matthew G. Knepley and Peter R. Brune}, 7599 title = {Accurate Evaluation of Local Averages on {GPGPUs}}, 7600 booktitle = {GPU Solutions to Multi-scale Problems in Science and Engineering}, 7601 series = {Lecture Notes in Earth System Sciences}, 7602 editor = {David A. Yuen and Long Wang and Xuebin Chi and Lennart Johnsson and Wei Ge and 7603 Yaolin Shi}, 7604 doi = {10.1007/978-3-642-16405-7_30}, 7605 publisher = {Springer Berlin Heidelberg}, 7606 pages = {487--501}, 7607 year = {2013}, 7608 isbn = {978-3-642-16404-0}, 7609 petsc_uses = {KSP} 7610} 7611 7612@InCollection{ zhengetal13, 7613 title = {{GPU} Implementation of Multigrid Solver for {S}tokes Equation with Strongly 7614 Variable Viscosity}, 7615 author = {Liang Zheng and Taras Gerya and Matthew G. Knepley and David A. Yuen and Huai 7616 Zhang and Yaolin Shi}, 7617 booktitle = {GPU Solutions to Multi-scale Problems in Science and Engineering}, 7618 series = {Lecture Notes in Earth System Sciences}, 7619 editor = {David A. Yuen and Long Wang and Xuebin Chi and Lennart Johnsson and Wei Ge and 7620 Yaolin Shi}, 7621 doi = {10.1007/978-3-642-16405-7_21}, 7622 publisher = {Springer Berlin Heidelberg}, 7623 pages = {321--333}, 7624 year = {2013}, 7625 isbn = {978-3-642-16404-0}, 7626 petsc_uses = {KSP} 7627} 7628 7629@Article{ zhengetal13b, 7630 title = {Implementation of a multigrid solver on {GPU} for {S}tokes equations with 7631 strongly variable viscosity based on {M}atlab and {CUDA}}, 7632 author = {Liang Zheng and Taras Gerya and Matthew G. Knepley and David A. Yuen and Huai 7633 Zhang and Yaolin Shi}, 7634 journal = {IJHPCA}, 7635 volume = {28}, 7636 number = {1}, 7637 pages = {50--60}, 7638 doi = {10.1177/1094342013478640}, 7639 year = {2013}, 7640 petsc_uses = {KSP} 7641} 7642 7643@InBook{ s2011, 7644 author = {B. Smith}, 7645 chapter = {PETSc, the Portable, Extensible Toolkit for Scientific computing}, 7646 title = {Encyclopedia of Parallel Computing}, 7647 bookeditor = {D. Padua}, 7648 publisher = {Springer}, 7649 year = {2011}, 7650 petsc_uses = {KSP} 7651} 7652 7653@Article{ acostamejia06, 7654 author = {Carlos D. Acosta and Carlos E. Mej\'ia}, 7655 title = {Computaci\'on cient\'ifica en paralelo con interfaz MATLAB a PETSc}, 7656 journal = {Lecturas Matem\'aticas}, 7657 volume = {27}, 7658 year = {2006}, 7659 pages = {213--224}, 7660 petsc_uses = {KSP} 7661} 7662 7663@InProceedings{ quenettemoresisunterappelbe07, 7664 author = {Steve Quenette and Louis Moresi and {P. D.} Sunter and Bill F. Appelbe}, 7665 title = {Explaining StGermain: An aspect oriented environment for building extensible 7666 computational mechanics modeling software}, 7667 booktitle = {Parallel and Distributed Processing Symposium, IPDPS 2007}, 7668 publisher = {IEEE}, 7669 pages = {1--8}, 7670 yerar = {2007}, 7671 petsc_uses = {KSP} 7672} 7673 7674@Article{ dfm1, 7675 title = {Vectorized sparse matrix multiply for compressed row storage format}, 7676 author = {E. F. D'Azevedo and M. R. Fahey and R. T. Mills}, 7677 journal = {Lecture Notes in Computer Science}, 7678 year = {2005}, 7679 pages = {99--106}, 7680 volume = {3514}, 7681 lab = {ORNL}, 7682 petsc_uses = {KSP} 7683} 7684 7685@InProceedings{ laniquintinokimpedeconinckvandewallepoedts05, 7686 author = {Andrea Lani and Tiago Quintino and Dries Kimpe and Herman Deconinck and Stefan 7687 Vandewalle and Stefaan Poedts}, 7688 title = {The COOLFluiD Framework: Design Solutions for High Performance Object Oriented 7689 Scientific Computing Software}, 7690 booktitle = {Computational Science ICCS 2005: 5th International Conference}, 7691 year = {2005}, 7692 note = {Lecture Notes in Computer Science}, 7693 volume = {3514}, 7694 publisher = {Springer-Verlag GmbH}, 7695 petsc_uses = {KSP} 7696} 7697 7698@InProceedings{ dalcin-paz-storti, 7699 author = {L. Dalcin and R. Paz and M. Storti}, 7700 title = {Desarrollo de Aplicaciones Paralelas en Python}, 7701 booktitle = {Proceedings of *XIV Congress on Numerical Methods and its Applications (ENIEF). 7702 Bariloche, Argentina}, 7703 year = {2004}, 7704 petsc_uses = {KSP} 7705} 7706 7707@Article{ mpi-python, 7708 author = {L. Dalcin and R. Paz and M. Storti}, 7709 title = {MPI for Python}, 7710 journal = {Journal of Parallel and Distributed Computing}, 7711 year = {2005}, 7712 petsc_uses = {KSP} 7713} 7714 7715@Unpublished{ hrv02a, 7716 title = {{SLEPc}: Scalable Library for Eigenvalue Problem Computations}, 7717 author = {V. Hernandex and J. E. Roman and V. Vidal}, 7718 note = {Submited to VecPar 2002}, 7719 year = {2002}, 7720 petsc_uses = {KSP} 7721} 7722 7723@Article{ knyazev2007block, 7724 title = {Block Locally Optimal Preconditioned Eigenvalue Xolvers {(BLOPEX)} in {Hypre} and 7725 {PETSc}}, 7726 author = {Knyazev, A. V. and Argentati, M. E. and Lashuk, I. and Ovtchinnikov, E. E.}, 7727 journal = {SIAM Journal on Scientific Computing}, 7728 volume = {29}, 7729 pages = {2224-2239}, 7730 doi = {10.1137/060661624}, 7731 year = {2007}, 7732 petsc_uses = {KSP} 7733} 7734 7735@MastersThesis{ aarrestad-master, 7736 author = {Asbjorn Hoiland Aarrestad}, 7737 title = {Time Dependent Solution of the Schrodinger Equation for Parallel Computers}, 7738 school = {University of Bergen}, 7739 month = aug, 7740 year = {2003}, 7741 url = {http://www.parallab.uib.no/projects/molecul/matrix/}, 7742 note = {Implemented Runge-Kutta methods using PETSc}, 7743 petsc_uses = {KSP} 7744} 7745 7746@PhDThesis{ kaushik-phd, 7747 author = {D. K. Kaushik}, 7748 title = {Performance Modeling and Prediction for the Scalable Solution of Partial 7749 Differential Equations on Unstructured Grids}, 7750 school = {Old Dominion University}, 7751 month = dec, 7752 year = {2002}, 7753 url = {http://www.mcs.anl.gov/\~{ }kaushik/Papers/thesis.ps}, 7754 petsc_uses = {KSP} 7755} 7756 7757@TechReport{ rb1, 7758 author = {Rickard Bergstrom}, 7759 title = {Object Oriented Implementation of a General Finite Element Code}, 7760 number = {2002-13}, 7761 institution = {Chalmers Finite Element Center, Chalmers University of Technology}, 7762 year = {2002}, 7763 url = {http://www.phi.chalmers.se/pub/preprints/pdf/phiprint-2002-13.pdf}, 7764 note = {Discribes a finite element software package that uses PETSc for its solvers}, 7765 petsc_uses = {KSP} 7766} 7767 7768@InProceedings{ dbl1, 7769 author = {Enzo A. Dari and Gustavo C. Buscaglia and Adrian J. Lew}, 7770 title = {A Parallel General Purpose Finite Element System}, 7771 booktitle = {IX SIAM Conference on Parallel Processing for Scientific Computing}, 7772 publisher = {SIAM}, 7773 year = {1999}, 7774 url = {http://cabmec1.cnea.gov.ar/papers/apgpfes.ps.gz}, 7775 note = {Describes software that uses PETSc for its parallel linear solves}, 7776 petsc_uses = {KSP} 7777} 7778 7779@Article{ p1, 7780 title = {Parallel Components for PDEs and Optimization: Some Issues and Experiences}, 7781 author = {B. Norris and S. Balay and S. Benson and L. Freitag and P. Hovland and L. McInnes 7782 and B. Smith}, 7783 journal = {Parallel Computing}, 7784 year = {2002}, 7785 pages = {1811--1831}, 7786 volume = {28 (12)}, 7787 petsc_uses = {KSP} 7788} 7789 7790@Article{ automatic-ad, 7791 author = {Paul Hovland and Boyana Norris and Barry Smith}, 7792 title = {Making Automatic Differentiation Truly Automatic: Coupling {PETSc} with {ADIC}}, 7793 year = {2005}, 7794 journal = {Future Generation Computer Systems}, 7795 volume = {21}, 7796 number = {8}, 7797 pages = {1426--1438}, 7798 petsc_uses = {KSP} 7799} 7800 7801@TechReport{ remote-math, 7802 author = {Elizabeth Dolan and Paul Hovland and Jorge Mor\'e and Boyana Norris and Barry 7803 Smith}, 7804 title = {Remote Access to Mathematical Software}, 7805 number = {ANL/MCS-P889-0601}, 7806 institution = {Mathematics and Computer Science Division, Argonne National Laboratory}, 7807 month = jun, 7808 year = {2001}, 7809 url = {http://icm.mcs.kent.edu/research/iamc01proceedings.html}, 7810 petsc_uses = {KSP} 7811} 7812 7813@InProceedings{ gropp98, 7814 author = {William D. Gropp}, 7815 title = {Exploiting Existing Software in Libraries: Successes, Failures, and Reasons Why}, 7816 publisher = {SIAM}, 7817 booktitle = {Proceedings of the SIAM Workshop on Object Oriented Methods for Inter-operable 7818 Scientific and Engineering Computing}, 7819 year = {1999}, 7820 pages = {21-29}, 7821 petsc_uses = {KSP} 7822} 7823 7824@InProceedings{ knepleysarin99, 7825 author = {Matthew Knepley and Vivek Sarin}, 7826 title = {Algorithm Development for Large Scale Computing}, 7827 publisher = {SIAM}, 7828 booktitle = {Proceedings of the SIAM Workshop on Object Oriented Methods for Inter-operable 7829 Scientific and Engineering Computing}, 7830 note = {\url{http://books.google.com/books?id=2Da5OcnjPSgC&lpg=PA58&ots=TJCK64BUeg&dq=Bill%20Gropp%20Science%20Engineering%20Object%20Oriented&pg=PA138#v=onepage&q&f=false}}, 7831 year = {1999}, 7832 petsc_uses = {KSP} 7833} 7834 7835@InBook{ bgms00, 7836 author = {S. Balay and W. D. Gropp and L. C. McInnes and B. F. Smith}, 7837 chapter = {Software for the Scalable Solution of {PDEs}}, 7838 url = {ftp://info.mcs.anl.gov/pub/tech_reports/reports/P834.ps.Z}, 7839 title = {CRPC Handbook of Parallel Computing}, 7840 editor = {J. Dongarra and I. Foster and G. Fox and B. Gropp and K. Kennedy and L. Torczon 7841 and A. White}, 7842 publisher = {Morgan Kaufmann Publishers}, 7843 year = {2002}, 7844 petsc_uses = {KSP} 7845} 7846 7847@InProceedings{ hovland_norris_smith98, 7848 author = {Paul Hovland and Boyana Norris and Lucas Roh and Barry Smith}, 7849 title = {Developing a Derivative-Enhanced Object-Oriented Toolkit for Scientific 7850 Computations}, 7851 publisher = {SIAM}, 7852 booktitle = {Proceedings of the SIAM Workshop on Object Oriented Methods for Inter-operable 7853 Scientific and Engineering Computing}, 7854 url = {ftp://info.mcs.anl.gov/pub/tech_reports/reports/P731.ps.Z}, 7855 note = {also available as Argonne preprint ANL/MCS-P731-1098}, 7856 year = {1999}, 7857 pages = {129-137}, 7858 petsc_uses = {KSP} 7859} 7860 7861@InProceedings{ efficient, 7862 author = {Satish Balay and William D. Gropp and Lois Curfman McInnes and Barry F. Smith}, 7863 title = {Efficient Management of Parallelism in Object Oriented Numerical Software 7864 Libraries}, 7865 booktitle = {Modern Software Tools in Scientific Computing}, 7866 editor = {E. Arge and A. M. Bruaset and H. P. Langtangen}, 7867 publisher = {Birkhauser Press}, 7868 pages = {163--202}, 7869 year = {1997}, 7870 petsc_uses = {KSP} 7871} 7872 7873% url = "ftp://info.mcs.anl.gov/pub/tech_reports/reports/P634.ps.Z" 7874@TechReport{ petsc-user-ref, 7875 author = {Satish Balay and Shrirang Abhyankar and Mark~F. Adams and Steven Benson and Jed 7876 Brown and Peter Brune and Kris Buschelman and Emil Constantinescu and Lisandro 7877 Dalcin and Alp Dener and Victor Eijkhout and Jacob Faibussowitsch and William~D. 7878 Gropp and V\'{a}clav Hapla and Tobin Isaac and Pierre Jolivet and Dmitry Karpeev 7879 and Dinesh Kaushik and Matthew~G. Knepley and Fande Kong and Scott Kruger and 7880 Dave~A. May and Lois Curfman McInnes and Richard Tran Mills and Lawrence Mitchell 7881 and Todd Munson and Jose~E. Roman and Karl Rupp and Patrick Sanan and Jason Sarich 7882 and Barry~F. Smith and Stefano Zampini and Hong Zhang and Hong Zhang and Junchao 7883 Zhang}, 7884 title = {{PETSc/TAO} Users Manual}, 7885 institution = {Argonne National Laboratory}, 7886 number = {ANL-21/39 - Revision 3.20}, 7887 doi = {10.2172/1968587}, 7888 year = {2023} 7889} 7890 7891% url = {https://petsc.org/release} 7892@TechReport{ petsc-developers, 7893 author = {Scott Kruger and Patrick Sanan and Barry~F. Smith}, 7894 title = {{PETS}c Developers Guide}, 7895 institution = {Argonne National Laboratory}, 7896 number = {ANL-18/18}, 7897 year = {2018}, 7898 url = {https://petsc.org/release/developers}, 7899 petsc_uses = {KSP} 7900} 7901 7902@Unpublished{ alice-memory-snooper, 7903 author = {Ibrahima Ba and Barry~F. Smith}, 7904 title = {The {ALICE} Memory Snooper}, 7905 year = {1999}, 7906 petsc_uses = {KSP} 7907} 7908 7909@TechReport{ petsc-user-ref-polish, 7910 author = {Marcin Bojko and Piotr Krzyzanowski}, 7911 title = {Rozwiazywanie ukladow rownan przy pomocy pakietu PETSc}, 7912 institution = {Instytut Matematyki, Stosowanej i Mechaniki, Uniwersytet Warszawski}, 7913 year = {1998}, 7914 note = {An introduction to PETSc in Polish}, 7915 petsc_uses = {KSP} 7916} 7917 7918@InProceedings{ abghmn00, 7919 title = {Integrating Automatic Differentiation with Object-Oriented Toolkits for 7920 High-Performance Scientific Computing}, 7921 author = {J. Abate and S. Benson and L. Grignon and P. Hovland and L. C. McInnes and B. 7922 Norris}, 7923 url = {ftp://info.mcs.anl.gov/pub/tech_reports/reports/P820.ps.Z}, 7924 booktitle = {Automatic Differentiation of Algorithms: From Simulation to Optimization}, 7925 editor = {George Corliss and Christ\`{e}le Faure and Andreas Griewank and Laurent 7926 Hasco\"{e}t and Uwe Naumann}, 7927 publisher = {Springer}, 7928 year = {2002}, 7929 petsc_uses = {KSP} 7930} 7931 7932@Unpublished{ petsc-mpi-paper, 7933 author = {Lois Curfman McInnes and Barry F. Smith}, 7934 title = {{PETS}c 2.0: A Case Study of Using {MPI} to Develop Numerical Software 7935 Libraries}, 7936 note = {Proceedings of the MPI Developers Conference, Notre Dame, IN}, 7937 month = jun, 7938 year = {1995}, 7939 petsc_uses = {KSP} 7940} 7941 7942@InProceedings{ miss-paper, 7943 author = {William D. Gropp and Barry F. Smith}, 7944 title = {Scalable, Extensible, and Portable Numerical Libraries}, 7945 publisher = {IEEE}, 7946 year = {1994}, 7947 booktitle = {Proceedings of the Scalable Parallel Libraries Conference}, 7948 address = {Mississippi State University}, 7949 pages = {87--93}, 7950 keyword = {numerical libraries, scientific computing, parallel computing}, 7951 petsc_uses = {KSP} 7952} 7953 7954@InProceedings{ snes-paper, 7955 author = {William D. Gropp and Lois Curfman McInnes and Barry F. Smith}, 7956 title = {Scalable Libraries for Solving Systems of Nonlinear Equations and Unconstrained 7957 Minimization Problems}, 7958 publisher = {IEEE}, 7959 year = {1995}, 7960 booktitle = {Proceedings of the Scalable Parallel Libraries Conference}, 7961 address = {Mississippi State University}, 7962 pages = {60-67}, 7963 keyword = {nonlinear equations, optimization, superconductivity, parallel computing}, 7964 petsc_uses = {KSP} 7965} 7966 7967@Article{ dsneutral, 7968 author = {Barry F. Smith and William D. Gropp}, 7969 title = {The Design of Data-structure-neutral Libraries for the Iterative Solution of 7970 Sparse Linear Systems}, 7971 journal = {Scientific Programming}, 7972 volume = {5}, 7973 pages = {329--336}, 7974 key = {GroppSmith96 ! KSP design}, 7975 year = {1996}, 7976 petsc_uses = {KSP} 7977} 7978 7979@InProceedings{ bgms98, 7980 author = {Satish Balay and William D. Gropp and Lois Curfman McInnes and Barry F. Smith}, 7981 title = {A Microkernel Design for Component-based Parallel Numerical Software Systems}, 7982 booktitle = {Proceedings of the SIAM Workshop on Object Oriented Methods for Inter-operable 7983 Scientific and Engineering Computing}, 7984 publisher = {SIAM}, 7985 pages = {58-67}, 7986 url = {ftp://info.mcs.anl.gov/pub/tech_reports/reports/P727.ps.Z}, 7987 year = {1998}, 7988 petsc_uses = {KSP} 7989} 7990 7991@Article{ hkm98, 7992 author = {M. E. Hayder and D. E. Keyes and P. Mehrotra}, 7993 title = {A Comparison of the {PETSc} Library and {HPF} Implementations of an Archetypal 7994 {PDE} Computation}, 7995 journal = {Advances in Engineering Software}, 7996 volume = {29}, 7997 pages = {415-424}, 7998 year = {1998}, 7999 petsc_uses = {KSP} 8000} 8001 8002@TechReport{ pdpta99, 8003 author = {L. A. Freitag and W. D. Gropp and P. D. Hovland and L. C. McInnes and B. F. 8004 Smith}, 8005 title = {Infrastructure and Interfaces for Large-Scale Numerical Software}, 8006 note = {to appear in the Proceedings of the 1999 International Conference on Parallel and 8007 Distributed Processing Techniques and Applications, June 28 - July 1, 1999, Las 8008 Vegas, Nevada}, 8009 institution = {Mathematics and Computer Science Division, Argonne National Laboratory}, 8010 url = {ftp://info.mcs.anl.gov/pub/tech_reports/reports/P751.ps.Z}, 8011 number = {ANL/MCS-P751-0599}, 8012 year = {1999}, 8013 petsc_uses = {KSP} 8014} 8015 8016@InProceedings{ bbh:com, 8017 author = {C. H. Bischof and H. M. B{\"u}cker and P. D. Hovland}, 8018 title = {{On Combining Computational Differentiation and Toolkits for Parallel Scientific 8019 Computing}}, 8020 booktitle = {Euro-Par 2000 -- Parallel Processing, Proceedings of the 6th International 8021 Euro-Par Conference, Munich, Germany, August/September 2000}, 8022 year = {2000}, 8023 editor = {A. Bode and T. Ludwig and W. Karl and R. Wism{\"u}ller}, 8024 volume = {1900}, 8025 series = {Lecture Notes in Computer Science}, 8026 pages = {86--94}, 8027 address = {Berlin}, 8028 publisher = {Springer}, 8029 url = {ftp://info.mcs.anl.gov/pub/tech_reports/reports/P797.ps.Z}, 8030 petsc_uses = {KSP} 8031} 8032 8033@InProceedings{ overture00, 8034 author = {K. R. Buschelman and W. D. Gropp and L. C. McInnes and B. F. Smith}, 8035 title = { {PETSc and Overture}: Lessons Learned Developing an Interface between 8036 Components}, 8037 url = {ftp://info.mcs.anl.gov/pub/tech_reports/reports/P858.ps.Z}, 8038 booktitle = {Proceedings of the International Federation for Information Processing Working 8039 Conference on Software Architectures for Scientific Computing, Kluwer}, 8040 year = {2000}, 8041 pages = {57--68}, 8042 petsc_uses = {KSP} 8043} 8044 8045@TechReport{ smith97, 8046 title = {An Interface for Efficient Vector Scatters and Gathers on Parallel Machines}, 8047 url = {ftp://info.mcs.anl.gov/pub/tech_reports/reports/P701.ps.Z}, 8048 number = {ANL/MCS-P701}, 8049 author = {Barry F. Smith}, 8050 institution = {Mathematics and Computer Science Division, Argonne National Laboratory}, 8051 petsc_uses = {KSP} 8052} 8053 8054@Article{ smith98, 8055 author = {Barry Smith}, 8056 title = {The Transition of Numerical Software: From Nuts-and-Bolts to Abstraction}, 8057 journal = {SIGNUM Newsletter}, 8058 year = {1998}, 8059 url = {ftp://info.mcs.anl.gov/pub/tech_reports/reports/P712.ps.Z}, 8060 petsc_uses = {KSP} 8061} 8062 8063@TechReport{ ad-petsc-tm, 8064 title = {Using {ADIFOR} and {ADIC} to Provide a {J}acobian for the {SNES} Component of 8065 {PETSc}}, 8066 author = {Christian Bischof and Paul Hovland and Po-Ting Wu}, 8067 year = {1997}, 8068 type = {Technical Memorandum}, 8069 institution = {ANL}, 8070 url = {ftp://info.mcs.anl.gov/pub/tech_reports/reports/TM233.ps.Z}, 8071 number = {ANL/MCS-TM-233}, 8072 petsc_uses = {KSP} 8073} 8074 8075% LiteralHTML: 8076% LiteralHTML: <a name="algorithm"><H3><center>Algorithm design and analysis</center></H3> 8077% LiteralHTML: 8078@PhDThesis{ klotzthesis2019, 8079 author = {Thomas S. Klotz}, 8080 title = {Numerical Analysis of Nonlinear Boundary Integral Equations Arising in Molecular 8081 Biology}, 8082 school = {Rice University}, 8083 year = {2019}, 8084 petsc_uses = {KSP} 8085} 8086 8087@Article{ klotzbardhanknepley2018, 8088 title = {Efficient Evaluation of Ellipsoidal Harmonics for Potential Modeling}, 8089 author = {Thomas S. Klotz and Jaydeep Bardhan and Matthew G. Knepley}, 8090 journal = {arXiv e-prints}, 8091 eprint = {1708.06028}, 8092 archiveprefix = {arXiv}, 8093 primaryclass = {math.na}, 8094 year = {2018}, 8095 note = {\url{http://arxiv.org/abs/1708.06028}}, 8096 petsc_uses = {KSP} 8097} 8098 8099@Misc{ brown2016, 8100 title = {Threading Tradeoffs in Domain Decomposition}, 8101 author = {Jed Brown}, 8102 note = {SIAM Parallel Processing Conference, To Thread or Not To Thread Minisymposium, 8103 \url{https://www.cse.buffalo.edu/~knepley/presentations/SIAMPP2016_1.pdf}}, 8104 url = {https://www.cse.buffalo.edu/~knepley/presentations/SIAMPP2016_1.pdf}, 8105 year = {2016}, 8106 petsc_uses = {KSP} 8107} 8108 8109@Article{ changnakshatralaknepleyjohnsson2017, 8110 title = {A performance spectrum for parallel computational frameworks that solve {PDEs}}, 8111 author = {Justin Chang and Kalyana B. Nakshatrala and Matthew G. Knepley and Lennart 8112 Johnsson}, 8113 journal = {Concurency: Practice and Experience}, 8114 volume = {30}, 8115 number = {11}, 8116 eprint = {1705.03625}, 8117 doi = {10.1002/cpe.4401}, 8118 year = {2017}, 8119 petsc_uses = {KSP} 8120} 8121 8122@Article{ changfabienknepleymills2018, 8123 title = {Comparative study of finite element methods using the Time-Accuracy-Size {(TAS)} 8124 spectrum analysis}, 8125 author = {Justin Chang and Maurice S. Fabien and Matthew G. Knepley and Richard T. Mills}, 8126 journal = {SIAM Journal on Scientific Computing}, 8127 volume = {40}, 8128 number = {6}, 8129 pages = {C779--C802}, 8130 eprint = {1802.07832}, 8131 doi = {10.1137/18M1172260}, 8132 year = {2018}, 8133 petsc_uses = {KSP} 8134} 8135 8136@Article{ joshaghanichangnakshatralaknepley2019, 8137 title = {Composable solvers for the four-field double porosity/permeability model}, 8138 author = {M. S. Joshaghani and Justin Chang and Kalyana B. Nakshatrala and Matthew G. 8139 Knepley}, 8140 journal = {Journal of Computational Physics}, 8141 volume = {386}, 8142 pages = {428--466}, 8143 doi = {10.1016/j.jcp.2019.02.020}, 8144 year = {2019}, 8145 petsc_uses = {KSP} 8146} 8147 8148@InProceedings{ barralknepleylangepiggottgorman2016, 8149 title = {Anisotropic mesh adaptation in {Firedrake} with {PETSc} {DMPlex}}, 8150 author = {Nicolas Barral and Matthew G. Knepley and Michael Lange and Matthew D. Piggott 8151 and Gerard J. Gorman}, 8152 booktitle = {25th International Meshing Roundtable}, 8153 editor = {Steve Owen and Hang Si}, 8154 month = sep, 8155 address = {Washington, DC}, 8156 pages = {1--5}, 8157 url = {http://imr.sandia.gov/papers/imr25/2026_imr25RN_Barral.pdf}, 8158 year = {2016}, 8159 petsc_uses = {KSP} 8160} 8161 8162@Article{ adamsbrownknepleysamtaney2016, 8163 title = {Segmental Refinement: A Multigrid Technique for Data Locality}, 8164 author = {Mark F. Adams and Jed Brown and Matthew G. Knepley and Ravi Samtaney}, 8165 journal = {SIAM Journal on Scientific Computing}, 8166 url = {http://epubs.siam.org/toc/sjoce3/38/4 }, 8167 epub = {http://arxiv.org/abs/1406.7808}, 8168 volume = {8}, 8169 number = {4}, 8170 pages = {C426--C440}, 8171 doi = {10.1137/140975127}, 8172 year = {2016}, 8173 petsc_uses = {KSP} 8174} 8175 8176@InProceedings{ maysananruppknepleysmith2016, 8177 title = {Extreme-Scale Multigrid Components within {PETSc}}, 8178 author = {Dave A. May and Patrick Sanan and Karl Rupp and Matthew G. Knepley and Barry F. 8179 Smith}, 8180 booktitle = {Proceedings of the {Platform for Advanced Scientific Computing Conference}}, 8181 series = {PASC '16}, 8182 isbn = {978-1-4503-4126-4}, 8183 location = {Lausanne, Switzerland}, 8184 pages = {5:1--5:12}, 8185 articleno = {5}, 8186 numpages = {12}, 8187 doi = {10.1145/2929908.2929913}, 8188 acmid = {2929913}, 8189 publisher = {ACM}, 8190 address = {New York, NY, USA}, 8191 keywords = {GPU, HPC, agglomeration, coarse-level solver, multigrid, parallel computing, 8192 preconditioning}, 8193 year = {2016}, 8194 petsc_uses = {KSP} 8195} 8196 8197@Article{ liu2015field, 8198 title = {Field-Split Preconditioned Inexact Newton Algorithms}, 8199 author = {Lulu Liu and David E Keyes}, 8200 journal = {SIAM Journal on Scientific Computing}, 8201 volume = {37}, 8202 number = {3}, 8203 pages = {A1388--A1409}, 8204 year = {2015}, 8205 publisher = {SIAM}, 8206 petsc_uses = {KSP} 8207} 8208 8209@Article{ lujiaomissirlis2014, 8210 title = {A hybrid geometric+ algebraic multigrid method with semi-iterative smoothers}, 8211 author = {Cao Lu and Xiangmin Jiao and Nikolaos Missirlis}, 8212 journal = {Numerical Linear Algebra with Applications}, 8213 volume = {21}, 8214 number = {2}, 8215 pages = {221--238}, 8216 year = {2014}, 8217 publisher = {Wiley Online Library}, 8218 petsc_uses = {KSP} 8219} 8220 8221@Article{ badiamartinprincipe2013, 8222 title = {Enhanced balancing Neumann-Neumann preconditioning in computational fluid and 8223 solid mechanics}, 8224 author = {Santiago Badia and Alberto F. Mart\'in and Javier Principe}, 8225 journal = {International Journal for Numerical Methods in Engineering}, 8226 volume = {96}, 8227 number = {4}, 8228 pages = {203--230}, 8229 year = {2013}, 8230 petsc_uses = {KSP} 8231} 8232 8233@Article{ morganknepleysananscott2016, 8234 title = {A Stochastic Performance Model for Pipelined {Krylov} Methods}, 8235 author = {Hannah Morgan and Matthew G. Knepley and Patrick Sanan and L. Ridgway Scott}, 8236 journal = {Concurrency and Computation: Practice and Experience}, 8237 volume = {28}, 8238 pages = {4532--4542}, 8239 year = {2016}, 8240 url = {http://arxiv.org/abs/1602.04873}, 8241 doi = {10.1002/cpe.3820}, 8242 petsc_uses = {KSP} 8243} 8244 8245@Article{ morgansananknepleymills2020, 8246 title = {Understanding performance variability in standard and pipelined parallel {Krylov} 8247 solvers}, 8248 author = {Hannah Morgan and Patrick Sanan and Matthew G. Knepley and Richard Tran Mills}, 8249 journal = {The International Journal of High Performance Computing Applications}, 8250 volume = {35}, 8251 issue = {1}, 8252 doi = {10.1177/1094342020966835}, 8253 url = {https://doi.org/10.1177/1094342020966835}, 8254 eprint = {https://doi.org/10.1177/1094342020966835}, 8255 year = {2020}, 8256 petsc_uses = {KSP} 8257} 8258 8259@Article{ msz2013, 8260 title = {Efficient Sparse Matrix-Matrix Products Using Colorings}, 8261 author = {M. McCourt and B. F. Smith and H. Zhang}, 8262 journal = {SIAM Journal on Matrix Analysis and Applications}, 8263 year = {2015}, 8264 note = {To appear}, 8265 petsc_uses = {KSP} 8266} 8267 8268@Article{ bassi2014agglomeration, 8269 title = {Agglomeration-based physical frame d{G} discretizations: {A}n attempt to be mesh 8270 free}, 8271 author = {Bassi, Francesco and Botti, Lorenzo and Colombo, Alessandro}, 8272 journal = {Mathematical Models and Methods in Applied Sciences}, 8273 volume = {24}, 8274 number = {08}, 8275 pages = {1495--1539}, 8276 year = {2014}, 8277 publisher = {World Scientific}, 8278 petsc_uses = {KSP} 8279} 8280 8281@Article{ jhuranidemkowicz12, 8282 author = {{Jhurani}, C. and {Demkowicz}, L.}, 8283 title = {{Multiscale modeling using goal-oriented adaptivity and numerical homogenization. 8284 Part II: Algorithms for the Moore-Penrose pseudoinverse}}, 8285 journal = {Computer Methods in Applied Mechanics and Engineering}, 8286 volume = {213}, 8287 pages = {418-426}, 8288 year = {2012}, 8289 month = mar, 8290 doi = {10.1016/j.cma.2011.06.003}, 8291 adsurl = {http://adsabs.harvard.edu/abs/2012CMAME.213..418J}, 8292 petsc_uses = {KSP} 8293} 8294 8295@Article{ yangcai11, 8296 author = {Yang, Haijian and Cai, Xiao-Chuan}, 8297 title = {Parallel Two-Grid Semismooth Newton-Krylov-Schwarz Method for Nonlinear 8298 Complementarity Problems}, 8299 journal = {J. Sci. Comput.}, 8300 issue_date = {May 2011}, 8301 volume = {47}, 8302 number = {2}, 8303 month = may, 8304 pages = {258--280}, 8305 year = {2011}, 8306 issn = {0885-7474}, 8307 numpages = {23}, 8308 doi = {10.1007/s10915-010-9436-4}, 8309 acmid = {1971246}, 8310 publisher = {Plenum Press}, 8311 address = {New York, NY, USA}, 8312 keywords = {Complementarity problem, Grid sequencing, Parallel computing, Schwarz 8313 preconditioners, Semismooth Newton, Two-level methods}, 8314 petsc_uses = {KSP} 8315} 8316 8317@Article{ rheinbach09, 8318 author = {Rheinbach, Oliver}, 8319 title = {Parallel Iterative Substructuring in Structural Mechanics}, 8320 journal = {Archives of Computational Methods in Engineering}, 8321 volume = {16}, 8322 number = {4}, 8323 pages = {425-463}, 8324 year = {2009}, 8325 issn = {1134-3060}, 8326 doi = {10.1007/s11831-009-9035-4}, 8327 publisher = {Springer Netherlands}, 8328 language = {English}, 8329 petsc_uses = {KSP} 8330} 8331 8332@Article{ knepleyterrel2013, 8333 author = {Matthew G. Knepley and Andy R. Terrel}, 8334 title = {Finite Element Integration on {GPUs}}, 8335 journal = {{ACM} Transactions on Mathematical Software}, 8336 volume = {39}, 8337 number = {2}, 8338 accepted = {17 April 2012}, 8339 year = {2013}, 8340 abstract = {We present a novel finite element integration method for low order elements on 8341 GPUs. We achieve more than 100GF for element integration on first order 8342 discretizations of both the Laplacian and Elasticity operators on an NVIDIA 8343 GTX285, which has a nominal single precision peak flop rate of 1 TF/s and 8344 bandwidth of 159 GB/s, corresponding to a bandwidth limited peak of 40 GF/s.}, 8345 url = {http://arxiv.org/abs/1103.0066}, 8346 note = {no. 10, \url{http://arxiv.org/abs/1103.0066}}, 8347 petsc_uses = {KSP} 8348} 8349 8350@Article{ knepleyruppterrel2016, 8351 title = {Finite Element Integration with Quadrature on the GPU}, 8352 journal = {ArXiv e-prints}, 8353 author = {Matthew G. Knepley and Karl Rupp and Andy R. Terrel}, 8354 version = {1}, 8355 date = {2016-07-14}, 8356 eprinttype = {arxiv}, 8357 eprintclass = {cs.MS}, 8358 eprint = {1607.04245v1}, 8359 petsc_uses = {KSP} 8360} 8361 8362@Article{ klawonnlanserrheinbach2014, 8363 title = {Nonlinear {FETI-DP} and {BDDC} Methods}, 8364 author = {Axel Klawonn and Martin Lanser and Oliver Rheinbach}, 8365 journal = {SIAM Journal on Scientific Computing}, 8366 volume = {36}, 8367 number = {2}, 8368 pages = {A737--A765}, 8369 year = {2014}, 8370 petsc_uses = {KSP} 8371} 8372 8373@TechReport{ pbmkbsxt2012, 8374 title = {Composing Scalable Nonlinear Algebraic Solvers}, 8375 author = {Peter R. Brune and Matthew G. Knepley and Barry F. Smith and Xuemin Tu}, 8376 year = {2013}, 8377 type = {Preprint}, 8378 number = {ANL/MCS-P2010-0112}, 8379 institution = {Argonne National Laboratory}, 8380 petsc_uses = {KSP} 8381} 8382 8383@Article{ bruneknepleysmithtu15, 8384 title = {Composing Scalable Nonlinear Algebraic Solvers}, 8385 author = {Peter R. Brune and Matthew G. Knepley and Barry F. Smith and Xuemin Tu}, 8386 journal = {SIAM Review}, 8387 volume = {57}, 8388 number = {4}, 8389 pages = {535--565}, 8390 note = {\url{http://www.mcs.anl.gov/papers/P2010-0112.pdf}}, 8391 url = {http://www.mcs.anl.gov/papers/P2010-0112.pdf}, 8392 doi = {10.1137/130936725}, 8393 year = {2015}, 8394 petsc_uses = {KSP} 8395} 8396 8397@Article{ mszm2014, 8398 title = {Hierarchical {Krylov} and nested {Krylov} methods for extreme-scale computing}, 8399 author = {Lois Curfman McInnes and Barry Smith and Hong Zhang and Richard Tran Mills}, 8400 volume = {40}, 8401 pages = {17--31}, 8402 year = {2014}, 8403 journal = {Parallel Computing}, 8404 doi = {10.1016/j.parco.2013.10.001}, 8405 petsc_uses = {KSP} 8406} 8407 8408@TechReport{ mszm2012, 8409 title = {Hierarchical {Krylov} and Nested {Krylov} Methods for Extreme-Scale Computing}, 8410 author = {Lois Curfman McInnes and Barry Smith and Hong Zhang and Richard Tran Mills}, 8411 year = {2012}, 8412 number = {ANL/MCS-P2097-0512}, 8413 institution = {Argonne National Laboratory}, 8414 petsc_uses = {KSP} 8415} 8416 8417@InProceedings{ bkmms2012, 8418 author = {Jed Brown and Matthew G. Knepley and David A. May and Lois C. McInnes and Barry 8419 F. Smith}, 8420 title = {Composable linear solvers for multiphysics}, 8421 booktitle = {Proceeedings of the 11th {International Symposium on Parallel and Distributed 8422 Computing} ({ISPDC} 2012)}, 8423 year = {2012}, 8424 doi = {10.1109/ISPDC.2012.16}, 8425 publisher = {IEEE Computer Society}, 8426 pages = {55--62}, 8427 petsc_uses = {KSP} 8428} 8429 8430@Article{ bourdinbucuroudet2009, 8431 author = {Blaise Bourdin and D. Bucur and E. Oudet}, 8432 title = {Optimal Partitions for Eigenvalues}, 8433 journal = {SIAM J. Sci. Comput.}, 8434 volume = {31}, 8435 number = {6}, 8436 pages = {4100--4114}, 8437 year = {2009}, 8438 petsc_uses = {KSP} 8439} 8440 8441@InBook{ kimnbourdin2007, 8442 author = {J.-H. Kimn and Blaise Bourdin}, 8443 title = {Numerical implementation of overlapping balancing domain decomposition methods on 8444 unstructured meshes}, 8445 editor = {O. B. Widlund and D. E. Keyes}, 8446 booktitle = {Domain Decomposition Methods in Science and Engineering XVI}, 8447 series = {Lecture Notes in Computational Science and Engineering}, 8448 number = {55}, 8449 publisher = {Springer-Verlag}, 8450 pages = {309--315}, 8451 url = {http://www.cims.nyu.edu/dd16/proceedings/kimn_bourdin_mini_6.pdf}, 8452 year = {2007}, 8453 petsc_uses = {KSP} 8454} 8455 8456@Article{ bjm2005, 8457 author = {AH Baker and ER Jessup and T Manteuffel}, 8458 title = {A Technique for Accelerating the Convergence of Restarted GMRES}, 8459 journal = {SIAM JOURNAL ON MATRIX ANALYSIS AND APPLICATIONS}, 8460 year = {2005}, 8461 petsc_uses = {KSP} 8462} 8463 8464@Unpublished{ sundar-2008a, 8465 author = {R.S. Sampath and G. Biros}, 8466 title = {A parallel geometric multigrid method for finite elements on octree meshes}, 8467 url = {http://www.seas.upenn.edu/\~{ }rahulss}, 8468 petsc_uses = {KSP} 8469} 8470 8471@Article{ sundar-2008, 8472 author = {H. Sundar and R.S. Sampath and G. Biros}, 8473 title = {Bottom-up construction and 2:1 balance refinement of linear octrees in parallel}, 8474 journal = {SIAM Journal on Scientific Computing}, 8475 year = {2008}, 8476 url = {http://www.seas.upenn.edu/\~{ }rahulss}, 8477 petsc_uses = {KSP} 8478} 8479 8480@InProceedings{ sundar-2007, 8481 author = {H. Sundar and R.S. Sampath and S.S. Adavani and C. Davatzikos and G. Biros}, 8482 title = {Low-constant parallel algorithms for finite element simulations using linear 8483 octrees}, 8484 booktitle = {SC'07: ACM/IEEE Conference on Supercomputing}, 8485 year = {2007}, 8486 url = {http://www.seas.upenn.edu/\~{ }rahulss}, 8487 petsc_uses = {KSP} 8488} 8489 8490@InProceedings{ adams-98a, 8491 author = {Adams, Mark ~F.}, 8492 title = {A Parallel Maximal Independent Set Algorithm}, 8493 booktitle = {Proceedings 5th copper mountain conference on iterative methods}, 8494 year = {1998}, 8495 petsc_uses = {KSP} 8496} 8497 8498@Article{ akcelik2005ddd, 8499 title = {{Dynamic data-driven inversion for terascale simulations: real-time 8500 identification of airborne contaminants}}, 8501 author = {Ak\c{c}elik, V. and Biros, G. and Draganescu, A. and Hill, J. and Ghattas, O. and 8502 van Bloemen Waanders, B.}, 8503 journal = {Proceedings of the 2005 ACM/IEEE conference on Supercomputing}, 8504 year = {2005}, 8505 publisher = {IEEE Computer Society Washington, DC, USA}, 8506 petsc_uses = {KSP} 8507} 8508 8509@InBook{ akcelik-2006, 8510 author = {V. Akcelik and G. Biros and Omar Ghattas and J. Hill and David Keyes and B. van 8511 Bloemen Waanders}, 8512 bookeditor = {M. Heroux and P. Raghaven and H. Simon}, 8513 title = {Frontiers of Parallel Computing}, 8514 chapter = {Parallel algorithms for {PDE}-constrained optimization}, 8515 publisher = {SIAM}, 8516 year = {2006}, 8517 petsc_uses = {KSP} 8518} 8519 8520@Article{ dt, 8521 author = {Matthew F. Dixon and C. J. Kenneth Tan}, 8522 title = {Using Distributed Computers to Deterministically Approximate Higher Dimensional 8523 Convection Diffusion Equations}, 8524 journal = {The Journal of Supercomputing}, 8525 year = {2004}, 8526 pages = {235--253}, 8527 volume = {28}, 8528 url = {http://www.springerlink.com/(nekina45nmdgrib5izizn3ip)/app/home/contribution.asp?referrer=parent&backto=issue,8,8;journal,20,73;linkingpublicationresults,1:100302,1}, 8529 petsc_uses = {KSP} 8530} 8531 8532@PhDThesis{ hwang2004, 8533 author = {Feng-Nan Hwang}, 8534 title = {Some Parallel Linear and Nonlinear {Schwarz} Methods with Applications in 8535 Computational Fluid Dynamics}, 8536 school = {University of Colorado at Boulder}, 8537 year = {2004}, 8538 petsc_uses = {KSP} 8539} 8540 8541@PhDThesis{ baker, 8542 author = {{A. H.} Baker}, 8543 title = {On improving the performance of the linear solver restarted {GMRES}}, 8544 school = {University of Colorado at Boulder}, 8545 year = {2003}, 8546 petsc_uses = {KSP} 8547} 8548 8549@TechReport{ klawonnrheinbach601, 8550 author = {Axel Klawonn and Oliver Rheinbach}, 8551 title = {A Parallel Implementation of Dual-Primal FETI-DP Methods for Three Dimensional 8552 Linear Elasticity Using a Transformation of Basis}, 8553 institution = {Universit\"at Duisburg-Essen}, 8554 year = {2005}, 8555 type = {Technical Report}, 8556 number = {SM-E-601}, 8557 petsc_uses = {KSP} 8558} 8559 8560@TechReport{ klawonnrheinbach609, 8561 author = {Axel Klawonn and Oliver Rheinbach}, 8562 title = {Inexact FETI-DP Methods}, 8563 institution = {Universit\"at Duisburg-Essen}, 8564 year = {2005}, 8565 type = {Technical Report}, 8566 number = {SM-E-609}, 8567 petsc_uses = {KSP} 8568} 8569 8570@TechReport{ klawonnrheinbach607, 8571 author = {Axel Klawonn and Oliver Rheinbach}, 8572 title = {Robust FETI-DP Methods for Heterogeneous Three Dimensional Elasticity Problems}, 8573 institution = {Universit\"at Duisburg-Essen}, 8574 year = {2005}, 8575 type = {Technical Report}, 8576 number = {SM-E-607}, 8577 petsc_uses = {KSP} 8578} 8579 8580@Article{ kul-natraj-pbp, 8581 author = {Kshitij Kulshreshtha and Neela Nataraj and Michael Jung}, 8582 title = {Performance of a parallel mixed finite element implementation for fourth order 8583 clamped anisotropic plate bending problems in distributed memory environments}, 8584 journal = {Applied Mathematics and Computation}, 8585 volume = {155}, 8586 year = {2004}, 8587 number = {3}, 8588 pages = {753--777}, 8589 petsc_uses = {KSP} 8590} 8591 8592@Article{ bramkamp2006uej, 8593 author = {F. D. Bramkamp and H. M. B{\"u}cker and A. Rasch}, 8594 title = {Using Exact {J}acobians in an Implicit {N}ewton-{K}rylov Method}, 8595 journal = {Computers \& Fluids}, 8596 volume = {35}, 8597 number = {10}, 8598 pages = {1063--1073}, 8599 doi = {10.1016/j.compfluid.2005.10.003}, 8600 abstract = {In an implicit Newton-Krylov method for inviscid, compressible fluid flow, the 8601 derivation of the analytic flux Jacobian can become quite complicated depending on 8602 the complexity of the numerical flux calculation. Practically, the derivation of 8603 the exact Jacobian by hand is an unrealistic option because of the enormous 8604 man-hour investment needed. In this work, automatic differentiation is used to 8605 evaluate the exact Jacobian of upwind schemes implemented in the flow solver 8606 QUADFLOW. We compare the use of exact Jacobians and Jacobians numerically 8607 approximated by first-order forward differences. For a two-dimensional airfoil 8608 under three different flight conditions (quasi-incompressible flow, compressible 8609 subsonic flow, and transonic flow), we show that the robustness and performance of 8610 the present finite volume scheme is significantly improved by using exact 8611 Jacobians.}, 8612 year = {2006}, 8613 petsc_uses = {KSP} 8614} 8615 8616@Article{ shahbazi1, 8617 author = {Khosro Shahbazi}, 8618 title = {An explicit expression for the penalty parameter of the interior penalty method}, 8619 journal = {Journal of Computational Physics}, 8620 volume = {205}, 8621 year = {2005}, 8622 pages = {401--407}, 8623 petsc_uses = {KSP} 8624} 8625 8626@TechReport{ kk, 8627 title = {A Parallel Lanczos Algorithm for Eigensystem Calculation}, 8628 author = {Hans-Peter Kersken and Uwe Kuster}, 8629 year = {1999}, 8630 institution = {University of Stuttgart}, 8631 url = {http://elib.uni-stuttgart.de/opus/volltexte/1999/310/pdf/310.pdf}, 8632 number = {310}, 8633 petsc_uses = {KSP} 8634} 8635 8636@Article{ miha-mija, 8637 author = {M. D. Mihajlovi and S. Mijalkovi}, 8638 title = {A component decomposition preconditioning for 3D stress analysis problems}, 8639 journal = {Numerical Linear Algebra with Applications}, 8640 volume = {9}, 8641 year = {2002}, 8642 pages = {567--583}, 8643 url = {http://www3.interscience.wiley.com/cgi-bin/abstract/98516459/ABSTRACT}, 8644 petsc_uses = {KSP} 8645} 8646 8647@Article{ bjm, 8648 author = {M Benzi and W Joubert and G Mateescu}, 8649 journal = {Electronic Transactions on Numerical Analysis}, 8650 year = {1999}, 8651 volume = {8}, 8652 pages = {88--114}, 8653 title = {Numerical experiments with parallel orderings for {ILU} preconditioners}, 8654 url = {http://scholar.google.com/url?sa=U&q=http://emis.bibl.cwi.nl/journals/ETNA/vol.8.1999/pp88-114.dir/pp88-114.ps}, 8655 petsc_uses = {KSP} 8656} 8657 8658@PhDThesis{ hyde, 8659 author = {EMK Hyde}, 8660 title = {Fast, High-Order Methods for Scattering by Inhomogeneous Media}, 8661 school = {Caltech}, 8662 year = {2003}, 8663 url = {http://www.acm.caltech.edu/\~{ }bruno/02hyde_thesis_print.pdf}, 8664 petsc_uses = {KSP} 8665} 8666 8667@Article{ km2003, 8668 author = {A. Keese and H. G. Matthies}, 8669 journal = {Proceedings in Applied Mathematics and Mechanics}, 8670 year = {2003}, 8671 volume = {2}, 8672 pages = {485--486}, 8673 title = {Parallel Solution of Stochastic PDEs}, 8674 url = {http://www3.interscience.wiley.com/cgi-bin/abstract/104087421/ABSTRACT}, 8675 petsc_uses = {KSP} 8676} 8677 8678@Article{ whszss, 8679 author = {Joachim Weickert and Josef Heers and Christoph Schnorr and Karel J. Zuiderveld 8680 and Otmar Scherzer and H. Siegfried Stiehl}, 8681 journal = {Real Time Imaging}, 8682 year = {2001}, 8683 volume = {7}, 8684 pages = {31--45}, 8685 title = {Fast parallel algorithms for a broad class of nonlinear variational diffusion 8686 approaches}, 8687 url = {http://www.mia.uni-saarland.de/weickert/Papers/TR_5_99.ps.gz}, 8688 petsc_uses = {KSP} 8689} 8690 8691@TechReport{ baker1, 8692 title = {An Efficient Block Variant of GMRES}, 8693 author = {A. H. Baker and J. M. Dennis and E. R. Jessup}, 8694 year = {2003}, 8695 type = {Technical Report}, 8696 institution = {University of Colorado, Boulder}, 8697 url = {http://www.scd.ucar.edu/css/staff/dennis/papers/block.pdf}, 8698 number = {CU-CS-957-03}, 8699 petsc_uses = {KSP} 8700} 8701 8702@InProceedings{ mc2003, 8703 author = {Leszek Marcinkowski and Xiao-Chuan Cai}, 8704 title = {Parallel Performance of Some Two-Level {ASPIN} Algorithms}, 8705 booktitle = {Proceedings of the 15th International Conference on Domain Decomposition 8706 Methods}, 8707 pages = {639--646}, 8708 publisher = {Springer, Lecture Notes in Computational Science and Engineering (LNCSE).}, 8709 note = {}, 8710 url = {http://www.ddm.org/DD15/proceedings-dd15.html}, 8711 year = {2003}, 8712 petsc_uses = {KSP} 8713} 8714 8715@InProceedings{ kt2003, 8716 author = {Deepak V. Kulkarni and Daniel A. Tortorelli}, 8717 title = {A Domain Decomposition Based Two-Level Newton Scheme for Nonlinear Problems}, 8718 booktitle = {Proceedings of the 15th International Conference on Domain Decomposition 8719 Methods}, 8720 pages = {615--622}, 8721 publisher = {Springer, Lecture Notes in Computational Science and Engineering (LNCSE).}, 8722 note = {}, 8723 url = {http://www.ddm.org/DD15/proceedings-dd15.html}, 8724 year = {2003}, 8725 petsc_uses = {KSP} 8726} 8727 8728@InProceedings{ krw2003, 8729 author = {Axel Klawonn and Oliver Rheinbach and Olof B. Widlund}, 8730 title = {Some Computational Results for Dual-Primal FETI Methods for Elliptic Problems in 8731 3D}, 8732 booktitle = {Proceedings of the 15th International Conference on Domain Decomposition 8733 Methods}, 8734 pages = {361--368}, 8735 publisher = {Springer, Lecture Notes in Computational Science and Engineering (LNCSE).}, 8736 note = {}, 8737 url = {http://www.ddm.org/DD15/proceedings-dd15.html}, 8738 year = {2003}, 8739 petsc_uses = {KSP} 8740} 8741 8742@InProceedings{ hc2003, 8743 author = {Feng-Nan Hwang and Xiao-Chuan Cai}, 8744 title = {Improving Robustness and Parallel Scalability of {Newton's} Method Through 8745 Nonlinear Preconditioning}, 8746 booktitle = {Proceedings of the 15th International Conference on Domain Decomposition 8747 Methods}, 8748 pages = {201--208}, 8749 publisher = {Springer, Lecture Notes in Computational Science and Engineering (LNCSE).}, 8750 note = {}, 8751 url = {http://www.ddm.org/DD15/proceedings-dd15.html}, 8752 year = {2003}, 8753 petsc_uses = {KSP} 8754} 8755 8756@InProceedings{ g2003, 8757 author = {P. Goldfeld}, 8758 title = {Balancing {Neumann-Neumann} for (In)Compressible Linear Elasticity and 8759 (Generalized) {Stokes} and Parallel Implementation}, 8760 booktitle = {Proceedings of the 14th International Conference on Domain Decomposition 8761 Methods}, 8762 pages = {209--216}, 8763 editor = {I. Herrera and D. Keyes and O. Widlund and R. Yates}, 8764 publisher = {National Autonomous University of Mexico (UNAM)}, 8765 note = {}, 8766 url = {http://www.ddm.org/DD14}, 8767 year = {2003}, 8768 petsc_uses = {KSP} 8769} 8770 8771@InProceedings{ dhv2003, 8772 author = {Zdenek Dostal and David Horak and Oldrich Vlach}, 8773 title = {Toward scalable FETI algorithm for variational inequalities with applications to 8774 composites}, 8775 booktitle = {Proceedings of the 14th International Conference on Domain Decomposition 8776 Methods}, 8777 pages = {395--401}, 8778 editor = {I. Herrera and D. Keyes and O. Widlund and R. Yates}, 8779 publisher = {National Autonomous University of Mexico (UNAM)}, 8780 note = {}, 8781 url = {http://www.ddm.org/DD14}, 8782 year = {2003}, 8783 petsc_uses = {KSP} 8784} 8785 8786@InProceedings{ dhsv2002, 8787 author = {Zdenek Dostal and David Horak and Jan Szweda and Vit Vondrak}, 8788 title = {Scalabilities of FETI for variational inequalities and contact shape 8789 optimization}, 8790 booktitle = {Proceedings of the 13th International Conference on Domain Decomposition 8791 Methods}, 8792 pages = {359--367}, 8793 editor = {N. Debit and M.Garbey and R. Hoppe and J. Periaux and D. Keyes and Y. Kuznetsov}, 8794 publisher = {CIMNE, Barcelona, Spain}, 8795 note = {}, 8796 url = {http://www.ddm.org/DD13}, 8797 year = {2002}, 8798 petsc_uses = {KSP} 8799} 8800 8801@InProceedings{ cky2002, 8802 author = {Xiao-Chuan Cai and David E. Keyes and David P. Young}, 8803 title = {A Nonlinear Additive Schwarz Preconditioned Inexact Newton Method for Shocked 8804 Duct Flows}, 8805 booktitle = {Proceedings of the 13th International Conference on Domain Decomposition 8806 Methods}, 8807 pages = {343--350}, 8808 editor = {N. Debit and M.Garbey and R. Hoppe and J. Periaux and D. Keyes and Y. Kuznetsov}, 8809 publisher = {CIMNE, Barcelona, Spain}, 8810 note = {}, 8811 url = {http://www.ddm.org/DD13}, 8812 year = {2002}, 8813 petsc_uses = {KSP} 8814} 8815 8816@Conference{ li-etal:03, 8817 author = {Li, Z. and Lanteri S. and Saad, Y.}, 8818 title = {Multiplicative-additive preconditioning combination for general sparse linear 8819 systems}, 8820 booktitle = {2003 International Conference on Preconditioning Techniques for Large Sparse 8821 Matrix Problems in Scientific and Industrial Applications}, 8822 address = {Napa, California, USA}, 8823 date = {october 27-29}, 8824 year = {2003}, 8825 petsc_uses = {KSP} 8826} 8827 8828@Article{ bashir2008hessian, 8829 title = {Hessian-based model reduction for large-scale systems with initial-condition 8830 inputs}, 8831 author = {Bashir, O. and Willcox, K. and Ghattas, O. and van Bloemen Waanders, B. and Hill, 8832 J.}, 8833 journal = {International journal for numerical methods in engineering}, 8834 volume = {73}, 8835 number = {6}, 8836 pages = {844--868}, 8837 year = {2008}, 8838 publisher = {Wiley Online Library}, 8839 petsc_uses = {KSP} 8840} 8841 8842@Article{ bashir2007hessian, 8843 title = {Hessian-Based Model Reduction for Large-Scale Data Assimilation Problems}, 8844 author = {Bashir, O. and Ghattas, O. and Hill, J. and van Bloemen Waanders, B. and Willcox, 8845 K.}, 8846 journal = {Computational Science--ICCS 2007}, 8847 pages = {1010--1017}, 8848 year = {2007}, 8849 publisher = {Springer}, 8850 petsc_uses = {KSP} 8851} 8852 8853@Article{ akcelik2011fast, 8854 title = {Fast algorithms for {B}ayesian uncertainty quantification in large-scale linear 8855 inverse problems based on low-rank partial {H}essian approximations}, 8856 author = {Ak\c{c}elik, V. and Flath, H.P. and Ghattas, O. and Hill, J. and van Bloemen 8857 Waanders, B. and Wilcox, L.}, 8858 journal = {SIAM Journal on Scientific Computing}, 8859 volume = {33}, 8860 number = {1}, 8861 year = {2011}, 8862 petsc_uses = {KSP} 8863} 8864 8865@InProceedings{ ff2003, 8866 author = {Abul K. M. Fahimuddin and Heike Fassbender}, 8867 title = {Model Reduction for Large Scale Applications in Microsystem Technology}, 8868 booktitle = {Proceedings of the 2004 SIAM Parallel Processing Conference}, 8869 year = {2003}, 8870 petsc_uses = {KSP} 8871} 8872 8873@InProceedings{ d2b2004, 8874 author = {Masoud Darbandi and Gerry E. Schneider and Seyed Mehi Bostandoost}, 8875 title = {Parallel Computation of a Fully Implicit Finite Volume Method Using Different 8876 Ordering Strategies}, 8877 booktitle = {Proceedings of AIAA Conference, Reno, Nevada}, 8878 year = {2004}, 8879 petsc_uses = {KSP} 8880} 8881 8882@InProceedings{ d2v2005, 8883 author = {Masoud Darbandi and Gerry E. Schneider and Soheyl Vakili}, 8884 title = {A Comparative Study of Preconditioned Methods for Solving Fully Coupled Fluid 8885 Flow Equations}, 8886 booktitle = {The 13th Annual Conference on Computational Fluid Dynamics}, 8887 year = {2005}, 8888 petsc_uses = {KSP} 8889} 8890 8891@InProceedings{ dvs2006, 8892 author = {Masoud Darbandi and Soheyl Vakili and Gerry E. Schneider}, 8893 title = {The Employment of Algebraic Multigrid as a Preconditioner to Solve Fully Implicit 8894 Mixed Convection Equations}, 8895 booktitle = { The 44th AIAA Aerospace Sciences Meeting and Exhibit}, 8896 year = {2006}, 8897 petsc_uses = {KSP} 8898} 8899 8900@Article{ dsv2006, 8901 author = {Masoud Darbandi and Gerry E. Schneider and Soheyl Vakili}, 8902 title = {Using Different Preconditioned Krylov Subspace Methods to Solve Coupled Fluid 8903 Flow Equations}, 8904 journal = {Computational Fluid Dynamics}, 8905 year = {2006}, 8906 volume = {15}, 8907 number = {1}, 8908 petsc_uses = {KSP} 8909} 8910 8911@Article{ lahaye03, 8912 author = {Lahaye, D. and Vandewalle, S. and Hameyer, K.}, 8913 title = {An Algebraic Multilevel Preconditioner for Field-Circuit Coupled Problems}, 8914 journal = {J. Comput. Appl. Math.}, 8915 year = {2004}, 8916 pages = {267--275}, 8917 volume = {168}, 8918 petsc_uses = {KSP} 8919} 8920 8921@TechReport{ brmn, 8922 title = {Faster {PDE}-based Simulations Using Robust Composite Linear Solvers}, 8923 author = {S. Bhowmick and P. Raghavan and L. McInnes and B. Norris}, 8924 year = {2002}, 8925 type = {Technical Report}, 8926 institution = {ANL}, 8927 number = {ANL/MCS-P993-0902}, 8928 note = {To appear in Future Generation Computer Systems}, 8929 petsc_uses = {KSP} 8930} 8931 8932@InProceedings{ mnbr, 8933 author = {L. McInnes and B. Norris and S. Bhowmick and P. Raghavan}, 8934 title = {Adaptive Sparse Linear Solvers for Implicit {CFD} Using {Newton-Krylov} 8935 Algorithms}, 8936 booktitle = {Proceedings of the Second MIT Conference on Computational Fluid and Solid 8937 Mechanics}, 8938 year = {2003}, 8939 petsc_uses = {KSP} 8940} 8941 8942@InProceedings{ bmnr, 8943 author = {S. Bhowmick and L. McInnes and B. Norris and P. Raghavan}, 8944 title = {The Role of Multi-Method Linear Solvers in {PDE}-based Simulations}, 8945 booktitle = {Proceedings of the 2003 International Conference on Computational Science and its 8946 Applications, Lecture notes in Computer Science 2677}, 8947 editor = {V. Kumar and M. L. Gavrilova and C. J. K. Tan and P. L'Ecuyer}, 8948 pages = {828--839}, 8949 year = {2003}, 8950 petsc_uses = {KSP} 8951} 8952 8953@Article{ ph03, 8954 author = {M. Pernice and R. D. Hornung}, 8955 title = {Newton-Krylov-FAC Methods for Problems Discretized on Locally Refined Grids}, 8956 journal = {Computing and Visualization in Science}, 8957 year = {2003}, 8958 lab = {LANL}, 8959 petsc_uses = {KSP} 8960} 8961 8962@Article{ adams-02, 8963 author = {Adams, M.~F. and Brezina, M. and Hu, J. J. and Tuminaro, R. S}, 8964 journal = {J. Comp. Phys.}, 8965 number = {2}, 8966 pages = {593-610}, 8967 title = {Parallel multigrid smoothing: polynomial versus {G}auss--{S}eidel}, 8968 volume = {188}, 8969 year = {2003}, 8970 petsc_uses = {KSP} 8971} 8972 8973@InProceedings{ adams2001distributed, 8974 title = {A distributed memory unstructured {G}auss-{S}eidel algorithm for multigrid 8975 smoothers}, 8976 author = {Adams, M.F.}, 8977 booktitle = {Supercomputing, ACM/IEEE 2001 Conference}, 8978 pages = {14--14}, 8979 year = {2001}, 8980 organization = {IEEE}, 8981 petsc_uses = {KSP} 8982} 8983 8984@PhDThesis{ els01, 8985 author = {Ulrich Elsner}, 8986 title = {Static and Dynamic Graph Partitioning. A comparative study of existing 8987 algorithms}, 8988 school = {Technical University Chemnitz}, 8989 year = {2002}, 8990 publisher = {Logos Verlag, Berlin}, 8991 isbn = {3-89722-923-4}, 8992 annote = {Uses PETSc's high quality parallel algorithms to provide a framework to compare 8993 different graph partitioning algorithms}, 8994 petsc_uses = {KSP} 8995} 8996 8997@TechReport{ ckk02, 8998 title = {Pseudo-Transient Continuation and Differential-Algebraic Equations}, 8999 author = {Todd S. Coffey and C. T. Kelley and David E. Keyes}, 9000 year = {2002}, 9001 type = {Technical Report}, 9002 institution = {ODU}, 9003 url = {http://www.math.odu.edu/\~{ }keyes}, 9004 note = {Submitted to the special issue of the SIAM Journal of Scientific Computing 9005 dedicated to papers from the 2002 Copper Mountain Conference on Iterative 9006 Methods}, 9007 petsc_uses = {KSP} 9008} 9009 9010@Article{ gpw2002, 9011 title = {Balancing Neumann-Neumann Preconditioners for Mixed Approximations of 9012 Heterogeneous Problems in Linear Elasticity}, 9013 author = {Paulo Goldfeld and Luca F. Pavarino and Olof B. Widlund}, 9014 year = {2003}, 9015 pages = {283--324}, 9016 volume = {95}, 9017 url = {http://www.cs.nyu.edu/csweb/Research/TechReports/TR2002-825/TR2002-825.pdf}, 9018 journal = {Numerische Mathematik}, 9019 petsc_uses = {KSP} 9020} 9021 9022@Article{ dh1, 9023 title = {Scalability and FETI based algorithm for large discretized variational 9024 inequalities}, 9025 author = {Z Dostal and D Horak}, 9026 year = {2003}, 9027 pages = {347--357}, 9028 volume = {61}, 9029 url = {http://portal.acm.org/citation.cfm?id=770222.770239}, 9030 journal = {Mathematics and Computers in Simulation}, 9031 petsc_uses = {KSP} 9032} 9033 9034@InProceedings{ dhsv1, 9035 author = {Zdenek Dostal and David Horak and Jan Szweda and Vit Vondrak}, 9036 url = {http://cdcsp.univ-lyon1.fr/\~{ }dd13/DD13proc/Dostal.pdf}, 9037 title = {36 Scalabilities of FETI for Variational Inequalities and Contact Shape 9038 Optimization}, 9039 booktitle = {Proceedings of the 13th International Conference on Domain Decomposition 9040 Methods}, 9041 editor = { N. Debit and M. Garbey and R. Hoppe and J. Periaus and D. Keyes and Y. 9042 Kuznetsov}, 9043 petsc_uses = {KSP} 9044} 9045 9046@Article{ lahaye02, 9047 author = {Domenico Lahaye and S. Vandewalle and K. Hameyer}, 9048 title = {An Algebraic Multilevel Preconditioner for Field-Circuit Coupled Problems}, 9049 journal = {IEEEMAGN}, 9050 year = {2002}, 9051 volume = {38}, 9052 number = {2}, 9053 pages = {413-416}, 9054 petsc_uses = {KSP} 9055} 9056 9057@Article{ ckm01, 9058 author = {X.-C. Cai and D. E. Keyes and L. Marcinkowski}, 9059 url = {http://www.cs.colorado.edu/homes/cai/public_html/papers/10page.ps}, 9060 title = {Nonlinear additive {Schwarz} preconditioners and applications in computational 9061 fluid dynamics}, 9062 journal = {International Journal of Numerical Methods in Fluid Mechanics}, 9063 year = {2002}, 9064 volume = {40}, 9065 pages = {1463--1470}, 9066 petsc_uses = {KSP} 9067} 9068 9069@InProceedings{ cky01, 9070 author = {X.-C. Cai and D. E. Keyes and D. P. Young}, 9071 url = {http://www.cs.colorado.edu/homes/cai/public_html/papers/dd13_1d.ps}, 9072 title = {A nonlinear additive {Schwarz} preconditioned inexact {Newton} method for shocked 9073 duct flow}, 9074 booktitle = {Proceedings of the 13th International Conference on Domain Decomposition 9075 Methods}, 9076 editor = { N. Debit and M. Garbey and R. Hoppe and J. Periaus and D. Keyes and Y. 9077 Kuznetsov}, 9078 year = {2002}, 9079 petsc_uses = {KSP} 9080} 9081 9082@Article{ ck02, 9083 author = {X.-C. Cai and D. E. Keyes}, 9084 url = {http://www.cs.colorado.edu/homes/cai/public_html/papers/aspin.ps}, 9085 title = {Nonlinearly preconditioned inexact {Newton} algorithms}, 9086 journal = {SIAM J. Sci. Comput.}, 9087 year = {2002}, 9088 pages = {183--200}, 9089 volume = {24}, 9090 petsc_uses = {KSP} 9091} 9092 9093@Article{ c04, 9094 author = {Feng-Nan Hwang and X.-C. Cai}, 9095 url = {http://amath.colorado.edu/student/hwangf/papers/one-level-aspin.pdf}, 9096 title = {A parallel nonlinear additive {Schwarz} preconditioned inexact {Newton} algorithm 9097 for incompressible {Navier-Stokes} equations}, 9098 journal = {Journal of Computational Physics}, 9099 year = {2005}, 9100 volume = {204}, 9101 pages = {666--691}, 9102 petsc_uses = {KSP} 9103} 9104 9105@Article{ hc06, 9106 author = {Feng-Nan Hwang and X.-C. Cai}, 9107 url = {http://www.cs.colorado.edu/\~{ }cai/papers/aspin2_06.pdf}, 9108 title = {A Class of Parallel Two-Level Nonlinear {Schwarz} Preconditioned Inexact {Newton} 9109 Algorithms}, 9110 journal = {Computer Methods in Applied Mechanics and Engineering}, 9111 year = {2006}, 9112 volume = {196}, 9113 pages = {1603--1611}, 9114 petsc_uses = {KSP} 9115} 9116 9117@InProceedings{ adams-01, 9118 author = {Mark F. Adams}, 9119 title = {A Distributed Memory Unstructured {G}auss-{S}eidel Algorithm for Multigrid 9120 Smoothers}, 9121 booktitle = {ACM/IEEE Proceedings of SC2001: High Performance Networking and Computing}, 9122 address = {Denver, Colorado}, 9123 month = nov, 9124 year = {2001}, 9125 petsc_uses = {KSP} 9126} 9127 9128@Book{ 1dl, 9129 author = {Domenico Lahaye}, 9130 title = {Algebraic Multigrid for Two Dimensional Time-Harmonic Magnetic Field 9131 Computations}, 9132 year = {2001}, 9133 publisher = {Katholieke Universiteit Leuven}, 9134 notes = {Thesis}, 9135 petsc_uses = {KSP} 9136} 9137 9138@Article{ adams-00, 9139 author = {Adams, M.~F.}, 9140 journal = {International Journal for Numerical Methods in Engineering}, 9141 number = {8}, 9142 pages = {1241-1262}, 9143 title = {Parallel Multigrid Solvers for 3{D} Unstructured Finite Element Problems in Large 9144 Deformation Elasticity and Plasticity}, 9145 volume = {48}, 9146 year = {2000}, 9147 petsc_uses = {KSP} 9148} 9149 9150@Article{ adams2002evaluation, 9151 author = {Adams, M.~F.}, 9152 journal = {International Journal for Numerical Methods in Engineering}, 9153 number = {1}, 9154 pages = {519-534}, 9155 title = {Evaluation of Three Unstructured Multigrid Methods on 3{D} Finite Element 9156 Problems in Solid Mechanics}, 9157 volume = {55}, 9158 year = {2002}, 9159 petsc_uses = {KSP} 9160} 9161 9162@Article{ lahaye00, 9163 author = {Domenico Lahaye and De Gersem, H. and Vandewalle, S. and Hameyer, K.}, 9164 title = {Algebraic Multigrid for Complex Symmetric Systems}, 9165 journal = {IEEEMAGN}, 9166 year = {2000}, 9167 volume = {36}, 9168 number = {4}, 9169 pages = {1535--1538}, 9170 petsc_uses = {KSP} 9171} 9172 9173@InProceedings{ adams-99c, 9174 author = {Mark F. Adams and J. Demmel}, 9175 title = {Parallel Multigrid Solver Algorithms and Implementations for 3{D} Unstructured 9176 Finite Element Problems}, 9177 booktitle = {Proceedings of SC99: High Performance Networking and Computing}, 9178 address = {Portland, Oregon}, 9179 month = nov, 9180 year = {1999}, 9181 petsc_uses = {KSP} 9182} 9183 9184@Article{ chan95, 9185 author = {T. Chan and B. Smith and J. Zou}, 9186 title = {Overlapping {S}chwarz Methods on Unstructured Meshes using Non-matching Coarse 9187 Grids}, 9188 journal = {Numer. Math.}, 9189 year = {1995}, 9190 volume = {73}, 9191 pages = {149--167}, 9192 petsc_uses = {KSP} 9193} 9194 9195@TechReport{ adams-csd-98-993, 9196 pages = {11}, 9197 year = {1998}, 9198 type = {Technical Report}, 9199 number = {CSD-98-993}, 9200 institution = {University of California, Berkeley}, 9201 title = {A Parallel Maximal Independent Set Algorithm}, 9202 bibdate = {March 11, 1998}, 9203 author = {Mark F. Adams and James Demmel}, 9204 abstract = {The parallel construction of maximal independent sets is a useful building block 9205 for many algorithms in the computational sciences, including graph coloring and 9206 multigrid coarse grid creation on unstructured meshes. We present an efficient 9207 asynchronous maximal independent set algorithm for use on parallel computers, for 9208 ``well partitioned'' graphs, that arise from finite element (FE) models. For 9209 appropriately partitioned bounded degree graphs, it is shown that the running time 9210 of our algorithm under the P-RAM computational model is of $O(1)$, which is an 9211 improvement over the previous best P-RAM complexity for this class of graphs. We 9212 present numerical experiments on an IBM SP, that confirm our P-RAM complexity 9213 model is indicative of the performance one can expect with practical partitions on 9214 graphs from FE problems.}, 9215 month = mar, 9216 petsc_uses = {KSP} 9217} 9218 9219@Article{ benzigolubliesen2005, 9220 title = {Numerical solution of saddle point problems}, 9221 author = {Michele Benzi and Gene H. Golub and J\"org Liesen}, 9222 volume = {14}, 9223 journal = {Acta Numerica}, 9224 pages = {1-–137}, 9225 doi = {10.1017/S0962492904000212}, 9226 year = {2005} 9227} 9228 9229@Article{ mardal2011preconditioning, 9230 title = {Preconditioning discretizations of systems of partial differential equations}, 9231 author = {Kent-Andre Mardal and Ragnar Winther}, 9232 journal = {Numerical Linear Algebra with Applications}, 9233 volume = {18}, 9234 number = {1}, 9235 pages = {1--40}, 9236 year = {2011} 9237} 9238 9239@TechReport{ k676, 9240 year = {1994}, 9241 type = {Technical Report}, 9242 number = {TR1994-676}, 9243 institution = {New York University}, 9244 title = {An Optimal Preconditioner for a Class of Saddle Point Problems with a Penalty 9245 Term}, 9246 author = {Axel Klawonn}, 9247 url = {http://www.cs.nyu.edu/csweb/Research/TechReports/TR1994-676/TR1994-676.pdf}, 9248 petsc_uses = {KSP} 9249} 9250 9251@Book{ ak1, 9252 author = {Axel Klawonn}, 9253 title = {Preconditioners for Indefinite Problems}, 9254 year = {1995}, 9255 publisher = {Westfalishen Wilhelms-Universitat Munster}, 9256 url = {http://www.cs.nyu.edu/csweb/Research/TechReports/TR1996-716/TR1996-716.pdf}, 9257 notes = {Thesis}, 9258 petsc_uses = {KSP} 9259} 9260 9261@TechReport{ knepleykarpeev05, 9262 pages = {41}, 9263 year = {2005}, 9264 type = {Technical Report}, 9265 number = {ANL/MCS-P1295-1005}, 9266 institution = {Argonne National Laboratory}, 9267 title = {Flexible Representation of Computational Meshes}, 9268 author = {Matthew G. Knepley and Dmitry A. Karpeev}, 9269 abstract = {}, 9270 url = {ftp://info.mcs.anl.gov/pub/tech_reports/reports/P1295.pdf}, 9271 note = {\url{ftp://info.mcs.anl.gov/pub/tech_reports/reports/P1295.pdf}}, 9272 month = oct, 9273 petsc_uses = {DMPlex} 9274} 9275 9276@TechReport{ knepleykarpeev07a, 9277 pages = {14}, 9278 year = {2007}, 9279 type = {Technical Report}, 9280 number = {ANL/MCS-P1455-0907}, 9281 institution = {Argonne National Laboratory}, 9282 title = {Mesh Algorithms for {PDE} with {Sieve} {I}: {Mesh} Distribution}, 9283 author = {Matthew G. Knepley and Dmitry A. Karpeev}, 9284 abstract = {}, 9285 url = {ftp://info.mcs.anl.gov/pub/tech_reports/reports/P1455.pdf}, 9286 note = {\url{ftp://info.mcs.anl.gov/pub/tech_reports/reports/P1455.pdf}}, 9287 month = feb, 9288 petsc_uses = {DMPlex} 9289} 9290 9291@Article{ knepleykarpeev09, 9292 author = {Matthew G. Knepley and Dmitry A. Karpeev}, 9293 title = {Mesh Algorithms for {PDE} with {Sieve} {I}: {Mesh} Distribution}, 9294 journal = {Scientific Programming}, 9295 volume = {17}, 9296 number = {3}, 9297 pages = {215--230}, 9298 year = {2009}, 9299 doi = {10.3233/SPR-2009-0249}, 9300 url = {http://arxiv.org/abs/0908.4427}, 9301 note = {\url{http://arxiv.org/abs/0908.4427}}, 9302 petsc_uses = {DMPlex} 9303} 9304 9305@Article{ biezuner2012computing, 9306 author = {Biezuner, Rodney and Brown, Jed and Ercole, Grey and Martins, Eder}, 9307 affiliation = {Departamento de Matem\'atica—ICEx, Universidade Federal de Minas Gerais, Av. 9308 Ant\^onio Carlos 6627, Caixa Postal 702, 30161-970 Belo Horizonte, MG, Brazil}, 9309 title = {Computing the First Eigenpair of the $p$-{L}aplacian via Inverse Iteration of 9310 Sublinear Supersolutions}, 9311 journal = {Journal of Scientific Computing}, 9312 publisher = {Springer Netherlands}, 9313 issn = {0885-7474}, 9314 keyword = {Mathematics and Statistics}, 9315 pages = {180--201}, 9316 volume = {52}, 9317 issue = {1}, 9318 year = {2012}, 9319 doi = {10.1007/s10915-011-9540-0}, 9320 petsc_uses = {KSP} 9321} 9322 9323% LiteralHTML: 9324% LiteralHTML: <a name="books"><H3><center>Books</center></H3> 9325% LiteralHTML: 9326@Book{ knepley2017, 9327 title = {Computational Science I}, 9328 author = {Matthew G. Knepley}, 9329 url = {https://www.cse.buffalo.edu/~knepley/classes/caam519/CSBook.pdf}, 9330 note = {\url{https://www.cse.buffalo.edu/~knepley/classes/caam519/CSBook.pdf}}, 9331 publisher = {PETSc}, 9332 year = {2017}, 9333 petsc_uses = {KSP} 9334} 9335 9336@Article{ verleyeuser, 9337 title = {{User friendly permeability predicting software for technical textiles}}, 9338 author = {Verleye, B. and Morren, G. and Lomov, S.V. and Sol, H. and Verpoest, I. and 9339 Roose, D.}, 9340 journal = {status: published}, 9341 issn = {1560-6074}, 9342 publisher = {Hong Kong Polytechnic University, Hong Kong Institution of Textile and Apparel}, 9343 petsc_uses = {KSP} 9344} 9345 9346@Book{ pacheco, 9347 author = {Peter Pacheco}, 9348 title = {Parallel Programming with MPI}, 9349 year = {1997}, 9350 publisher = {Morgan-Kaufmann}, 9351 note = {Devotes a couple of sections to PETSc}, 9352 petsc_uses = {KSP} 9353} 9354 9355@Book{ 1sbg, 9356 author = {Barry F. Smith and Petter Bj{\o}rstad and William D. Gropp}, 9357 title = {Domain Decomposition: Parallel Multilevel Methods for Elliptic Partial 9358 Differential Equations}, 9359 year = {1996}, 9360 publisher = {Cambridge University Press}, 9361 url = {http://www.mcs.anl.gov/~bsmith/ddbook.html}, 9362 petsc_uses = {KSP} 9363} 9364 9365@Misc{ petsc-fem:homepage, 9366 title = {{PETSc-FEM}: A General Purpose, Parallel, Multi-physics {FEM} Program}, 9367 author = {M. Storti and N. Nigro and R. Paz and L. Dalcin and E. Lopez and L. Battaglia and 9368 G. Rodriguez and G. Filippini}, 9369 howpublished = {\url{http://www.cimec.org.ar/twiki/bin/view/Cimec/PETScFEM}}, 9370 petsc_uses = {KSP} 9371} 9372 9373@Misc{ petsc4py-web-page, 9374 author = {Lisandro Dalcin}, 9375 title = {{PETSc} for {Python} -- {Python} bindings for {PETSc} libraries}, 9376 howpublished = {\url{http://code.google.com/p/petsc4py/}}, 9377 note = {http://code.google.com/p/petsc4py/}, 9378 petsc_uses = {KSP} 9379} 9380 9381@Article{ libmeshpaper06, 9382 author = {B.~S.~Kirk and J.~W.~Peterson and R.~H.~Stogner and G.~F.~Carey}, 9383 title = {{\texttt{libMesh}: A C++ Library for Parallel Adaptive Mesh Refinement/Coarsening 9384 Simulations}}, 9385 journal = {Engineering with Computers}, 9386 volume = {22}, 9387 number = {3--4}, 9388 pages = {237--254}, 9389 year = {2006}, 9390 doi = {10.1007/s00366-006-0049-3}, 9391 petsc_uses = {KSP} 9392} 9393 9394@Misc{ sisiphus:homepage, 9395 title = {{SISIPHUS}: Scalable Ice-Sheet Solvers and Infrastructure for Petascale, 9396 High-Resolution, Unstructured Simulations}, 9397 author = {T. {Tautges et al.}}, 9398 howpublished = {\url{http://trac.mcs.anl.gov/projects/sisiphus/wiki}}, 9399 petsc_uses = {KSP} 9400} 9401 9402@Misc{ pflotran:homepage, 9403 title = {{PFLOTRAN} project}, 9404 author = {Ben Andre and Gautam Bisht and Nathan Collier and Glenn Hammond and Satish Karra 9405 and Jitendra Kumar and Peter Lichtner and Richard Mills}, 9406 howpublished = {\url{http://pflotran.org/}}, 9407 petsc_uses = {KSP} 9408} 9409 9410@Misc{ pism:homepage, 9411 title = {{PISM}: A Parallel Ice Sheet Model}, 9412 author = {E. {Bueler et al.}}, 9413 howpublished = {\url{http://pism-docs.org}}, 9414 petsc_uses = {KSP} 9415} 9416 9417@Misc{ dohp:homepage, 9418 title = {Dohp: Dual order $hp$-finite elements}, 9419 author = {J. Brown}, 9420 howpublished = {\url{http://dohp.org}}, 9421 petsc_uses = {KSP} 9422} 9423 9424@Article{ mccourtrognlienetal12, 9425 title = {Improving parallel scalability for edge plasma transport simulations with neutral 9426 gas species}, 9427 author = {M. McCourt and T. D. Rognlien and L. C. McInnes and H. Zhang}, 9428 journal = {Computational Science and Discovery}, 9429 year = {2012}, 9430 volume = {5}, 9431 number = {014012}, 9432 doi = {10.1088/1749-4699/5/1/014012}, 9433 note = {Focus on 22nd International Conference on Numerical Simulations of Plasmas (ICNSP 9434 2011)}, 9435 petsc_uses = {KSP} 9436} 9437 9438@Misc{ petclaw-github, 9439 title = {Pet{C}law Software}, 9440 author = {Kyle T. Mandli and David I. Ketcheson and Amal Alghamdi and Aron Ahmadia}, 9441 year = {2011}, 9442 howpublished = {\url{https://github.com/pyclaw/pyclaw}}, 9443 petsc_uses = {KSP} 9444} 9445 9446@Misc{ pyclaw-web-page, 9447 author = {Kyle T. Mandli and David I. Ketcheson and others}, 9448 title = {{PyClaw} software}, 9449 howpublished = {\url{http://clawpack.github.io/doc/pyclaw/}}, 9450 url = {http://clawpack.github.io/doc/pyclaw/}, 9451 year = {2012}, 9452 petsc_uses = {KSP} 9453} 9454 9455@Article{ ketcheson2011highorder, 9456 title = {High-order wave propagation algorithms for general hyperbolic systems}, 9457 author = {Ketcheson, David I. and Parsani, Matteo and LeVeque, Randall J.}, 9458 year = {2011}, 9459 note = {submitted}, 9460 petsc_uses = {KSP} 9461} 9462 9463@Article{ biros2005pln1, 9464 title = {{Parallel {Lagrange-Newton-Krylov-Schur} methods for {PDE} constrained 9465 optimization. Part I: The {Krylov-Schur} solver}}, 9466 author = {Biros, G. and Ghattas, O.}, 9467 journal = {SIAM Journal on Scientific Computing}, 9468 volume = {27}, 9469 number = {2}, 9470 pages = {687--713}, 9471 year = {2005}, 9472 publisher = {Society for Industrial and Applied Mathematics Philadelphia, PA, USA}, 9473 petsc_uses = {KSP} 9474} 9475 9476@Article{ biros2005pln2, 9477 title = {Parallel {Lagrange-Newton-Krylov-Schur} methods for {PDE}-constrained 9478 optimization. Part {II}: The {Lagrange Newton} solver, and its application to 9479 optimal control of steady viscous flows}, 9480 author = {Biros, G. and Ghattas, O.}, 9481 journal = {SIAM Journal on Scientific Computing}, 9482 volume = {27}, 9483 number = {2}, 9484 pages = {714--739}, 9485 year = {2005}, 9486 publisher = {Society for Industrial and Applied Mathematics Philadelphia, PA, USA}, 9487 petsc_uses = {KSP} 9488} 9489 9490@Misc{ issm:homepage, 9491 title = {{I}ce {S}heet {S}ystem {M}odel}, 9492 author = {Eric Larour and Mathieu Morlighem and Helene Seroussi}, 9493 year = {2010}, 9494 note = {\href{http://issm.jpl.nasa.gov}{\url{issm.jpl.nasa.gov}}}, 9495 petsc_uses = {KSP} 9496} 9497 9498@Article{ morlighem2010spatial, 9499 title = {Spatial patterns of basal drag inferred using control methods from a 9500 full-{S}tokes and simpler models for {P}ine {I}sland {G}lacier, {W}est 9501 {A}ntarctica}, 9502 author = {Morlighem, M. and Rignot, E. and Seroussi, H. and Larour, E. and Dhia, H.B. and 9503 Aubry, D.}, 9504 journal = {Geophysical Research Letters}, 9505 volume = {37}, 9506 number = {14}, 9507 pages = {L14502}, 9508 year = {2010}, 9509 publisher = {American Geophysical Union}, 9510 petsc_uses = {KSP} 9511} 9512 9513@Article{ jardin2012plasmas, 9514 title = {Multiple timescale calculations of sawteeth and other global macroscopic dynamics 9515 of tokamak plasmas}, 9516 author = {S. C. Jardin and N. Ferraro and J. Breslau and J. Chen}, 9517 journal = {Computational Science \& Discovery}, 9518 volume = {5}, 9519 number = {1}, 9520 url = {http://stacks.iop.org/1749-4699/5/014002}, 9521 year = {2012}, 9522 petsc_uses = {KSP} 9523} 9524 9525@Article{ cmz2016, 9526 title = {Analysis and Practical Use of Flexible {BiCGStab}}, 9527 author = {Jie Chen and Lois Curfman McInnes and Hong Zhang}, 9528 journal = {Journal of Scientific Computing}, 9529 publisher = {Springer}, 9530 pages = {803--825}, 9531 volume = {68}, 9532 issue = {2}, 9533 url = {http://link.springer.com/article/10.1007/s10915-015-0159-4}, 9534 doi = {10.1007/s10915-015-0159-4}, 9535 year = {2016}, 9536 note = {Also preprint ANL/MCS-P3039-0912}, 9537 petsc_uses = {KSP} 9538} 9539 9540@Article{ knepleybrownruppsmith13, 9541 author = {{Knepley}, M.~G. and {Brown}, J. and {Rupp}, K. and {Smith}, B.~F.}, 9542 title = {Achieving High Performance with Unified Residual Evaluation}, 9543 journal = {ArXiv e-prints}, 9544 eprint = {1309.1204}, 9545 archiveprefix = {arXiv}, 9546 primaryclass = {cs.MS}, 9547 keywords = {Computer Science - Mathematical Software, Computer Science - Computational 9548 Engineering, Finance, and Science}, 9549 year = {2013}, 9550 month = sep, 9551 adsurl = {http://adsabs.harvard.edu/abs/2013arXiv1309.1204K}, 9552 adsnote = {Provided by the SAO/NASA Astrophysics Data System}, 9553 petsc_uses = {KSP} 9554} 9555 9556@Book{ fenicsbook, 9557 title = {Automated Solution of Differential Equations by the Finite Element Method: The 9558 FEniCS Book}, 9559 series = {Lecture Notes in Computational Science and Engineering}, 9560 volume = {84}, 9561 editor = {Anders Logg, Kent-Andre Mardal, Garth Wells}, 9562 publisher = {Springer}, 9563 isbn = {978-3-642-23098-1}, 9564 year = {2012}, 9565 petsc_uses = {KSP} 9566} 9567 9568@Article{ demidovahnertruppgottschling12, 9569 author = {{Demidov}, D. and {Ahnert}, K. and {Rupp}, K. and {Gottschling}, P.}, 9570 title = {{Programming CUDA and OpenCL: A Case Study Using Modern C++ Libraries}}, 9571 journal = {ArXiv e-prints}, 9572 archiveprefix = {arXiv}, 9573 eprint = {1212.6326}, 9574 primaryclass = {cs.MS}, 9575 keywords = {Computer Science - Mathematical Software, Computer Science - Distributed, 9576 Parallel, and Cluster Computing, Physics - Computational Physics}, 9577 year = {2012}, 9578 month = dec, 9579 adsurl = {http://adsabs.harvard.edu/abs/2012arXiv1212.6326D}, 9580 adsnote = {Provided by the SAO/NASA Astrophysics Data System}, 9581 petsc_uses = {KSP} 9582} 9583 9584@InProceedings{ viennacl, 9585 author = {Rupp, K. and Rudolf, F. and Weinbub, J.}, 9586 title = {{ViennaCL - A High Level Linear Algebra Library for GPUs and Multi-Core CPUs}}, 9587 booktitle = {Intl.~Workshop on GPUs and Scientific Applications}, 9588 year = {2010}, 9589 pages = {51-56}, 9590 petsc_uses = {KSP} 9591} 9592 9593@Article{ knepleybrownmcinnessmithruppadams2015, 9594 title = {Exascale Computing without Threads}, 9595 author = {Matthew G. Knepley and Jed Brown and Lois Curfman McInnes and Barry Smith and 9596 Karl Rupp and Mark Adams}, 9597 url = {https://figshare.com/articles/Exascale_Computing_without_Threads-Barry_Smith_pdf/5824950}, 9598 note = {Whitepaper for the DOE High Performance Computing Operational Review (HPCOR) on 9599 Scientific Software Architecture for Portability and Performance}, 9600 doi = {10.6084/m9.figshare.5824950.v1}, 9601 year = {2015}, 9602 petsc_uses = {KSP} 9603} 9604 9605@Article{ knepleybrownmcinnessmithruppadams2015b, 9606 title = {Overview of the {PETSc} Library}, 9607 author = {Matthew G. Knepley and Jed Brown and Lois Curfman McInnes and Barry Smith and 9608 Karl Rupp and Mark Adams}, 9609 url = {http://www.orau.gov/hpcor2015/whitepapers/Overview_of_the_PETSc_Library-Lois_McInnes.pdf}, 9610 note = {Whitepaper for the DOE High Performance Computing Operational Review (HPCOR) on 9611 Scientific Software Architecture for Portability and Performance}, 9612 year = {2015}, 9613 petsc_uses = {KSP} 9614} 9615 9616@InBook{ balaybrownknepleymcinnessmith2015, 9617 author = {Satish Balay and Jed Brown and Matthew G. Knepley and Lois McInnes and Barry 9618 Smith}, 9619 bookeditor = {J. Carver}, 9620 title = {Software Engineering for Science}, 9621 chapter = {Providing Mixed Language and Legacy Support within a Library}, 9622 publisher = {Taylor \& Francis}, 9623 year = {2015}, 9624 petsc_uses = {KSP} 9625} 9626 9627@Article{ ruppbalaybrownknepleymcinnessmith2015, 9628 title = {On The Evolution Of User Support Topics in Computational Science and Engineering 9629 Software}, 9630 author = {Karl Rupp and Satish Balay and Jed Brown and Matthew G. Knepley and Lois Curfman 9631 McInnes and Barry F. Smith}, 9632 note = {Whitepaper for Computational Science \& Engineering Software Sustainability and 9633 Productivity Challenges}, 9634 journal = {ArXiv e-prints}, 9635 archiveprefix = {arXiv}, 9636 eprint = {1510.01122}, 9637 year = {2015}, 9638 petsc_uses = {KSP} 9639} 9640 9641@InProceedings{ knepley2013accurately, 9642 title = {Accurately Citing Software and Algorithms Used in Publications}, 9643 author = {Knepley, Matthew G. and Brown, Jed and McInnes, Lois Curfman and Smith, Barry 9644 F.}, 9645 year = {2013}, 9646 booktitle = {First Workshop on Sustainable Software for Science: Practice and Experiences 9647 (WSSSPE), held at SC13}, 9648 doi = {10.6084/m9.figshare.785731}, 9649 petsc_uses = {KSP} 9650} 9651 9652@InProceedings{ milleretal2013, 9653 title = {Package Management Practice Essential for Interoperability: Lessons Learned and 9654 Strategies Developed for {FASTMath}}, 9655 author = {Mark C. Miller and Lori Diachin and Satish Balay and Lois Curfman McInnes and 9656 Barry Smith}, 9657 year = {2013}, 9658 booktitle = {First Workshop on Sustainable Software for Science: Practice and Experiences 9659 (WSSSPE), held at SC13}, 9660 doi = {10.6084/m9.figshare.789055}, 9661 petsc_uses = {KSP} 9662} 9663 9664@TechReport{ dudsonetal2012, 9665 title = {Improved Nonlinear Solvers in {BOUT++}}, 9666 author = {Ben Dudson and Sean Farley and Lois Curfman McInnes}, 9667 institution = {Argonne National Laboratory}, 9668 number = {ANL/MCS-P3025-0812}, 9669 year = {2012}, 9670 petsc_uses = {KSP} 9671} 9672 9673@Misc{ brown13, 9674 author = {J. Brown}, 9675 title = {Scalable Repository Workflows}, 9676 note = {whitepaper submitted to DOE Workshop on Software Productivity for Extreme-Scale 9677 Science, available via \url{http://www.orau.gov/swproductivity2014/papers.htm}}, 9678 year = {2013}, 9679 petsc_uses = {KSP} 9680} 9681 9682@Misc{ starforest11, 9683 title = {Star forests as a parallel communication model}, 9684 author = {Jed Brown}, 9685 url = {https://jedbrown.org/files/StarForest.pdf}, 9686 year = {2011}, 9687 petsc_uses = {KSP} 9688} 9689 9690@Misc{ brownknepleysmith13, 9691 author = {J. Brown and M. Knepley and B. Smith}, 9692 title = {Run-time Extensibility: Anything Less is Unsustainable}, 9693 note = {whitepaper submitted to DOE Workshop on Software Productivity for Extreme-Scale 9694 Science, available via \url{http://www.orau.gov/swproductivity2014/papers.htm}}, 9695 year = {2013}, 9696 petsc_uses = {KSP} 9697} 9698 9699@Article{ jzhaoyliwkliu15, 9700 author = {J. Zhao and Y. Li and W.K. Liu}, 9701 title = {Predicting band structure of 3{D} mechanical metamaterials with complex geometry 9702 via {XFEM}}, 9703 journal = {Computational Mechanics}, 9704 year = {2015}, 9705 url = {http://link.springer.com/article/10.1007/s00466-015-1129-2}, 9706 petsc_uses = {KSP} 9707} 9708 9709@Article{ alisic14, 9710 author = {L. Alisic and J.F. Rudge and R.F. Katz and G. Wells and S. Rhebergen}, 9711 title = {Compaction around a rigid, circular inclusion in partially molten rock}, 9712 journal = {J. Geophys. Res.}, 9713 year = {2014}, 9714 volume = {119}, 9715 number = {7}, 9716 pages = {5903-5920}, 9717 doi = {10.1002/2013JB010906}, 9718 petsc_uses = {KSP} 9719} 9720 9721@Article{ rhebergen14, 9722 author = {S. Rhebergen and G. Wells and R.F. Katz and A. Wathen}, 9723 title = {Analysis of block preconditioners for models of coupled magma mantle dynamics}, 9724 journal = {SIAM J. Sci. Comp.}, 9725 year = {2014}, 9726 volume = {36}, 9727 number = {4}, 9728 pages = {1960-1977}, 9729 doi = {10.1137/130946678}, 9730 petsc_uses = {KSP} 9731} 9732 9733@Article{ allwright14, 9734 author = {J. Allwright and R.F. Katz}, 9735 title = {Pipe Poiseuille flow of viscously anisotropic, partially molten rock}, 9736 journal = {Geophys. J. Int.}, 9737 year = {2014}, 9738 volume = {199}, 9739 number = {3}, 9740 pages = {1608--1624}, 9741 doi = {10.1093/gji/ggu345}, 9742 petsc_uses = {KSP} 9743} 9744 9745@Misc{ gropp10, 9746 author = {William D. Gropp}, 9747 title = {Update on libraries for {B}lue {W}aters}, 9748 address = {Bordeaux, France}, 9749 year = {2010}, 9750 url = {http://jointlab.ncsa.illinois.edu/events/workshop3/pdf/presentations/Gropp-Update-on-Libraries.pdf}, 9751 petsc_uses = {KSP} 9752} 9753 9754@Article{ ssm2016, 9755 author = {P. Sanan and S.M. Schnepp and D.A. May}, 9756 title = {Pipelined, Flexible {Krylov} Subspace Methods}, 9757 journal = {SIAM Journal on Scientific Computing}, 9758 volume = {38}, 9759 number = {5}, 9760 pages = {C441-C470}, 9761 year = {2016}, 9762 doi = {10.1137/15M1049130}, 9763 petsc_uses = {KSP} 9764} 9765 9766@InProceedings{ mayknepley2017, 9767 title = {{DMSwarm}: Particles in {PETSc}}, 9768 author = {Dave A May and Matthew G Knepley}, 9769 booktitle = {EGU General Assembly Conference Abstracts}, 9770 volume = {19}, 9771 pages = {10133}, 9772 year = {2017}, 9773 petsc_uses = {KSP} 9774} 9775 9776@InProceedings{ adamsbrownknepley2013, 9777 author = {Mark F. Adams and Jed Brown and Matthew G. Knepley}, 9778 title = {Low-communication techniques for extreme-scale multilevel solvers}, 9779 booktitle = {Exascale Mathematics Workshop, Aug 21--22, Washington, DC}, 9780 organization = {DOE Office of Advanced Scientific Computing Research}, 9781 year = {2013}, 9782 petsc_uses = {KSP} 9783} 9784 9785@Article{ bhallagriffithknepleyadamsguy2017, 9786 title = {Scalable smoothing strategies for a geometric multigrid method for the immersed 9787 boundary equations}, 9788 author = {Amneet Pal Singh Bhalla and Boyce E. Griffith and Matthew G. Knepley and Mark F. 9789 Adams and Robert D. Guy}, 9790 journal = {arXiv e-prints}, 9791 eprint = {1612.02208}, 9792 year = {2017}, 9793 note = {\url{http://arxiv.org/abs/1612.02208}}, 9794 petsc_uses = {KSP} 9795} 9796 9797@Article{ zampini2016pcbddc, 9798 title = {{PCBDDC}: a class of robust dual-primal methods in {PETSc}}, 9799 author = {Zampini, Stefano}, 9800 journal = {SIAM Journal on Scientific Computing}, 9801 volume = {38}, 9802 number = {5}, 9803 pages = {S282--S306}, 9804 year = {2016}, 9805 publisher = {SIAM}, 9806 petsc_uses = {KSP} 9807} 9808 9809@Article{ jolivetromanzampini2020, 9810 title = {{KSPHPDDM} and {PCHPDDM}: extending {PETSc} with advanced {Krylov} methods and 9811 robust multilevel overlapping {Schwarz} preconditioners}, 9812 author = {Pierre Jolivet and Jose Roman and Stefano Zampini}, 9813 journal = {Computers and Mathematics with Applications}, 9814 volume = {84}, 9815 pages = {277--295}, 9816 year = {2020} 9817} 9818 9819@Article{ zampinitu2017, 9820 title = {Multilevel {BDDC} deluxe algorithms with adaptive coarse spaces for flow in 9821 porous media}, 9822 author = {Stefano Zampini and Xuemin Tu}, 9823 journal = {SIAM Journal of Scientific Computing}, 9824 volume = {39}, 9825 number = {4}, 9826 pages = {A1389--A1415}, 9827 year = {2017} 9828} 9829 9830@Article{ ohwidlundzampinidohrmann2017, 9831 title = {{BDDC} algorithms with deluxe scaling and adaptive selection of primal 9832 constraints for {Raviart-Thomas} vector fields}, 9833 author = {D.-S. Oh and Olof B. Widlund and Stefano Zampini and Clark Dohrmann}, 9834 journal = {Mathematics of Computation}, 9835 volume = {87}, 9836 number = {310}, 9837 pages = {659--692}, 9838 year = {2017} 9839} 9840 9841@Article{ veigapavarinoscacchiwidlundzampini2016, 9842 title = {Adaptive selection of primal constraints for isogeometric {BDDC} deluxe 9843 preconditioners}, 9844 author = {L. Beirao Da Veiga and Luca F. Pavarino and S. Scacchi and Olof B. Widlund and 9845 Stefano Zampini}, 9846 journal = {SIAM Journal of Scientific Computing}, 9847 volume = {39}, 9848 number = {1}, 9849 pages = {A281--A302}, 9850 year = {2016} 9851} 9852 9853@Article{ pavarinoscacchiwidlundzampini2018, 9854 title = {Isogeometric {BDDC} deluxe preconditioners for linear elasticity for isogeometric 9855 analysis}, 9856 author = {Luca F. Pavarino and S. Scacchi and Olof B. Widlund and Stefano Zampini}, 9857 journal = {Mathematical Models and Methods in Applied Sciences}, 9858 volume = {28}, 9859 number = {7}, 9860 pages = {1337--1370}, 9861 year = {2018} 9862} 9863 9864@Article{ bergervergiatwaisman2017, 9865 title = {An overlapping Domain Decomposition preconditioning method for monolithic 9866 solution of shear bands}, 9867 author = {Luc Berger-Vergiat and Haim Waisman}, 9868 journal = {Computer Methods in Applied Mechanics and Engineering}, 9869 volume = {318}, 9870 pages = {33--60}, 9871 year = {2017}, 9872 petsc_uses = {KSP} 9873} 9874 9875@Article{ abhyankarmaldonadosmithzhang2020, 9876 title = {{PETSc} {DMNetwork}: A Library for Scalable Network PDE-Based Multiphysics 9877 Simulations}, 9878 author = {S. Abhyankar and G. Betrie and D.A. Maldonado and L.C. McInnes and B. Smith and 9879 H. Zhang}, 9880 journal = {ACM Transactions on Mathematical Software}, 9881 volume = {46}, 9882 number = {1}, 9883 year = {2020}, 9884 doi = {10.1145/3344587}, 9885 petsc_uses = {KSP} 9886} 9887 9888@InProceedings{ zhangellpack2018, 9889 author = {Hong Zhang and Richard T. Mills and Karl Rupp and Barry F. Smith}, 9890 title = {Vectorized Parallel Sparse Matrix-Vector Multiplication in {PETSc} Using 9891 {AVX-512}}, 9892 booktitle = {Proceedings of the 47th International Conference on Parallel Processing}, 9893 year = {2018}, 9894 petsc_uses = {KSP} 9895} 9896 9897@Misc{ petsc-user-meetings:website, 9898 title = {{PETSc User Meetings}}, 9899 key = {PETSc User Meetings}, 9900 howpublished = {\url{https://petsc.org/release/community/meetings/meeting}}, 9901 petsc_uses = {KSP} 9902} 9903 9904@Article{ flexible-bicgstab-chen16, 9905 title = {Analysis and Practical Use of Flexible {BiCGStab}}, 9906 author = {J. Chen and L.C. McInnes and H. Zhang}, 9907 journal = {Journal of Scientific Computing}, 9908 volume = {68}, 9909 number = {2}, 9910 month = jul, 9911 year = {2016}, 9912 pages = {803--825}, 9913 doi = {10.1007/s10915-015-0159-4}, 9914 petsc_uses = {KSP} 9915} 9916 9917@Misc{ petsc-extensibility2016, 9918 author = {M. Knepley and D. A. May and J. Brown and B. Smith}, 9919 title = {{Extensibility in PETSc}}, 9920 note = {SIAM News, available via 9921 \url{https://sinews.siam.org/Details-Page/extensibility-in-petsc}}, 9922 year = {2016}, 9923 petsc_uses = {KSP} 9924} 9925 9926@Misc{ error-estimation-whitepaper2017, 9927 author = {E. Constantinescu and O. Marin and T. Munson and B. Smith and H. Zhang}, 9928 title = {End-to-end error estimation and control}, 9929 note = {whitepaper for 2017 ASCR Applied Mathematics PI Meeting}, 9930 doi = {10.6084/m9.figshare.5339866}, 9931 year = {2017}, 9932 petsc_uses = {KSP} 9933} 9934 9935@Misc{ petsc-user-support15, 9936 title = {On the Evolution of User Support Topics in Computational Science and Engineering 9937 Software}, 9938 author = {K. Rupp and S. Balay and J. Brown and M. Knepley and L. C. McInnes and B. Smith}, 9939 note = {Workshop on CSE Software Sustainability and Productivity (CSESSP) Challenges, Oct 9940 15-16, 2015}, 9941 year = {2015}, 9942 petsc_uses = {KSP} 9943} 9944 9945@InBook{ petsc-mixed-language-support2016, 9946 title = {Numerical Library Support for High-Performance Mixed Language Applications and 9947 Legacy Code}, 9948 author = {S. Balay and J. Brown and M. Knepley and L.C. McInnes and B. Smith}, 9949 booktitle = {Software Engineering for Science}, 9950 editors = {J. Carver et al.}, 9951 publisher = {CRC Press}, 9952 pages = {201--214}, 9953 year = {2016}, 9954 petsc_uses = {KSP} 9955} 9956 9957@InProceedings{ konolige2018parallel, 9958 title = {A Parallel Solver for Graph {L}aplacians}, 9959 author = {Tristan Konolige and Jed Brown}, 9960 booktitle = {Proceedings of the Platform for Advanced Scientific Computing (PASC)}, 9961 doi = {10.1145/3218176.3218227}, 9962 note = {Best Paper Award}, 9963 archiveprefix = {arXiv}, 9964 eprint = {1705.06266}, 9965 year = {2018}, 9966 petsc_uses = {KSP} 9967} 9968 9969@InProceedings{ werner-kimn2019, 9970 title = {Parallel implementation of AC optimal power flow and time-constrained optimal 9971 power flow using high-performance computing}, 9972 author = {Alex Werner and Kapil Duwadi and Nicholas Stegmeier and Timothy M. Hansen and 9973 Jung-Han Kimn}, 9974 booktitle = {IEEE 9th Annual Computing and Communication Workshop and Conference (CCWC 2019)}, 9975 note = {Best Paper in Track}, 9976 year = {2019}, 9977 petsc_uses = {KSP} 9978} 9979 9980@MastersThesis{ rinaldo-ceresoli18, 9981 author = {Stefano Guido Rinaldo and Andrea Ceresoli}, 9982 title = {Newton–Krylov–Schwarz Methods for Distributed Power Flow and Related 9983 Applications}, 9984 school = {Politecnico di Milano}, 9985 year = {2018}, 9986 month = apr, 9987 petsc_uses = {KSP} 9988} 9989 9990@Article{ sananschneppmay2016, 9991 title = {Pipelined, Flexible {K}rylov Subspace Methods}, 9992 author = {P. Sanan and S. M. Schnepp and D. A. May}, 9993 journal = {SIAM Journal on Scientific Computing}, 9994 volume = {38}, 9995 number = {5}, 9996 pages = {C441-C470}, 9997 year = {2016}, 9998 doi = {10.1137/15M1049130}, 9999 petsc_uses = {KSP} 10000} 10001 10002@Article{ petscsf2022, 10003 author = {Zhang, Junchao and Brown, Jed and Balay, Satish and Faibussowitsch, Jacob and 10004 Knepley, Matthew and Marin, Oana and Mills, Richard Tran and Munson, Todd and 10005 Smith, Barry F. and Zampini, Stefano}, 10006 journal = {IEEE Transactions on Parallel and Distributed Systems}, 10007 title = {The {PetscSF} Scalable Communication Layer}, 10008 year = {2022}, 10009 volume = {33}, 10010 number = {4}, 10011 pages = {842-853}, 10012 doi = {10.1109/TPDS.2021.3084070} 10013} 10014 10015@Article{ brandt2000, 10016 title = {General highly accurate algebraic coarsening}, 10017 author = {Achi Brandt}, 10018 journal = {Electronic Transactions on Numerical Analysis}, 10019 volume = {10}, 10020 number = {9680}, 10021 pages = {1--20}, 10022 issn = {10689613}, 10023 year = {2000} 10024} 10025 10026@Article{ dalcinpazklercosimo2011, 10027 title = {Parallel distributed computing using Python}, 10028 author = {Lisandro D. Dalcin and Rodrigo R. Paz and Pablo A. Kler and Alejandro Cosimo}, 10029 journal = {Advances in Water Resources}, 10030 volume = {34}, 10031 number = {9}, 10032 pages = {1124 - 1139}, 10033 note = {New Computational Methods and Software Tools}, 10034 issn = {0309-1708}, 10035 doi = {10.1016/j.advwatres.2011.04.013}, 10036 year = {2011} 10037} 10038 10039@Article{ behnelbradshawcitrodalcinseljebotnsmith2011, 10040 title = {Cython: The Best of Both Worlds}, 10041 author = {Behnel,Stefan and Bradshaw,Robert and Citro,Craig and Dalcin,Lisandro and 10042 Seljebotn,Dag Sverre and Smith,Kurt }, 10043 journal = {Computing in Science \& Engineering}, 10044 volume = {13}, 10045 number = {2}, 10046 pages = {31-39}, 10047 doi = {10.1109/MCSE.2010.118}, 10048 year = {2011} 10049} 10050 10051@Article{ dalcinpazstorti2005, 10052 title = {MPI for Python}, 10053 author = {Lisandro Dalcín and Rodrigo Paz and Mario Storti}, 10054 journal = {Journal of Parallel and Distributed Computing}, 10055 volume = {65}, 10056 number = {9}, 10057 pages = {1108 - 1115}, 10058 issn = {0743-7315}, 10059 doi = {10.1016/j.jpdc.2005.03.010}, 10060 year = {2005} 10061} 10062 10063@Article{ dalcincolliervignalcortescalo2016, 10064 title = {PetIGA: A framework for high-performance isogeometric analysis}, 10065 author = {Lisandro Dalcin and Nathan Collier and P. Vignal and A.M.A. Cortes and Victor M. 10066 Calo}, 10067 journal = {Computer Methods in Applied Mechanics and Engineering}, 10068 volume = {308}, 10069 pages = {151 - 181}, 10070 issn = {0045-7825}, 10071 doi = {10.1016/j.cma.2016.05.011}, 10072 year = {2016} 10073} 10074 10075@Article{ collierpardodalcinpaszynskicalo2012, 10076 title = {The cost of continuity: A study of the performance of isogeometric finite 10077 elements using direct solvers}, 10078 author = {Nathan Collier and David Pardo and Lisandro Dalcin and Maciej Paszynski and V.M. 10079 Calo}, 10080 journal = {Computer Methods in Applied Mechanics and Engineering}, 10081 volume = {213-216}, 10082 pages = {353 - 361}, 10083 issn = {0045-7825}, 10084 doi = {10.1016/j.cma.2011.11.002}, 10085 year = {2012} 10086} 10087 10088@Article{ collierdalcinpardocalo2013, 10089 title = {The Cost of Continuity: Performance of Iterative Solvers on Isogeometric Finite 10090 Elements}, 10091 author = {Nathan Collier and Lisandro Dalcin and David Pardo and Victor M. Calo}, 10092 journal = {SIAM Journal on Scientific Computing}, 10093 volume = {35}, 10094 number = {2}, 10095 pages = {A767-A784}, 10096 doi = {10.1137/120881038}, 10097 year = {2013} 10098} 10099 10100@Article{ dunning2017jump, 10101 title = {{JuMP}: a modeling language for mathematical optimization}, 10102 author = {Dunning, Iain and Huchette, Joey and Lubin, Miles}, 10103 journal = {SIAM Review}, 10104 volume = {59}, 10105 number = {2}, 10106 pages = {295--320}, 10107 year = {2017}, 10108 publisher = {SIAM} 10109} 10110 10111@InProceedings{ prudencioschulz2011, 10112 title = {The parallel {C++} statistical library {QUESO}: Quantification of Uncertainty for 10113 Estimation, Simulation and Optimization}, 10114 author = {Ernesto E Prudencio and Karl W Schulz}, 10115 booktitle = {European Conference on Parallel Processing}, 10116 pages = {398--407}, 10117 year = {2011} 10118} 10119 10120@Misc{ rol-website, 10121 key = {ROL}, 10122 title = {{Rapid Optimization Library} Website}, 10123 howpublished = {\url{https://trilinos.org/packages/rol}}, 10124 year = {2018} 10125} 10126 10127@Article{ more1994line, 10128 title = {Line search algorithms with guaranteed sufficient decrease}, 10129 author = {Mor{\'e}, Jorge J and Thuente, David J}, 10130 journal = {ACM Transactions on Mathematical Software}, 10131 volume = {20}, 10132 number = {3}, 10133 pages = {286--307}, 10134 year = {1994}, 10135 publisher = {ACM} 10136} 10137 10138@Article{ griewank2000algorithm, 10139 title = {Algorithm 799: revolve: an implementation of checkpointing for the reverse or 10140 adjoint mode of computational differentiation}, 10141 author = {Griewank, Andreas and Walther, Andrea}, 10142 journal = {ACM Transactions on Mathematical Software}, 10143 volume = {26}, 10144 number = {1}, 10145 pages = {19--45}, 10146 year = {2000}, 10147 publisher = {ACM} 10148} 10149 10150@Article{ metcalf2011seven, 10151 title = {The seven ages of fortran}, 10152 author = {Metcalf, Michael}, 10153 journal = {Journal of Computer Science \& Technology}, 10154 volume = {11}, 10155 year = {2011} 10156} 10157 10158@Article{ giraldo_2013, 10159 title = {Implicit-explicit formulations of a three-dimensional nonhydrostatic unified 10160 model of the atmosphere {(NUMA)}}, 10161 author = {F.X. Giraldo and J.F. Kelly and E.M. Constantinescu}, 10162 journal = {SIAM Journal on Scientific Computing}, 10163 year = {2013}, 10164 number = {5}, 10165 pages = {B1162-B1194}, 10166 volume = {35}, 10167 doi = {10.1137/120876034} 10168} 10169 10170@Article{ constantinescu_tr2016b, 10171 author = {Constantinescu, E.M.}, 10172 title = {Estimating Global Errors in Time Stepping}, 10173 journal = {ArXiv e-prints}, 10174 archiveprefix = {arXiv}, 10175 eprint = {1503.05166}, 10176 primaryclass = {math.NA}, 10177 keywords = {Mathematics - Numerical Analysis, 65L05, 65L06, 65L20, 65L70}, 10178 year = {2016}, 10179 month = mar, 10180 adsurl = {http://adsabs.harvard.edu/abs/2015arXiv150305166C}, 10181 adsnote = {Provided by the SAO/NASA Astrophysics Data System} 10182} 10183 10184@Article{ pareschi_2005, 10185 title = {Implicit-Explicit {R}unge-{K}utta Schemes and Applications to Hyperbolic Systems 10186 with Relaxation}, 10187 author = {L. Pareschi and G. Russo}, 10188 journal = {Journal of Scientific Computing}, 10189 year = {2005}, 10190 number = {1}, 10191 pages = {129--155}, 10192 volume = {25} 10193} 10194 10195@Article{ kennedy_2003, 10196 title = {Additive {R}unge-{K}utta schemes for convection-diffusion-reaction equations}, 10197 author = {C.A. Kennedy and M.H. Carpenter}, 10198 journal = {Appl. Numer. Math.}, 10199 year = {2003}, 10200 number = {1-2}, 10201 pages = {139--181}, 10202 volume = {44}, 10203 doi = {10.1016/S0168-9274(02)00138-1}, 10204 publisher = {Elsevier Science Publishers B. V.} 10205} 10206 10207@Unpublished{ boscarino_tr2011, 10208 title = {Implicit-Explicit {R}unge-{K}utta schemes for hyperbolic systems and kinetic 10209 equations in the diffusion limit}, 10210 author = {Boscarino, S. and Pareschi, L. and Russo, G.}, 10211 note = {Arxiv preprint arXiv:1110.4375}, 10212 year = {2011} 10213} 10214 10215@Article{ ascher_1997, 10216 title = {Implicit-explicit {R}unge-{K}utta methods for time-dependent partial differential 10217 equations}, 10218 author = {U.M. Ascher and S.J. Ruuth and R.J. Spiteri}, 10219 journal = {Applied Numerical Mathematics}, 10220 year = {1997}, 10221 pages = {151--167}, 10222 volume = {25} 10223} 10224 10225@Book{ ascherpetzold1998, 10226 title = {Computer methods for ordinary differential equations and differential-algebraic 10227 equations}, 10228 author = {Uri M Ascher and Linda R Petzold}, 10229 volume = {61}, 10230 publisher = {SIAM}, 10231 year = {1998} 10232} 10233 10234@Article{ colomesbadia2016, 10235 title = {Segregated {Runge}--{Kutta} methods for the incompressible {Navier}--{Stokes} 10236 equations}, 10237 author = {Oriol Colom{\'e}s and Santiago Badia}, 10238 journal = {International Journal for Numerical Methods in Engineering}, 10239 volume = {105}, 10240 number = {5}, 10241 pages = {372--400}, 10242 year = {2016} 10243} 10244 10245@Article{ sandu_1997, 10246 title = {Benchmarking stiff ode solvers for atmospheric chemistry problems {II}: 10247 {R}osenbrock solvers}, 10248 author = {A. Sandu and J.G. Verwer and J.G. Blom and E.J. Spee and G.R. Carmichael and F.A. 10249 Potra}, 10250 journal = {Atmospheric Environment}, 10251 year = {1997}, 10252 number = {20}, 10253 pages = {3459--3472}, 10254 volume = {31}, 10255 abstract = {In the numerical simulation of atmospheric transport-chemistry processes, a major 10256 task is the integration of the stiff systems of ordinary differential equations 10257 describing the chemical transformations. It is therefore of interest to 10258 systematically search for stiff solvers which can be identified as close to 10259 optimal for atmospheric applications. In this paper we continue our investigation 10260 from Sandu et al. (1996, CWI Report NM-R9603 and Report in Comput. Math., No. 85) 10261 and compare eight solvers on a set of seven box-models used in present day models. 10262 The focus is on Rosenbrock solvers. These turn out to be very well suited for our 10263 application when they are provided with highly efficient sparse matrix techniques 10264 to economize on the linear algebra. Two of the Rosenbrock solvers tested are from 10265 the literature, viz. and 4, and two are new and specially developed for air 10266 quality applications, viz. 3 and 3. } 10267} 10268 10269@Article{ rang_2005, 10270 title = {New {R}osenbrock {W}-methods of order 3 for partial differential algebraic 10271 equations of index 1}, 10272 author = {Rang, J. and Angermann, L.}, 10273 journal = {BIT Numerical Mathematics}, 10274 year = {2005}, 10275 number = {4}, 10276 pages = {761--787}, 10277 volume = {45}, 10278 publisher = {Springer} 10279} 10280 10281@Article{ gottliebketchesonshu2009, 10282 author = {Sigal Gottlieb and David I. Ketcheson and Chi Wang Shu}, 10283 title = {{High order strong stability preserving time discretizations}}, 10284 journal = {Journal of Scientific Computing}, 10285 volume = {38}, 10286 number = {3}, 10287 pages = {251--289}, 10288 doi = {10.1007/s10915-008-9239-z}, 10289 year = {2009} 10290} 10291 10292@Article{ ketcheson_2008, 10293 title = {Highly Efficient Strong Stability-Preserving {R}unge--{K}utta Methods with 10294 Low-Storage Implementations}, 10295 author = {D.I. Ketcheson}, 10296 journal = {SIAM Journal on Scientific Computing}, 10297 year = {2008}, 10298 number = {4}, 10299 pages = {2113--2136}, 10300 volume = {30}, 10301 doi = {10.1137/07070485X}, 10302 keywords = {method of lines, strong stability-preserving, monotonicity, low-storage, 10303 RungeKutta methods}, 10304 publisher = {SIAM} 10305} 10306 10307@Article{ jansen_2000, 10308 title = {A generalized-alpha method for integrating the filtered {N}avier--{S}tokes 10309 equations with a stabilized finite element method}, 10310 author = {Jansen, K.E. and Whiting, C.H. and Hulbert, G.M.}, 10311 journal = {Computer Methods in Applied Mechanics and Engineering}, 10312 year = {2000}, 10313 number = {3}, 10314 pages = {305--319}, 10315 volume = {190}, 10316 publisher = {Elsevier} 10317} 10318 10319@Article{ butcher_2007, 10320 title = {Error propagation of general linear methods for ordinary differential equations}, 10321 author = {J.C. Butcher and Z. Jackiewicz and W.M. Wright}, 10322 journal = {Journal of Complexity}, 10323 year = {2007}, 10324 number = {4-6}, 10325 pages = {560--580}, 10326 volume = {23}, 10327 abstract = {We discuss error propagation for general linear methods for ordinary differential 10328 equations up to terms of order p+2, where p is the order of the method. These 10329 results are then applied to the estimation of local discretization errors for 10330 methods of order p and for the adjacent order p+1. The results of numerical 10331 experiments confirm the reliability of these estimates. This research has 10332 applications in the design of robust stepsize and order changing strategies for 10333 algorithms based on general linear methods.}, 10334 doi = {10.1016/j.jco.2007.01.009}, 10335 issn = {0885-064X} 10336} 10337 10338@Article{ constantinescu_a2010a, 10339 title = {Extrapolated implicit-explicit time stepping}, 10340 author = {E.M. Constantinescu and A. Sandu}, 10341 journal = {SIAM Journal on Scientific Computing}, 10342 year = {2010}, 10343 number = {6}, 10344 pages = {4452-4477}, 10345 volume = {31}, 10346 comment = {Preprint \# ANL/MCS-P1612-0409}, 10347 doi = {10.1137/080732833} 10348} 10349 10350@InProceedings{ devito2011liszt, 10351 title = {Liszt: a domain specific language for building portable mesh-based PDE solvers}, 10352 author = {DeVito, Zachary and Joubert, Niels and Palacios, Francisco and Oakley, Stephen 10353 and Medina, Montserrat and Barrientos, Mike and Elsen, Erich and Ham, Frank and 10354 Aiken, Alex and Duraisamy, Karthik and others}, 10355 booktitle = {Proceedings of 2011 International Conference for High Performance Computing, 10356 Networking, Storage and Analysis}, 10357 pages = {9}, 10358 year = {2011}, 10359 organization = {ACM} 10360} 10361 10362@Article{ devito2011designing, 10363 title = {Designing the Language Liszt for Building Portable Mesh-based PDE Solvers}, 10364 author = {DeVito, Zachary and Hanrahan, Pat}, 10365 journal = {Scientific Discovery through Advanced Computing Program (SciDAC)}, 10366 year = {2011} 10367} 10368 10369@Misc{ pgasintro, 10370 author = {Tim Stitt}, 10371 title = {An Introduction to the Partitioned Global Address Space (PGAS) Programming 10372 Model}, 10373 note = {\url{http://cnx.org/content/m20649/latest/}} 10374} 10375 10376@InProceedings{ el2006upc, 10377 title = {UPC: unified parallel C}, 10378 author = {El-Ghazawi, Tarek and Smith, Lauren}, 10379 booktitle = {Proceedings of the 2006 ACM/IEEE conference on Supercomputing}, 10380 pages = {27}, 10381 year = {2006}, 10382 organization = {ACM} 10383} 10384 10385@InProceedings{ numrich1998co, 10386 title = {Co-Array Fortran for parallel programming}, 10387 author = {Numrich, Robert W and Reid, John}, 10388 booktitle = {ACM Sigplan Fortran Forum}, 10389 volume = {17}, 10390 number = {2}, 10391 pages = {1--31}, 10392 year = {1998}, 10393 organization = {ACM} 10394} 10395 10396@Article{ aiken1997titanium, 10397 title = {Titanium: A high-performance Java dialect}, 10398 author = {Aiken, Alex and Colella, Phil and Gay, David and Graham, Susan and Hilfinger, 10399 Paul and Krishnamurthy, Arvind and Liblit, Ben and Miyamoto, Carleton and Pike, 10400 Geoff and Semenzato, Luigi and others}, 10401 year = {1997} 10402} 10403 10404@Article{ charles2005x10, 10405 title = {X10: an object-oriented approach to non-uniform cluster computing}, 10406 author = {Charles, Philippe and Grothoff, Christian and Saraswat, Vijay and Donawa, 10407 Christopher and Kielstra, Allan and Ebcioglu, Kemal and Von Praun, Christoph and 10408 Sarkar, Vivek}, 10409 journal = {Acm Sigplan Notices}, 10410 volume = {40}, 10411 number = {10}, 10412 pages = {519--538}, 10413 year = {2005}, 10414 publisher = {ACM} 10415} 10416 10417@Article{ chamberlain2007parallel, 10418 title = {Parallel programmability and the chapel language}, 10419 author = {Chamberlain, Bradford L and Callahan, David and Zima, Hans P}, 10420 journal = {International Journal of High Performance Computing Applications}, 10421 volume = {21}, 10422 number = {3}, 10423 pages = {291--312}, 10424 year = {2007}, 10425 publisher = {SAGE Publications} 10426} 10427 10428@InProceedings{ charmppoopsla93, 10429 author = {{Kal\'{e}}, L.V. and Krishnan, S.}, 10430 title = {{CHARM++: A Portable Concurrent Object Oriented System Based on C++}}, 10431 editor = {Paepcke, A.}, 10432 fulleditor = {Paepcke, Andreas}, 10433 pages = {91--108}, 10434 month = sep, 10435 year = {1993}, 10436 booktitle = {{Proceedings of OOPSLA'93}}, 10437 publisher = {{ACM Press}} 10438} 10439 10440@InProceedings{ hewitt1973universal, 10441 title = {A universal modular actor formalism for artificial intelligence}, 10442 author = {Hewitt, Carl and Bishop, Peter and Steiger, Richard}, 10443 booktitle = {Proceedings of the 3rd international joint conference on Artificial 10444 intelligence}, 10445 pages = {235--245}, 10446 year = {1973}, 10447 organization = {Morgan Kaufmann Publishers Inc.} 10448} 10449 10450@Book{ yonezawa1990abcl, 10451 title = {ABCL: an object-oriented concurrent system}, 10452 author = {Yonezawa, Akinori}, 10453 year = {1990}, 10454 publisher = {MIT press} 10455} 10456 10457@InProceedings{ dally1988object, 10458 title = {Object-oriented concurrent programming in CST}, 10459 author = {Dally, William J and Chien, Andrew A}, 10460 booktitle = {Proceedings of the third conference on Hypercube concurrent computers and 10461 applications: Architecture, software, computer systems, and general issues-Volume 10462 1}, 10463 pages = {434--439}, 10464 year = {1988}, 10465 organization = {ACM} 10466} 10467 10468@Article{ grimshaw1993easy, 10469 title = {Easy-to-use object-oriented parallel processing with Mentat}, 10470 author = {Grimshaw, Andrew S.}, 10471 journal = {Computer}, 10472 volume = {26}, 10473 number = {5}, 10474 pages = {39--51}, 10475 year = {1993}, 10476 publisher = {IEEE} 10477} 10478 10479@InProceedings{ gannon1991object, 10480 title = {Object oriented parallelism: pC++ ideas and experiments}, 10481 author = {Gannon, Dennis and Lee, JK}, 10482 booktitle = {Proceedings of}, 10483 pages = {13--23}, 10484 year = {1991} 10485} 10486 10487@InProceedings{ lau1992object, 10488 title = {An object-oriented class library for scalable parallel heuristic search}, 10489 author = {Lau, Wing-cheong and Singh, Vineet}, 10490 booktitle = {ECOOP’92 European Conference on Object-Oriented Programming}, 10491 pages = {252--267}, 10492 year = {1992}, 10493 organization = {Springer} 10494} 10495 10496@Book{ chase1989amber, 10497 title = {The Amber system: Parallel programming on a network of multiprocessors}, 10498 author = {Chase, Jeffery and Amador, Franz and Lazowska, Edward and Levy, Henry and 10499 Littlefield, Richard}, 10500 volume = {23}, 10501 number = {5}, 10502 year = {1989}, 10503 publisher = {ACM} 10504} 10505 10506@InProceedings{ kaiser2009parallex, 10507 title = {Parallex an advanced parallel execution model for scaling-impaired applications}, 10508 author = {Kaiser, Hartmut and Brodowicz, Maciej and Sterling, Thomas}, 10509 booktitle = {Parallel Processing Workshops, 2009. ICPPW'09. International Conference on}, 10510 pages = {394--401}, 10511 year = {2009}, 10512 organization = {IEEE} 10513} 10514 10515@TechReport{ ipm, 10516 author = {Barry F. Smith}, 10517 title = {A New Parallel Programming Model for Computer Simulation}, 10518 institution = {Argonne National Laboratory}, 10519 year = {2014}, 10520 number = {ANL/MCS-P5135-0414} 10521} 10522 10523@Article{ groppsnir, 10524 author = {William Gropp and Marc Snir}, 10525 title = {Programming for Exascale Computers}, 10526 journal = {Computing in Science and Engineering}, 10527 volume = {15}, 10528 number = {6}, 10529 issn = {1521-9615}, 10530 year = {2013}, 10531 pages = {27-35}, 10532 doi = {10.1109/MCSE.2013.96}, 10533 publisher = {IEEE Computer Society}, 10534 address = {Los Alamitos, CA} 10535} 10536 10537@Book{ mpi3, 10538 title = {MPI: A Message-Passing Interface Standard, Version 3.0}, 10539 author = {Message Passing Interface Forum}, 10540 year = {2012}, 10541 publisher = {High Performance Computing Center Stuttgart (HLRS)} 10542} 10543 10544@Book{ openmp4, 10545 title = {OpenMP Application Program Interface, Version 4.0}, 10546 year = {2013}, 10547 publisher = {OpenMP Architecture Review Board} 10548} 10549 10550@InProceedings{ hartono2009annotation, 10551 title = {Annotation-based empirical performance tuning using {Orio}}, 10552 author = {Hartono, Albert and Norris, Boyana and Sadayappan, Ponnuswamy}, 10553 booktitle = {Parallel \& Distributed Processing, 2009. IPDPS 2009. IEEE International 10554 Symposium on}, 10555 pages = {1--11}, 10556 year = {2009}, 10557 organization = {IEEE} 10558} 10559 10560@Book{ toselli2005domain, 10561 title = {Domain Decomposition Methods: Algorithms and Theory}, 10562 author = {Toselli, Andrea and Widlund, Olof B}, 10563 volume = {34}, 10564 year = {2005}, 10565 publisher = {Springer} 10566} 10567 10568@InBook{ st2016, 10569 author = {Barry F. Smith and Xumin Tu}, 10570 chapter = {Domain Decomposition}, 10571 title = {Encyclopedia of Applied and Computational Mathematics}, 10572 bookeditor = {B. Engquist}, 10573 publisher = {Springer}, 10574 pages = {375--381}, 10575 year = {2016} 10576} 10577 10578@TechReport{ saws, 10579 author = {Matt Otten and Jed Brown and Barry F. Smith}, 10580 title = {Scientific Application Web Server {(SAWs)} Users Manual}, 10581 institution = {Argonne National Laboratory}, 10582 year = {2013} 10583} 10584 10585@Article{ smith1997domain, 10586 title = {Domain Decomposition Methods for Partial Differential Equations}, 10587 author = {Smith, B.F.}, 10588 journal = {ICASE LARC Interdisciplinary Series in Science and Engineering}, 10589 volume = {4}, 10590 pages = {225--244}, 10591 year = {1997}, 10592 publisher = {Citeseer} 10593} 10594 10595@Article{ spillane2011abstract, 10596 title = {Abstract robust coarse spaces for systems of {PDEs} via generalized eigenproblems 10597 in the overlaps}, 10598 author = {Spillane, N and Dolean, V and Hauret, P and Nataf, F and Pechstein, C and 10599 Scheichl, R}, 10600 journal = {NuMa-Report}, 10601 volume = {7}, 10602 pages = {2007}, 10603 year = {2011} 10604} 10605 10606@InProceedings{ jolivet2013scalabledd, 10607 title = {Scalable domain decomposition preconditioners for heterogeneous elliptic 10608 problems}, 10609 author = {Jolivet, Pierre and Hecht, Fr{\'e}d{\'e}ric and Nataf, Fr{\'e}d{\'e}ric and 10610 Prud'homme, Christophe}, 10611 booktitle = {Proceedings of SC13: International Conference for High Performance Computing, 10612 Networking, Storage and Analysis}, 10613 pages = {80}, 10614 year = {2013}, 10615 organization = {ACM} 10616} 10617 10618@Book{ ks2000, 10619 author = {D. Kinderlehrer and G. Stampacchia}, 10620 publisher = {Society for Industrial Mathematics}, 10621 title = {An Introduction to Variational Inequalities and Their Applications}, 10622 year = {2000} 10623} 10624 10625@Article{ wan2000energy, 10626 title = {An energy-minimizing interpolation for robust multigrid methods}, 10627 author = {Wan, W.L. and Chan, T.F. and Smith, B. F.}, 10628 journal = {SIAM Journal on Scientific Computing}, 10629 volume = {21}, 10630 number = {4}, 10631 pages = {1632--1649}, 10632 year = {2000}, 10633 publisher = {Philadelphia, PA: SIAM, c1993-} 10634} 10635 10636@Article{ chansmith1994, 10637 title = {Domain decomposition and multigrid algorithms for elliptic problems on 10638 unstructured meshes}, 10639 author = {Chan, T.F. and Smith, B.F.}, 10640 journal = {Electronic Transactions on Numerical Analysis}, 10641 volume = {2}, 10642 pages = {171--182}, 10643 year = {1994} 10644} 10645 10646@TechReport{ proto-fsp, 10647 author = {Venkatramani Balaji and Barry Smith and Brian Van Straalen and Priya Vashishta 10648 and Michael Zarnstorff and Michael Zika}, 10649 title = {Report of the {Proto-FSP} {Assessment Panel for the FSP}}, 10650 institution = {Princeton Plasma Physics Laboratory}, 10651 year = {2010}, 10652 url = {http://www.pppl.gov/fsp/documents/Proto-FSPAssessmentReport.pdf} 10653} 10654 10655@Article{ hirvijoki2021, 10656 title = {Structure-preserving marker-particle discretizations of {Coulomb} collisions for 10657 particle-in-cell codes}, 10658 journal = {Plasma Phys. Control. Fusion}, 10659 author = {Eero Hirvijoki}, 10660 note = {in press}, 10661 doi = {10.1088/1361-6587/abe884}, 10662 year = {2021} 10663} 10664 10665@Article{ ipsen2001, 10666 author = {Ilse C. F. Ipsen}, 10667 journal = {SIAM J. Sci. Comput.}, 10668 pages = {1050--1051}, 10669 volume = {23}, 10670 publisher = {SIAM}, 10671 title = {A Note on Preconditioning Nonsymmetric Matrices}, 10672 year = {2001} 10673} 10674 10675% Random papers on solvers for GPUs 10676@InProceedings{ gpus-suck, 10677 author = {Vuduc, R. and Chandramowlishwaran, A. and Choi, J. and Guney M. }, 10678 title = { On the Limits of {GPU} Acceleration}, 10679 booktitle = {HOTPAR: Proceedings of the 2nd USENIX Workshop on Hot Topics in Parallelism}, 10680 year = {2010}, 10681 publisher = {USENIX} 10682} 10683 10684@InProceedings{ 882364, 10685 author = {Bolz, Jeff and Farmer, Ian and Grinspun, Eitan and Schr\"{o}oder, Peter}, 10686 title = {Sparse matrix solvers on the {GPU}: conjugate gradients and multigrid}, 10687 booktitle = {SIGGRAPH '03: ACM SIGGRAPH 2003 Papers}, 10688 year = {2003}, 10689 isbn = {1-58113-709-5}, 10690 pages = {917--924}, 10691 location = {San Diego, California}, 10692 doi = {10.1145/1201775.882364}, 10693 publisher = {ACM}, 10694 address = {New York, NY} 10695} 10696 10697@Conference{ feng2008multigrid, 10698 author = {Feng, Z. and Li, P.}, 10699 booktitle = {IEEE/ACM International Conference on Computer-Aided Design, 2008. ICCAD 2008}, 10700 date-added = {2010-08-19 15:57:06 -0500}, 10701 date-modified = {2010-08-19 15:57:06 -0500}, 10702 pages = {647--654}, 10703 title = {Multigrid on {GPU}: Tackling power grid analysis on parallel SIMT platforms}, 10704 year = {2008} 10705} 10706 10707@Conference{ goodnight2003multigrid, 10708 author = {Goodnight, N. and Woolley, C. and Lewin, G. and Luebke, D. and Humphreys, G.}, 10709 booktitle = {Proceedings of the ACM SIGGRAPH/EUROGRAPHICS conference on Graphics hardware}, 10710 date-added = {2010-08-19 15:45:20 -0500}, 10711 date-modified = {2010-08-19 15:45:20 -0500}, 10712 organization = {Eurographics Association}, 10713 pages = {102--111}, 10714 title = {A multigrid solver for boundary value problems using programmable graphics 10715 hardware}, 10716 year = {2003} 10717} 10718 10719@Article{ buatois2007concurrent, 10720 author = {Buatois, L. and Caumon, G. and L{\'e}vy, B.}, 10721 date-added = {2010-08-19 15:45:02 -0500}, 10722 date-modified = {2010-08-19 15:45:02 -0500}, 10723 journal = {High Performance Computing and Communications}, 10724 pages = {358--371}, 10725 publisher = {Citeseer}, 10726 title = {Concurrent number cruncher: {A}n efficient sparse linear solver on the {GPU}}, 10727 year = {2007} 10728} 10729 10730@Article{ joldes2010real, 10731 author = {Joldes, G.R. and Wittek, A. and Miller, K.}, 10732 date-added = {2010-08-19 15:44:41 -0500}, 10733 date-modified = {2010-08-19 15:44:41 -0500}, 10734 journal = {Computer Methods in Applied Mechanics and Engineering}, 10735 publisher = {Elsevier}, 10736 title = {Real-time nonlinear finite element computations on {GPU}-application to 10737 neurosurgical simulation}, 10738 year = {2010} 10739} 10740 10741@Misc{ aharon2005gpu, 10742 author = {Aharon, S.}, 10743 date-added = {2010-08-19 15:44:32 -0500}, 10744 date-modified = {2010-08-19 15:44:32 -0500}, 10745 month = apr, 10746 note = {US Patent App. 11/115,642}, 10747 publisher = {Google Patents}, 10748 title = {{GPU}-based Finite Element}, 10749 year = {2005} 10750} 10751 10752@Article{ cevahir2009fast, 10753 author = {Cevahir, A. and Nukada, A. and Matsuoka, S.}, 10754 date-added = {2010-08-19 15:44:01 -0500}, 10755 date-modified = {2010-08-19 15:44:01 -0500}, 10756 journal = {Computational Science--ICCS 2009}, 10757 pages = {893--903}, 10758 publisher = {Springer}, 10759 title = {Fast conjugate gradients with multiple {GPU}s}, 10760 year = {2009} 10761} 10762 10763@Article{ maier1995symmetric, 10764 author = {Maier, G. and Miccoli, S. and Perego, U. and Novati, G.}, 10765 date-added = {2010-08-19 15:43:57 -0500}, 10766 date-modified = {2010-08-19 15:43:57 -0500}, 10767 journal = {Computational Mechanics}, 10768 number = {1}, 10769 pages = {115--129}, 10770 publisher = {Springer}, 10771 title = {Symmetric {G}alerkin boundary element method in plasticity and gradient 10772 plasticity}, 10773 volume = {17}, 10774 year = {1995} 10775} 10776 10777@Article{ corrigan-running, 10778 author = {Corrigan, A. and Camelli, F. and L{\\"o}hner, R. and Wallin, J.}, 10779 date-added = {2010-08-19 15:43:47 -0500}, 10780 date-modified = {2010-08-19 15:43:47 -0500}, 10781 journal = {International Journal for Numerical Methods in Fluids}, 10782 publisher = {John Wiley \& Sons}, 10783 title = {Running unstructured grid based CFD solvers on modern graphics hardware} 10784} 10785 10786@InProceedings{ volkov08, 10787 author = {Vasily Volkov and James W. Demmel}, 10788 title = {Benchmarking GPUs to tune dense linear algebra}, 10789 booktitle = {Proceedings of the 2008 ACM/IEEE Conference on Supercomputing (SC08)}, 10790 note = {\url{http://mc.stanford.edu/cgi-bin/images/6/65/SC08_Volkov_GPU.pdf}}, 10791 year = {2008} 10792} 10793 10794@TechReport{ cray-mvmult, 10795 author = {Guy~E. Blelloch and Michael~A. Heroux and Marco Zagha}, 10796 title = {Segmented Operations for Sparse Matrix Computation on Vector Multiprocessors}, 10797 institution = {School of Computer Science, Carnegie Mellon University}, 10798 number = {CMU-CS-93-173}, 10799 month = aug, 10800 year = {1993} 10801} 10802 10803@Conference{ bell2009implementing, 10804 author = {Bell, N. and Garland, M.}, 10805 booktitle = {Proceedings of the Conference on High Performance Computing Networking, Storage 10806 and Analysis}, 10807 date-added = {2010-08-19 15:43:42 -0500}, 10808 date-modified = {2010-08-19 15:43:42 -0500}, 10809 organization = {ACM}, 10810 pages = {1--11}, 10811 title = {Implementing sparse matrix-vector multiplication on throughput-oriented 10812 processors}, 10813 year = {2009} 10814} 10815 10816@Article{ bell2008efficient, 10817 author = {Bell, N. and Garland, M.}, 10818 date-added = {2010-08-19 15:43:36 -0500}, 10819 date-modified = {2010-08-19 15:43:36 -0500}, 10820 journal = {{NVIDIA} Corporation, {NVIDIA} Technical Report NVR-2008-004}, 10821 title = {Efficient sparse matrix-vector multiplication on {CUDA}}, 10822 year = {2008} 10823} 10824 10825@Article{ cohen-fast, 10826 author = {Cohen, J. and Molemaker, M.J.}, 10827 date-added = {2010-08-19 15:43:34 -0500}, 10828 date-modified = {2010-08-19 15:43:34 -0500}, 10829 journal = {Parallel Computational Fluid Dynamics: Recent Advances and Future Directions}, 10830 pages = {414}, 10831 publisher = {DEStech Publications}, 10832 title = {A fast double precision CFD code using CUDA} 10833} 10834 10835@Article{ kazhdan2008streaming, 10836 author = {Kazhdan, M. and Hoppe, H.}, 10837 date-added = {2010-08-19 15:43:32 -0500}, 10838 date-modified = {2010-08-19 15:43:32 -0500}, 10839 journal = {ACM Transactions on Graphics (TOG)}, 10840 number = {3}, 10841 pages = {21}, 10842 publisher = {ACM}, 10843 title = {Streaming multigrid for gradient-domain operations on large images}, 10844 volume = {27}, 10845 year = {2008} 10846} 10847 10848@Article{ bonnet1998symmetric, 10849 author = {Bonnet, M. and Maier, G. and Polizzotto, C.}, 10850 date-added = {2010-08-19 15:43:18 -0500}, 10851 date-modified = {2010-08-19 15:43:18 -0500}, 10852 journal = {Appl. Mech. Rev}, 10853 pages = {669--704}, 10854 title = {Symmetric {G}alerkin boundary element method.}, 10855 volume = {51}, 10856 year = {1998} 10857} 10858 10859@Conference{ zamith2007gpu, 10860 author = {Zamith, M. and Clua, E. and Pagliosa, P. and Conci, A. and Montenegro, A. and 10861 Valente, L.}, 10862 booktitle = {Proceedings of the VI Brazilian Symposium on Computer Games and Digital 10863 Entertainment}, 10864 date-added = {2010-08-19 15:43:14 -0500}, 10865 date-modified = {2010-08-19 15:43:14 -0500}, 10866 pages = {37--43}, 10867 title = {The {GPU} used as a math co-processor in real time applications}, 10868 year = {2007} 10869} 10870 10871@Article{ baskaran2009optimizing, 10872 author = {Baskaran, M.M. and Bordawekar, R.}, 10873 date-added = {2010-08-19 15:42:56 -0500}, 10874 date-modified = {2010-08-19 15:42:56 -0500}, 10875 journal = {IBM Research Report RC24704, IBM}, 10876 title = {Optimizing sparse matrix-vector multiplication on {GPU}s}, 10877 year = {2009} 10878} 10879 10880@Misc{ szeliski2006locally, 10881 author = {Szeliski, R.}, 10882 date-added = {2010-08-19 15:42:45 -0500}, 10883 date-modified = {2010-08-19 15:42:45 -0500}, 10884 month = jul, 10885 note = {US Patent App. 11/459,724}, 10886 publisher = {Google Patents}, 10887 title = {Locally adapted hierarchical basis preconditioning}, 10888 year = {2006} 10889} 10890 10891@Article{ jung2006cholesky, 10892 author = {Jung, J.H. and O'Leary, D.P.}, 10893 date-added = {2010-08-19 15:42:34 -0500}, 10894 date-modified = {2010-08-19 15:42:34 -0500}, 10895 journal = {Scholarly Paper, University of Maryland}, 10896 publisher = {Citeseer}, 10897 title = {Cholesky decomposition and linear programming on a {GPU}}, 10898 year = {2006} 10899} 10900 10901@Conference{ filipovic2009gpu, 10902 author = {Filipovic, J. and Peterlik, I. and Fousek, J.}, 10903 booktitle = {SAAHPC: Symposium on Application Accelerators in HPC}, 10904 date-added = {2010-08-19 15:42:33 -0500}, 10905 date-modified = {2010-08-19 15:42:33 -0500}, 10906 title = {{GPU} Acceleration of Equations Assembly in Finite Elements Method-Preliminary 10907 Results}, 10908 year = {2009} 10909} 10910 10911@Article{ taylor2009modelling, 10912 author = {Taylor, ZA and Comas, O. and Cheng, M. and Passenger, J. and Hawkes, DJ and 10913 Atkinson, D. and Ourselin, S.}, 10914 date-added = {2010-08-19 15:42:23 -0500}, 10915 date-modified = {2010-08-19 15:42:23 -0500}, 10916 journal = {Medical Image Analysis}, 10917 number = {2}, 10918 pages = {234--244}, 10919 publisher = {Elsevier}, 10920 title = {On modelling of anisotropic viscoelasticity for soft tissue simulation: Numerical 10921 solution and {GPU} execution}, 10922 volume = {13}, 10923 year = {2009} 10924} 10925 10926@Conference{ owens2007survey, 10927 author = {Owens, J.D. and Luebke, D. and Govindaraju, N. and Harris, M. and Kr{\\"u}ger, J. 10928 and Lefohn, A.E. and Purcell, T.J.}, 10929 booktitle = {Computer Graphics Forum}, 10930 date-added = {2010-08-19 15:42:21 -0500}, 10931 date-modified = {2010-08-19 15:42:21 -0500}, 10932 number = {1}, 10933 organization = {John Wiley \& Sons}, 10934 pages = {80--113}, 10935 title = {A survey of general-purpose computation on graphics hardware}, 10936 volume = {26}, 10937 year = {2007} 10938} 10939 10940@Article{ strzodka2005scientific, 10941 author = {Strzodka, R. and Doggett, M. and Kolb, A.}, 10942 date-added = {2010-08-19 15:42:18 -0500}, 10943 date-modified = {2010-08-19 15:42:18 -0500}, 10944 journal = {Simulation Modelling Practice and Theory}, 10945 number = {8}, 10946 pages = {667--680}, 10947 publisher = {Elsevier}, 10948 title = {Scientific computation for simulations on programmable graphics hardware}, 10949 volume = {13}, 10950 year = {2005} 10951} 10952 10953@Conference{ rumpf2001using, 10954 author = {Rumpf, M. and Strzodka, R.}, 10955 booktitle = {Proc. of IASTED Visualization, Imaging and Image Processing Conference 10956 (VIIP-01)}, 10957 date-added = {2010-08-19 15:42:15 -0500}, 10958 date-modified = {2010-08-19 15:42:15 -0500}, 10959 organization = {Citeseer}, 10960 pages = {193--202}, 10961 title = {Using graphics cards for quantized FEM computations}, 10962 year = {2001} 10963} 10964 10965@Article{ sirtori1992galerkin, 10966 author = {Sirtori, S. and Maier, G. and Novati, G. and Miccoli, S.}, 10967 date-added = {2010-08-19 15:42:14 -0500}, 10968 date-modified = {2010-08-19 15:42:14 -0500}, 10969 journal = {International Journal for Numerical Methods in Engineering}, 10970 number = {2}, 10971 pages = {255--282}, 10972 publisher = {John Wiley \& Sons}, 10973 title = {A {G}alerkin symmetric boundary-element method in elasticity: formulation and 10974 implementation}, 10975 volume = {35}, 10976 year = {1992} 10977} 10978 10979@Article{ tejada2005large, 10980 author = {Tejada, E. and Ertl, T.}, 10981 date-added = {2010-08-19 15:42:09 -0500}, 10982 date-modified = {2010-08-19 15:42:09 -0500}, 10983 journal = {Simulation Modelling Practice and Theory}, 10984 number = {8}, 10985 pages = {703--715}, 10986 publisher = {Elsevier}, 10987 title = {Large steps in {GPU}-based deformable bodies simulation}, 10988 volume = {13}, 10989 year = {2005} 10990} 10991 10992@Article{ goddeke2008using, 10993 author = {Goddeke, D. and Strzodka, R. and Mohd-Yusof, J. and McCormick, P. and Wobker, H. 10994 and Becker, C. and Turek, S.}, 10995 date-added = {2010-08-19 15:42:06 -0500}, 10996 date-modified = {2010-08-19 15:42:06 -0500}, 10997 journal = {International Journal of Computational Science and Engineering}, 10998 number = {1}, 10999 pages = {36--55}, 11000 publisher = {Inderscience}, 11001 title = {Using {GPU}s to improve multigrid solver performance on a cluster}, 11002 volume = {4}, 11003 year = {2008} 11004} 11005 11006@Article{ garland2008parallel, 11007 author = {Garland, M. and Le Grand, S. and Nickolls, J. and Anderson, J. and Hardwick, J. 11008 and Morton, S. and Phillips, E. and Zhang, Y. and Volkov, V.}, 11009 date-added = {2010-08-19 15:41:51 -0500}, 11010 date-modified = {2010-08-19 15:41:51 -0500}, 11011 journal = {IEEE Micro}, 11012 number = {4}, 11013 pages = {13--27}, 11014 title = {Parallel computing experiences with CUDA}, 11015 volume = {28}, 11016 year = {2008} 11017} 11018 11019@Article{ wong1985method, 11020 author = {Wong, SH and Ciric, IR}, 11021 date-added = {2010-08-19 15:41:48 -0500}, 11022 date-modified = {2010-08-19 15:41:48 -0500}, 11023 journal = {COMPEL: The International Journal for Computation and Mathematics in Electrical 11024 and Electronic Engineering}, 11025 publisher = {MCB UP Ltd}, 11026 title = {Method of conformal transformation for the finite-element solution of 11027 axisymmetric exterior-field problems}, 11028 volume = {4}, 11029 year = {1985} 11030} 11031 11032@Article{ turek-feast, 11033 author = {Turek, S. and G{\\"o}ddeke, D. and Becker, C. and Buijssen, S.H.M. and Wobker, 11034 H.}, 11035 date-added = {2010-08-19 15:41:47 -0500}, 11036 date-modified = {2010-08-19 15:41:47 -0500}, 11037 journal = {Concurrency and Computation: Practice and Experience}, 11038 publisher = {John Wiley \& Sons}, 11039 title = {FEAST-realization of hardware-oriented numerics for HPC simulations with finite 11040 elements} 11041} 11042 11043@Article{ abedi2006space, 11044 author = {Abedi, R. and Petracovici, B. and Haber, R.B.}, 11045 date-added = {2010-08-19 15:41:46 -0500}, 11046 date-modified = {2010-08-19 15:41:46 -0500}, 11047 journal = {Computer Methods in Applied Mechanics and Engineering}, 11048 number = {25-28}, 11049 pages = {3247--3273}, 11050 publisher = {Elsevier}, 11051 title = {A space-time discontinuous {G}alerkin method for linearized elastodynamics with 11052 element-wise momentum balance}, 11053 volume = {195}, 11054 year = {2006} 11055} 11056 11057@Conference{ georgii2005interactiveb, 11058 author = {Georgii, J. and Westermann, R.}, 11059 booktitle = {Proceedings of VMV}, 11060 date-added = {2010-08-19 15:41:36 -0500}, 11061 date-modified = {2010-08-19 15:41:36 -0500}, 11062 title = {Interactive simulation and rendering of heterogeneous deformable bodies}, 11063 year = {2005} 11064} 11065 11066@Article{ mosegaard2005gpu, 11067 author = {Mosegaard, J. and others}, 11068 date-added = {2010-08-19 15:41:35 -0500}, 11069 date-modified = {2010-08-19 15:41:35 -0500}, 11070 publisher = {IEEE Computer Society}, 11071 title = {{GPU} accelerated surgical simulators for complex morphology}, 11072 year = {2005} 11073} 11074 11075@Article{ meyer2007particle, 11076 author = {Meyer, M. and Nelson, B. and Kirby, R. and Whitaker, R.}, 11077 date-added = {2010-08-19 15:41:33 -0500}, 11078 date-modified = {2010-08-19 15:41:33 -0500}, 11079 journal = {IEEE Transactions on Visualization and Computer Graphics}, 11080 pages = {1015--1026}, 11081 publisher = {Published by the IEEE Computer Society}, 11082 title = {Particle systems for efficient and accurate high-order finite element 11083 visualization}, 11084 year = {2007} 11085} 11086 11087@Conference{ rumpf2001nonlinear, 11088 author = {Rumpf, M. and Strzodka, R.}, 11089 booktitle = {Data Visualization 2001: proceedings of the Joint Eurographics-IEEE TCVG 11090 Symposium on Visualization in Ascona, Switzerland, May 28-30, 2001}, 11091 date-added = {2010-08-19 15:41:29 -0500}, 11092 date-modified = {2010-08-19 15:41:29 -0500}, 11093 organization = {Springer Verlag Wien}, 11094 pages = {75}, 11095 title = {Nonlinear diffusion in graphics hardware}, 11096 year = {2001} 11097} 11098 11099@Article{ georgii2005interactive, 11100 author = {Georgii, J. and Echtler, F. and Westermann, R.}, 11101 date-added = {2010-08-19 15:41:28 -0500}, 11102 date-modified = {2010-08-19 15:41:28 -0500}, 11103 journal = {Simulation and Visualisation}, 11104 pages = {247--258}, 11105 publisher = {Citeseer}, 11106 title = {Interactive simulation of deformable bodies on {GPU}s}, 11107 volume = {2005}, 11108 year = {2005} 11109} 11110 11111@Article{ harish2007accelerating, 11112 author = {Harish, P. and Narayanan, P.}, 11113 date-added = {2010-08-19 15:41:27 -0500}, 11114 date-modified = {2010-08-19 15:41:27 -0500}, 11115 journal = {High Performance Computing--HiPC 2007}, 11116 pages = {197--208}, 11117 publisher = {Springer}, 11118 title = {Accelerating large graph algorithms on the {GPU} using CUDA}, 11119 year = {2007} 11120} 11121 11122@Article{ keunings1995parallel, 11123 author = {Keunings, R.}, 11124 date-added = {2010-08-19 15:41:19 -0500}, 11125 date-modified = {2010-08-19 15:41:19 -0500}, 11126 journal = {Computers and Chemical Engineering}, 11127 number = {6}, 11128 pages = {647--670}, 11129 publisher = {Oxford; New York: Pergamon Press, 1977-}, 11130 title = {Parallel finite element algorithms applied to computational rheology}, 11131 volume = {19}, 11132 year = {1995} 11133} 11134 11135@Conference{ taylor2007real, 11136 author = {Taylor, Z.A. and Cheng, M. and Ourselin, S.}, 11137 booktitle = {Proceedings of the 10th international conference on Medical image computing and 11138 computer-assisted intervention-Volume Part I}, 11139 date-added = {2010-08-19 15:41:17 -0500}, 11140 date-modified = {2010-08-19 15:41:17 -0500}, 11141 organization = {Springer-Verlag}, 11142 pages = {701--708}, 11143 title = {Real-time nonlinear finite element analysis for surgical simulation using 11144 graphics processing units}, 11145 year = {2007} 11146} 11147 11148@Article{ liu2000finite, 11149 author = {Liu, R. and Li, DY}, 11150 date-added = {2010-08-19 15:41:16 -0500}, 11151 date-modified = {2010-08-19 15:41:16 -0500}, 11152 journal = {Materials Science and Engineering A}, 11153 number = {1-2}, 11154 pages = {169--175}, 11155 publisher = {Elsevier}, 11156 title = {A finite element model study on wear resistance of pseudoelastic {TiNi} alloy}, 11157 volume = {277}, 11158 year = {2000} 11159} 11160 11161@Conference{ kakadiaris1994active, 11162 author = {Kakadiaris, I.A. and Metaxas, D. and Bajcsy, R.}, 11163 booktitle = {IEEE Computer Society Conference on Computer Vision and Pattern Recognition}, 11164 date-added = {2010-08-19 15:41:15 -0500}, 11165 date-modified = {2010-08-19 15:41:15 -0500}, 11166 organization = {Citeseer}, 11167 pages = {980--980}, 11168 title = {Active part-decomposition, shape, and motion estimation of articulated objects: A 11169 physics-based approach}, 11170 year = {1994} 11171} 11172 11173@Conference{ de2004gpu, 11174 author = {De Pascale, M. and De Pascale, G. and Prattichizzo, D. and Barbagli, F.}, 11175 booktitle = {Proceedings of Eurohaptics}, 11176 date-added = {2010-08-19 15:41:14 -0500}, 11177 date-modified = {2010-08-19 15:41:14 -0500}, 11178 organization = {Citeseer}, 11179 pages = {44--51}, 11180 title = {A {GPU}-friendly method for haptic and graphic rendering of deformable objects}, 11181 volume = {2004}, 11182 year = {2004} 11183} 11184 11185@Book{ taflove1995computational, 11186 author = {Taflove, A. and Hagness, S.C.}, 11187 date-added = {2010-08-19 15:41:14 -0500}, 11188 date-modified = {2010-08-19 15:41:14 -0500}, 11189 publisher = {Artech House Norwood, MA}, 11190 title = {Computational electrodynamics}, 11191 year = {1995} 11192} 11193 11194@Conference{ galoppo2005lu, 11195 author = {Galoppo, N. and Govindaraju, N.K. and Henson, M. and Manocha, D.}, 11196 booktitle = {Proceedings of the 2005 ACM/IEEE conference on Supercomputing}, 11197 date-added = {2010-08-19 15:41:13 -0500}, 11198 date-modified = {2010-08-19 15:41:13 -0500}, 11199 organization = {IEEE Computer Society}, 11200 pages = {3}, 11201 title = {{LU-GPU}: Efficient algorithms for solving dense linear systems on graphics 11202 hardware}, 11203 year = {2005} 11204} 11205 11206@Conference{ ryoo2008optimization, 11207 author = {Ryoo, S. and Rodrigues, C.I. and Baghsorkhi, S.S. and Stone, S.S. and Kirk, D.B. 11208 and Hwu, W.W.}, 11209 booktitle = {Proceedings of the 13th ACM SIGPLAN Symposium on Principles and practice of 11210 parallel programming}, 11211 date-added = {2010-08-19 15:41:12 -0500}, 11212 date-modified = {2010-08-19 15:41:12 -0500}, 11213 organization = {ACM}, 11214 pages = {73--82}, 11215 title = {Optimization principles and application performance evaluation of a multithreaded 11216 {GPU} using CUDA}, 11217 year = {2008} 11218} 11219 11220@Conference{ micikevicius20093d, 11221 author = {Micikevicius, P.}, 11222 booktitle = {Proceedings of 2nd Workshop on General Purpose Processing on Graphics Processing 11223 Units}, 11224 date-added = {2010-08-19 15:41:11 -0500}, 11225 date-modified = {2010-08-19 15:41:11 -0500}, 11226 organization = {ACM}, 11227 pages = {79--84}, 11228 title = {3D finite difference computation on {GPU}s using {CUDA}}, 11229 year = {2009} 11230} 11231 11232@Conference{ zhou2004pixel, 11233 author = {Zhou, Y. and Garland, M. and Haber, R.}, 11234 booktitle = {IEEE Visualization, 2004}, 11235 date-added = {2010-08-19 15:41:03 -0500}, 11236 date-modified = {2010-08-19 15:41:03 -0500}, 11237 pages = {425--432}, 11238 title = {Pixel-exact rendering of spacetime finite element solutions}, 11239 year = {2004} 11240} 11241 11242@Article{ komatitsch2009porting, 11243 author = {Komatitsch, D. and Mich{\'e}a, D. and Erlebacher, G.}, 11244 date-added = {2010-08-19 15:41:01 -0500}, 11245 date-modified = {2010-08-19 15:41:01 -0500}, 11246 journal = {Journal of Parallel and Distributed Computing}, 11247 number = {5}, 11248 pages = {451--460}, 11249 publisher = {Elsevier}, 11250 title = {Porting a high-order finite-element earthquake modeling application to NVIDIA 11251 graphics cards using CUDA}, 11252 volume = {69}, 11253 year = {2009} 11254} 11255 11256@Article{ komatitsch1998spectral, 11257 author = {Komatitsch, D. and Vilotte, J.P.}, 11258 date-added = {2010-08-19 15:40:59 -0500}, 11259 date-modified = {2010-08-19 15:40:59 -0500}, 11260 journal = {Bulletin of the Seismological Society of America}, 11261 number = {2}, 11262 pages = {368--392}, 11263 publisher = {[El Cerrito, Calif., etc., Seismological Society of America, etc.]}, 11264 title = {The spectral element method: {A}n efficient tool to simulate the seismic response 11265 of 2D and 3D geological structures}, 11266 volume = {88}, 11267 year = {1998} 11268} 11269 11270@Article{ wu2005improved, 11271 author = {Wu, W. and Heng, P.A.}, 11272 date-added = {2010-08-19 15:40:59 -0500}, 11273 date-modified = {2010-08-19 15:40:59 -0500}, 11274 journal = {The Visual Computer}, 11275 number = {8}, 11276 pages = {707--716}, 11277 publisher = {Springer}, 11278 title = {An improved scheme of an interactive finite element model for 3D soft-tissue 11279 cutting and deformation}, 11280 volume = {21}, 11281 year = {2005} 11282} 11283 11284@Article{ taylor2008high, 11285 author = {Taylor, Z.A. and Cheng, M. and Ourselin, S.}, 11286 date-added = {2010-08-19 15:40:57 -0500}, 11287 date-modified = {2010-08-19 15:40:57 -0500}, 11288 journal = {IEEE transactions on medical imaging}, 11289 number = {5}, 11290 pages = {650}, 11291 title = {High-speed nonlinear finite element analysis for surgical simulation using 11292 graphics processing units.}, 11293 volume = {27}, 11294 year = {2008} 11295} 11296 11297@Conference{ bolz2003sparse, 11298 author = {Bolz, J. and Farmer, I. and Grinspun, E. and Schr{\\"o}oder, P.}, 11299 booktitle = {ACM SIGGRAPH 2003 Papers}, 11300 date-added = {2010-08-19 15:40:55 -0500}, 11301 date-modified = {2010-08-19 15:40:55 -0500}, 11302 organization = {ACM}, 11303 pages = {924}, 11304 title = {Sparse matrix solvers on the {GPU}: conjugate gradients and multigrid}, 11305 year = {2003} 11306} 11307 11308@Article{ wu2004hybrid, 11309 author = {Wu, W. and Heng, P.A.}, 11310 date-added = {2010-08-19 15:40:54 -0500}, 11311 date-modified = {2010-08-19 15:40:54 -0500}, 11312 journal = {Computer Animation and Virtual Worlds}, 11313 number = {3-4}, 11314 pages = {219--227}, 11315 publisher = {John Wiley \& Sons}, 11316 title = {A hybrid condensed finite element model with {GPU} acceleration for interactive 11317 3D soft tissue cutting}, 11318 volume = {15}, 11319 year = {2004} 11320} 11321 11322% ---------------------------------------------------------------------------------------------------------------- 11323@TechReport{ davis97, 11324 author = {T. Davis}, 11325 title = {The {U}niversity of {F}lorida Sparse Matrix Collection}, 11326 institution = {University of Florida}, 11327 year = {1997} 11328} 11329 11330@Article{ davis2011, 11331 author = {Davis, T. A. and Hu, Y.}, 11332 title = {The {U}niversity of {F}lorida sparse matrix collection}, 11333 journal = {ACM Transactions on Mathematical Software}, 11334 volume = {38}, 11335 issue = {1}, 11336 year = {2011}, 11337 pages = {1--25} 11338} 11339 11340@Article{ davis2004algorithm, 11341 title = {Algorithm 832: {UMFPACK} V4.3---An Unsymmetric-Pattern Multifrontal Method}, 11342 author = {Davis, Timothy A}, 11343 journal = {ACM Transactions on Mathematical Software}, 11344 volume = {30}, 11345 number = {2}, 11346 pages = {196--199}, 11347 year = {2004}, 11348 publisher = {ACM} 11349} 11350 11351@TechReport{ streams, 11352 author = {J. D. McCalpin}, 11353 title = {{STREAM}: Sustainable memory bandwidth in high performance computers}, 11354 institution = {University of Virginia}, 11355 url = {http://www.cs.virginia.edu/stream}, 11356 year = {1995} 11357} 11358 11359@Article{ areusken_1988b, 11360 author = {A. Reusken}, 11361 title = {Convergence of the multigrid full approximation scheme for a class of elliptic 11362 mildly nonlinear boundary value problems}, 11363 journal = {Numer. Math.}, 11364 volume = {52}, 11365 year = {1988}, 11366 pages = {251--277} 11367} 11368 11369@Article{ areusken_1988c, 11370 author = {A. Reusken}, 11371 title = {Convergence of the multigrid full approximation scheme including the {V}--cycle}, 11372 journal = {Numer. Math.}, 11373 volume = {53}, 11374 year = {1988}, 11375 pages = {663--686} 11376} 11377 11378@Unpublished{ mgnet, 11379 title = {Multigrid Net; http://www.mgnet.org/}, 11380 author = {Craig Douglas}, 11381 note = {Contains enormous bibliography on multigrid publications}, 11382 year = {2009} 11383} 11384 11385@Unpublished{ copper, 11386 title = {Fourteenth Copper Mountain Conference on Multigrid Methods}, 11387 author = {}, 11388 note = {Held bi-annually}, 11389 year = {2009} 11390} 11391 11392@Book{ wessling1992, 11393 author = {Pieter Wesseling}, 11394 title = {An Introduction to Multigrid Methods}, 11395 year = {2004}, 11396 publisher = {R. T. Edwards} 11397} 11398 11399@Book{ bhm2000, 11400 author = {William L. Briggs and Van Emden Henson and Steve F. McCormick}, 11401 title = {A Multigrid Tutorial}, 11402 year = {2000}, 11403 publisher = {SIAM} 11404} 11405 11406@Book{ trottenberg2001multigrid, 11407 title = {{Multigrid}}, 11408 author = {Trottenberg, U. and Oosterlee, C.W. and Sch{\"u}ller, A.}, 11409 isbn = {012701070X}, 11410 year = {2001}, 11411 publisher = {Academic Press} 11412} 11413 11414@TechReport{ brandt1984, 11415 author = {Achi Brandt}, 11416 title = {Multigrid Techniques: 1984 Guide with Applications for Fluid Dynamics}, 11417 institution = {Gesellschaft fur Mathematik und Dataenverarbeitung}, 11418 number = {GMD-Studien Nr. 85}, 11419 year = {1984} 11420} 11421 11422@Article{ yavneh1998coarse, 11423 title = {Coarse-Grid Correction for Nonelliptic and Singular Perturbation Problems}, 11424 author = {Yavneh, I.}, 11425 journal = {SIAM Journal on Scientific Computing}, 11426 volume = {19}, 11427 number = {5}, 11428 pages = {1682--1699}, 11429 year = {1998}, 11430 publisher = {Society for Industrial and Applied Mathematics} 11431} 11432 11433@Article{ wan2003phase, 11434 title = {A Phase Error Analysis of Multigrid Methods for Hyperbolic Equations}, 11435 author = {Wan, WL and Chan, T.F.}, 11436 journal = {SIAM Journal on Scientific Computing}, 11437 volume = {25}, 11438 pages = {857}, 11439 year = {2003} 11440} 11441 11442@Article{ imex, 11443 author = {Uri M. Ascher and Steven J. Ruuth and Brian T. R. Wetton}, 11444 title = {Implicit-Explicit Methods for Time-Dependent Partial Differential Equations}, 11445 journal = {SIAM Journel on Numerical Analysis}, 11446 volume = {32}, 11447 number = {3}, 11448 pages = {797--823}, 11449 year = {1995} 11450} 11451 11452@Article{ ow1, 11453 author = {T. Washio and C. W. Oosterlee}, 11454 title = {Krylov Subspace Acceleration for Nonlinear Multigrid Schemes with Application to 11455 Recirculating Flow}, 11456 journal = {SIAM Journal on Scientific Computing}, 11457 volume = {21}, 11458 number = {5}, 11459 pages = {1670--1690}, 11460 year = {2000} 11461} 11462 11463@Article{ vm1, 11464 author = {V. A. Mousseau}, 11465 title = {Implicitly Balanced Solution of the Two-Phase Flow Equations Coupled to Nonlinear 11466 Heat Conduction}, 11467 journal = {Journal Of Computational Physics}, 11468 volume = {200}, 11469 pages = {104--132}, 11470 year = {2004} 11471} 11472 11473@Article{ vm2, 11474 author = {V. A. Mousseau}, 11475 title = {A Fully Implicit Hybrid Solution Method for a Two-Phase Thermal-Hydraulic Model}, 11476 journal = {Journal Of Heat Transfer}, 11477 volume = {127}, 11478 pages = {531--539}, 11479 year = {2005} 11480} 11481 11482@Misc{ salome1, 11483 author = {Laurent Dada and Daniel Caruge}, 11484 title = {The {SALOME} Open Source {CAE} Platform Application to Reactor Physics 11485 Simulation}, 11486 year = {2005}, 11487 url = {http://conferences.esa.int/05c26/Seminar-2005-09-28-SALOME.pdf}, 11488 note = {Presentation at an ESA/ESTEC conference} 11489} 11490 11491@InProceedings{ downar1, 11492 author = {D. A. Barber and W. Wang and R. M. Miller and T. J. Downar and H. G. Joe and V. 11493 A. Mousseau and D. E. Ebert}, 11494 title = {Application of a generalized interface module to the coupling of {PARCS} with 11495 both {RELAP5} and {TRAC-M}}, 11496 booktitle = {Proceedings of 1999 annual meeting of the American Nuclear Society}, 11497 year = {1999} 11498} 11499 11500@Article{ lopez1, 11501 author = {A. P. Lopez and J. B. Sandova}, 11502 title = {A methodology for the coupling of {RAMONA-3B} neutron kinetics and {TRAC-BF1} 11503 thermal-hydraulics}, 11504 journal = {Annals of Nuclear Energy}, 11505 volume = {32(6)}, 11506 pages = {621--634}, 11507 year = {2005} 11508} 11509 11510@InProceedings{ og-1996, 11511 author = {C. R. E. de Oliveira and A. J. H. Goddard}, 11512 title = {{EVENT}: A Multidimensional Finite Element-Spherical Harmonics Radiation 11513 Transport Code}, 11514 booktitle = {Proceedings of the OECD International Seminar on 3D Deterministic Radiation 11515 Transport Codes}, 11516 editor = {}, 11517 publisher = {}, 11518 pages = {}, 11519 note = {Paris, France}, 11520 month = dec, 11521 year = {1996} 11522} 11523 11524@Article{ wo-2000, 11525 author = {P. Warner and C. R. E. de Oliveira}, 11526 title = {Verification and Validation of the 3D Finite Element Transport Theory Code 11527 {EVENT} for Shielding Applications}, 11528 journal = {J. Nucl. Sci. and Tech.}, 11529 volume = {Supplement 1}, 11530 pages = {466--470}, 11531 year = {2000} 11532} 11533 11534@Unpublished{ gnep-web, 11535 author = {{U.S. Department of Energy}}, 11536 title = {Global Nuclear Energy Partnership ({GNEP})}, 11537 note = {\url{ http://www.gnep.energy.gov}}, 11538 year = {2007} 11539} 11540 11541@Book{ lewis-miller-1984, 11542 author = {E. E. Lewis and W. F. Miller, Jr.}, 11543 title = {Computational Methods of Neutron Transport}, 11544 address = {}, 11545 publisher = {Wiley}, 11546 year = {1984} 11547} 11548 11549@Article{ couple1, 11550 author = {J. M. Cook and D. Okrent and D. Satkus and R. B. Lazarus and M. B. Wells}, 11551 title = {{AX-1}, A COMPUTING PROGRAM FOR COUPLED NEUTRONICS-HYDRODYNAMICS CALCULATIONS ON 11552 THE {IBM-704}}, 11553 journal = {Nuclear Sci. and Eng.}, 11554 year = {1959}, 11555 pages = {113--115}, 11556 volume = {2(1)} 11557} 11558 11559@InProceedings{ weber1, 11560 author = {D. P. Weber and S. S. Chen and C. Y. Wang and T. Y. C. Wei and S. Jansson}, 11561 title = {Coupled {CFD/CSM} vibration design methodology for generation {IV} long-life fuel 11562 and component design}, 11563 booktitle = {4th International Conference on Supercomputing in Nuclear Applications}, 11564 year = {2000} 11565} 11566 11567@Misc{ gnep:report, 11568 author = {Phillip Finck and David Keyes and Rick Stevens}, 11569 title = {{Report on the {DOE} Joint {NE/SC} Workshop Simulation and Modeling for Advanced 11570 Nuclear Energy Systems}}, 11571 year = {2006} 11572} 11573 11574@Misc{ subsurface-workshop-ref, 11575 author = {D. {Zachman (Chair)}}, 11576 title = {{Computational Subsurface Sciences Workshop}}, 11577 note = {January 9--12, 2007, Bethesda, MD, see \url{http://subsurface2007.labworks.org/}} 11578} 11579 11580@Misc{ fusion:report, 11581 title = {{Report of the Fusion Energy Sciences Advisory Committee Burning Plasma Strategy 11582 Panel}}, 11583 author = {{Fusion Energy Sciences Advisory Committee}}, 11584 year = {2002}, 11585 note = {see \url{http://www.ofes.fusion.doe.gov/More_HTML/FESAC/Austinfinal.pdf}} 11586} 11587 11588@Misc{ hecrtf:report, 11589 title = {{Report of the High End Computing Revitalization Task Force (HECRTF)}}, 11590 key = {HECRTF}, 11591 year = {2004}, 11592 howpublished = {see \url{http://www.ostp.gov/nstc/html/HECRTF-FINAL_051004.pdf}} 11593} 11594 11595@Misc{ doesc20years, 11596 title = {{Facilities for the Future of Science: A Twenty-Year Outlook}}, 11597 key = {Office of Science, U.S. Department of Energy}, 11598 year = {2003}, 11599 howpublished = {Office of Science, U.S. Department of Energy, see 11600 \url{http://www.sc.doe.gov/Scientific_User_Facilities/History/20-Year-Outlook-screen.pdf}} 11601} 11602 11603@PhDThesis{ karpeev-thesis, 11604 author = {D. A. Karpeyev}, 11605 title = {Geometric Integrators for Hamiltonian PDEs}, 11606 school = {Old Dominion University}, 11607 year = {2002} 11608} 11609 11610@InCollection{ fjp:ima, 11611 author = {Lori Freitag and Mark Jones and Paul Plassmann}, 11612 title = {The Scalability of Mesh Improvement Algorithms}, 11613 booktitle = {Algorithms for Parallel Processing}, 11614 publisher = {Springer-Verlag}, 11615 volume = {105}, 11616 series = {The IMA Volumes in Mathematics and Its Applications}, 11617 editor = {Michael T.\ Heath and Abhiram Ranade and Robert S.\ Schreiber}, 11618 year = {1998}, 11619 pages = {185--212} 11620} 11621 11622@InProceedings{ poet, 11623 author = {Rob Armstrong and Alex Cheung}, 11624 title = {{POET} ({P}arallel {O}bject-Oriented {E}nvironment and {T}oolkit) and Frameworks 11625 for Scientific Distributed Computing}, 11626 booktitle = {Proceedings of {HICSS97}}, 11627 year = {1997} 11628} 11629 11630@Misc{ pseware-web-page, 11631 author = {}, 11632 title = {{PSEware} {Web} page}, 11633 note = {\url{http://www.extreme.indiana.edu/pseware}, Indiana University}, 11634 key = {{PSEware} {Web} page} 11635} 11636 11637@Article{ epperly2011high, 11638 title = {High-performance language interoperability for scientific computing through 11639 {B}abel}, 11640 author = {Epperly, Thomas GW and Kumfert, Gary and Dahlgren, Tamara and Ebner, Dietmar and 11641 Leek, Jim and Prantl, Adrian and Kohn, Scott}, 11642 journal = {International Journal of High Performance Computing Applications}, 11643 pages = {1094342011414036}, 11644 year = {2011}, 11645 publisher = {SAGE Publications} 11646} 11647 11648@Misc{ babel-web-page, 11649 author = {Tom Epperly and Tamara Dahlgren and Gary Kumfert}, 11650 title = {{Babel} {Web} page}, 11651 note = {\url{http://www.llnl.gov/CASC/components/babel.html}} 11652} 11653 11654@Misc{ infospheres-web-page, 11655 author = {K.~M. {Chandy et al.}}, 11656 title = {{Infospheres} {W}eb page}, 11657 note = {\url{http://www.infospheres.caltech.edu}}, 11658 key = {{Infospheres} {Web} page} 11659} 11660 11661@Misc{ hammond, 11662 author = {Glenn Hammond}, 11663 title = {{Sandia National Laboratory}, {C}omputations on {R}eactive {F}low, private 11664 communication} 11665} 11666 11667@Misc{ ornl, 11668 author = {Oak Ridge National Laboratory}, 11669 title = {Private communication via petsc-maint email support} 11670} 11671 11672@Unpublished{ cumulvs-web-page, 11673 author = {}, 11674 title = {{Cumulvs} {W}eb page}, 11675 note = {http://www.epm.ornl.gov/cs/cumulvs.html}, 11676 key = {{Cumulvs} {W}eb page} 11677} 11678 11679@Article{ nonlineargmres, 11680 author = {T. Washio and C. W. Oosterlee}, 11681 title = {Krylov Subspace Acceleration for Nonlinear Multigrid Schemes}, 11682 journal = {ETNA}, 11683 year = {1997}, 11684 pages = {271--290}, 11685 volume = {6} 11686} 11687 11688@Article{ pcice, 11689 author = {Richard C. Martineau and Ray A. Berry}, 11690 title = {The pressure-corrected ICE finite element method for compressible flows on 11691 unstructured meshes}, 11692 journal = {Journal of Computational Physics}, 11693 year = {2004}, 11694 pages = {659--685}, 11695 volume = {198(2)} 11696} 11697 11698@Article{ cumulvs97, 11699 author = {G. A. Geist and J. A. Kohl and P. M. Papadopoulos}, 11700 title = {{CUMULVS}: Providing Fault-Tolerance, Visualization, and Steering of Parallel 11701 Applications}, 11702 journal = {International Journal of Supercomputing Applications}, 11703 year = {1997} 11704} 11705 11706@TechReport{ daly2012interagency, 11707 author = {John Daly and Bill Harrod and Thuc Hoang and Lucy Nowell and Bob Adolf and 11708 Shekhar Borkar and Nathan DeBardeleben and Mootaz Elnozahy and Mike Heroux and 11709 David Rogers and Rob Ross and Vivek Sarkar and Martin Schulz and Marc Snir and 11710 Paul Woodward}, 11711 title = {Inter-Agency Workshop on HPC Resilience at Extreme Scale}, 11712 year = {2012}, 11713 publisher = {US Department of Defense} 11714} 11715 11716@Article{ karpeev1, 11717 author = {A. L. Islas and D. A. Karpeev and C. M. Schober}, 11718 title = {Geometric Integrators for the Nonlinear Schr\"odinger Equation}, 11719 journal = {J. Comp. Phys.}, 11720 year = {2001}, 11721 pages = {116--148}, 11722 volume = {173} 11723} 11724 11725@InProceedings{ scirun97, 11726 author = {S. G. Parker and D. W. Weinstein and C. R. Johnson}, 11727 title = {The {SCIRun} Computational Steering System}, 11728 booktitle = {Modern Software Tools in Scientific Computing}, 11729 editor = {E. Arge and A. M. Bruaset and H. P. Langtangen}, 11730 publisher = {Birkhauser Press}, 11731 year = {1997} 11732} 11733 11734@TechReport{ szyld, 11735 author = {Valeria Simoncini and Daniel B. Szyld}, 11736 title = { Theory of Inexact Krylov Subspace Methods and Applications to Scientific 11737 Computing}, 11738 year = {2002}, 11739 institution = {Department of Mathematics, Temple University}, 11740 number = {02-4-12} 11741} 11742 11743@TechReport{ pdelab, 11744 author = {S. Weerawarana and E. N. Houstis and J. R. Rice and A. C. Catlin and C. Crabill 11745 and C. C. Chui and S. Markus}, 11746 title = {{PDELab}: An Object-Oriented Framework for Building Problem Solving Environments 11747 for {PDE} Based Applications}, 11748 year = {1994}, 11749 institution = {Department of Computer Sciences, Purdue University}, 11750 number = {CSD-TR-94-021} 11751} 11752 11753@Unpublished{ ilu-web-page, 11754 author = {Bill Janssen and Mike Spreitzer and Dan Larner and Chris Jacobi}, 11755 title = {{I}nter-{L}anguage {U}nification Reference Manual}, 11756 note = {ftp://ftp.parc.xerox.com/ilu/ilu.html, Xerox Corporation} 11757} 11758 11759@Unpublished{ doe2k-web-page, 11760 title = {{DOE2000 Initiative} {W}eb page}, 11761 note = {http://www.mcs.anl.gov/DOE2000}, 11762 key = {DOE2000 Initiative} 11763} 11764 11765@Misc{ pvode-web-page, 11766 title = {{PVODE} {W}eb Page}, 11767 note = {\url{http://www.llnl.gov/CASC/PVODE}, Lawrence Livermore National Laboratory}, 11768 author = {A. {Hindmarsh et al.}} 11769} 11770 11771@Book{ szyperski97, 11772 author = {Clemens Szyperski}, 11773 title = {Component Software: Beyond Object-Oriented Programming}, 11774 publisher = {ACM Press}, 11775 address = {New York}, 11776 year = {1997} 11777} 11778 11779@Unpublished{ petsc:coloringuse, 11780 title = {Code for computing sparse {J}acobians}, 11781 note = {\url{http://www.mcs.anl.gov/petsc/miscellaneous/external.html}}, 11782 institution = {Argonne National Laboratory} 11783} 11784 11785@Unpublished{ petsc:external, 11786 author = {B. F. {Smith et al.}}, 11787 title = {{External Software Used by PETSc}}, 11788 note = {\url{http://www.mcs.anl.gov/petsc/miscellaneous/external.html}}, 11789 institution = {Argonne National Laboratory} 11790} 11791 11792@Unpublished{ petsc:use-by-external-packages, 11793 author = {B. F. {Smith et al.}}, 11794 title = {{Software Packages that Use or Interface to PETSc}}, 11795 note = {\url{http://www.mcs.anl.gov/petsc/publications/petscapps.html#packages}}, 11796 institution = {Argonne National Laboratory} 11797} 11798 11799@Unpublished{ petsc:prizes, 11800 author = {B. F. {Smith et al.}}, 11801 title = {{Prizes Won Using PETSc}}, 11802 note = {\url{http://www.mcs.anl.gov/petsc/publications/prizes.html}}, 11803 institution = {Argonne National Laboratory} 11804} 11805 11806@Unpublished{ petsc:csgf, 11807 author = {B. F. {Smith et al.}}, 11808 title = {{DOE Computational Science Graduate Fellowship (CSGF) Users of PETSc}}, 11809 note = {\url{http://www.mcs.anl.gov/petsc/publications/prizes.html}}, 11810 institution = {Argonne National Laboratory} 11811} 11812 11813@Unpublished{ flash-web-page, 11814 title = {{U}niversity of {C}hicago {C}enter on {A}strophysical {T}hermonuclear {F}lashes 11815 {W}eb Page}, 11816 note = {http://www.asci.uchicago.edu}, 11817 author = {R. {Rosner et al.}}, 11818 institution = {University of Chicago} 11819} 11820 11821@Unpublished{ esi-web-page, 11822 title = {{E}quation {S}olver {I}nterface {F}orum {W}eb Page}, 11823 note = {http://z.ca.sandia.gov/esi}, 11824 author = {R. {Clay et al.}} 11825} 11826 11827@Unpublished{ infobus-web-page, 11828 title = {{I}nfo{B}us {W}eb Page}, 11829 note = {http://www.java.sun.com/beans/infobus}, 11830 key = {infobus} 11831} 11832 11833@Unpublished{ xray-web-page, 11834 title = {{S}upercomputer {S}olution of {M}assive {C}rystallographic and {M}icrotomographic 11835 {S}tructural {P}roblems {W}eb Page ({DOE} Grand Challenge Project)}, 11836 note = {http://www.mcs.anl.gov/xray/}, 11837 institution = {Argonne National Laboratory} 11838} 11839 11840@InProceedings{ kohn98, 11841 author = {Andrew Cleary and Scott Kohn and Steven Smith and Brent Smolinski}, 11842 title = {Language Interoperability Mechanisms for High-Performance Scientific 11843 Applications}, 11844 publisher = {SIAM}, 11845 booktitle = {Proceedings of the SIAM Workshop on Object Oriented Methods for Inter-operable 11846 Scientific and Engineering Computing}, 11847 year = {1999}, 11848 pages = {30-39} 11849} 11850 11851@InProceedings{ kohn01, 11852 author = {Scott Kohn and Gary Kumfert and Jeff Painter and Cal Ribbens}, 11853 title = {Divorcing Language Dependencies from a Scientific Software Library}, 11854 publisher = {SIAM}, 11855 booktitle = {Proceedings of the Tenth SIAM Conference on Parallel Processing}, 11856 year = {2001} 11857} 11858 11859@InProceedings{ freitag_jones_plassmann98, 11860 author = {Lori Freitag and Mark Jones and Paul Plassmann}, 11861 title = {Component Integration for Unstructured Mesh Algorithms and Software}, 11862 publisher = {SIAM}, 11863 booktitle = {Proceedings of the SIAM Workshop on Object Oriented Methods for Inter-operable 11864 Scientific and Engineering Computing}, 11865 year = {1999}, 11866 pages = {215-224} 11867} 11868 11869@Book{ templates, 11870 author = {R. Barrett and M. Berry and T. F. Chan and J. Demmel and J. Donato and J. 11871 Dongarra and V. Eijkhout and R. Pozo and C. Romine and H. Van der Vorst }, 11872 title = {Templates for the Solution of Linear Systems: Building Blocks for Iterative 11873 Methods}, 11874 publisher = {SIAM}, 11875 year = {1994}, 11876 address = {Philadelphia, PA} 11877} 11878 11879@InProceedings{ parasha2, 11880 author = {M. Parashar and J. C. Browne and C. Edwards and K. Klimkowski}, 11881 title = { A Common Data Management Infrastructure for Parallel Adaptive Algorithms for 11882 {PDE} Solutions}, 11883 booktitle = {SC97 Proceedings}, 11884 publisher = {IEEE Computer Society Press}, 11885 year = {1997} 11886} 11887 11888@TechReport{ parasha, 11889 author = {M. Parashar and J. C. Browne}, 11890 title = {{DAGH}: A Data-Management Infrastructure for Parallel Adaptive Mesh Refinement 11891 Techniques}, 11892 institution = {Department of Computer Science, University of Texas at Austin}, 11893 year = {1995} 11894} 11895 11896@Article{ parti, 11897 author = {R. Das and M. Uysal and J. Saltz and Y. S. Hwang}, 11898 title = {Communication Optimizations for Irregular Scientific Computations on Distributed 11899 Memory Architectures}, 11900 journal = {Journal of Parallel and Distributed Computing}, 11901 year = {1994}, 11902 volume = {22}, 11903 pages = {462--478} 11904} 11905 11906@Article{ mparti, 11907 author = {G. Agrawal and A. Sussman and J. Saltz}, 11908 title = {An Integrated Runtime and Compile-time Approach for Parallelizing Structured and 11909 Block Structured Applications}, 11910 journal = {IEEE Trans. on Parallel and Distributed Systems}, 11911 volume = {6}, 11912 number = {7}, 11913 year = {1995} 11914} 11915 11916@Article{ gropp-lusk-doss-skjellum, 11917 author = { William Gropp and Ewing Lusk and Nathan Doss and Anthony Skjellum}, 11918 title = {A high-performance, portable implementation of the {MPI} Message Passing 11919 Interface standard}, 11920 journal = {Parallel Computing}, 11921 year = {1996}, 11922 volume = {22}, 11923 pages = {789--828} 11924} 11925 11926@InProceedings{ lam, 11927 author = {Greg Burns and Raja Daoud and James Vaigl}, 11928 title = {{LAM}: An Open Cluster Environment for {MPI}}, 11929 booktitle = {Proceedings of Supercomputing Symposium '94}, 11930 editor = {John W. Ross}, 11931 publisher = {University of Toronto}, 11932 pages = {379--386}, 11933 year = {1994} 11934} 11935 11936@Article{ cs99, 11937 author = {X.-C. Cai and M. Sarkis}, 11938 title = {A restricted additive {S}chwarz preconditioner for general sparse linear 11939 systems}, 11940 journal = {SIAM J. Scientific Computing}, 11941 year = {1999}, 11942 volume = {21}, 11943 pages = {792-797} 11944} 11945 11946@TechReport{ cs97a, 11947 author = {X.-C. Cai and M. Sarkis}, 11948 title = {A restricted additive {S}chwarz preconditioner for general sparse linear systems 11949 }, 11950 year = {1997}, 11951 institution = {Computer Science Department, University of Colorado-Boulder}, 11952 number = {CU-CS 843-97}, 11953 note = {(accepted by SIAM J. of Scientific Computing)} 11954} 11955 11956@Article{ cai2003restricted, 11957 title = {Restricted additive {S}chwarz preconditioners with harmonic overlap for symmetric 11958 positive definite linear systems}, 11959 author = {Cai, X.C. and Dryja, M. and Sarkis, M.}, 11960 journal = {SIAM Journal on Numerical Analysis}, 11961 volume = {41}, 11962 issue = {1}, 11963 pages = {1209--1231}, 11964 year = {2003}, 11965 doi = {10.1137/S0036142901389621} 11966} 11967 11968@TechReport{ caisaad, 11969 author = {Xiao-Chuan Cai and Youcef Saad}, 11970 title = {Overlapping domain decomposition algorithms for general sparse matrices}, 11971 institution = {Army High Performance Computing Research Center, University of Minnesota }, 11972 year = {1993}, 11973 number = {Preprint 93-027 }, 11974 note = {SIAM J. Sci. Comp. (submitted)} 11975} 11976 11977@Book{ ruminations, 11978 author = {Andrew Koenig and Barbara Moo}, 11979 title = {Ruminations on C++}, 11980 year = {1996}, 11981 publisher = {Addison-Wesley} 11982} 11983 11984@Book{ mpi-complete, 11985 author = {Marc Snir and Steve Otto and Steven Huss-Lederman and David Walker and Jack 11986 Dongarra}, 11987 title = {{MPI}: The Complete Reference}, 11988 year = {1995}, 11989 publisher = {MIT Press} 11990} 11991 11992@Unpublished{ tcl-tk-web-page, 11993 title = {{Tcl/Tk} {W}orld {W}ide {W}eb page}, 11994 note = {http://www.sunlabs.com/research/tcl/}, 11995 year = {1996}, 11996 month = aug 11997} 11998 11999@Misc{ mpich-web-page, 12000 author = {William Gropp and {et. al.}}, 12001 title = {{MPICH} {W}eb page}, 12002 key = {MPICH}, 12003 url = {http://www.mpich.org}, 12004 howpublished = {\url{http://www.mpich.org}} 12005} 12006 12007@Article{ mpi-final, 12008 author = {MPI Forum}, 12009 title = {{MPI}: A Message-Passing Interface Standard}, 12010 journal = {International J. Supercomputing Applications}, 12011 volume = {8}, 12012 number = {3/4}, 12013 year = {1994}, 12014 key = {MPI Standard - final} 12015} 12016 12017@Unpublished{ npb-web-page, 12018 key = {NAS Parallel Benchmarks}, 12019 title = {{NAS} {P}arallel {B}enchmarks {W}eb page}, 12020 note = {http://www.nas.nasa.\-gov/\-NAS/\-NPB/\-index.html}, 12021 year = {1996}, 12022 month = dec 12023} 12024 12025@Book{ george81, 12026 title = {Computer Solution of Large Sparse Positive Definite Systems}, 12027 author = {Alan George and Joseph W. Liu}, 12028 publisher = {Prentice-Hall}, 12029 year = {1981}, 12030 key = {SparseDirect} 12031} 12032 12033@Book{ p4-book, 12034 title = {Portable Programs for Parallel Processors}, 12035 publisher = {Holt, Rinehart, {and} Winston}, 12036 year = {1987}, 12037 author = {James Boyle and Ralph Butler and Terrence Disz and Barnett Glickfeld and Ewing 12038 Lusk and Ross Overbeek and James Patterson and Rick Stevens}, 12039 key = {P4Book} 12040} 12041 12042@Article{ stones, 12043 author = {H. L. Stone}, 12044 title = {Iterative solution of implicit approximations of multidimensional partial 12045 differential equations}, 12046 journal = {SIAM J. Numerical Analysis}, 12047 pages = {87--113}, 12048 volumne = {5}, 12049 year = {1968} 12050} 12051 12052@Article{ parallelstones, 12053 author = {J. S. Reeve and A. D. Scurr and J. H. Merlin}, 12054 title = {Parallel versions of {S}tones strongly implicit algorithm}, 12055 journal = {Concurrency and Computation: Practice and Experience}, 12056 pages = {1049--1062}, 12057 volumne = {13}, 12058 year = {2001} 12059} 12060 12061@Article{ p4-paper, 12062 author = {Ralph Butler and Ewing Lusk}, 12063 title = {Monitors, Messages, and Clusters: {T}he p4 Parallel Programming System}, 12064 journal = {Journal of Parallel Computing}, 12065 note = {To appear (Also Argonne National Laboratory Mathematics and Computer Science 12066 Division preprint P362-0493)}, 12067 year = {1993} 12068} 12069 12070@TechReport{ picl, 12071 author = {G.~A.~Geist and Michael~T.~Heath and B.~W.~Peyton and Patrick~H.~Worley}, 12072 title = {{PICL}: A portable instrumented communications library}, 12073 institution = {Oak Ridge National Laboratory}, 12074 number = {TM-11130}, 12075 year = {1990}, 12076 key = {PICL} 12077} 12078 12079@TechReport{ upshot, 12080 author = {Virginia Herrarte and Ewing Lusk}, 12081 title = {Studying Parallel Program Behavior with {U}pshot}, 12082 institution = {Argonne National Laboratory}, 12083 number = {ANL-91/15}, 12084 month = aug, 12085 year = {1991}, 12086 key = {Upshot} 12087} 12088 12089@TechReport{ p4-manual, 12090 author = {Ralph Butler and Ewing Lusk}, 12091 title = {User's Guide to the p4 Parallel Programming System}, 12092 institution = {Argonne National Laboratory}, 12093 number = {ANL-92/17}, 12094 month = oct, 12095 year = {1992}, 12096 key = {p4-Manual} 12097} 12098 12099@InProceedings{ oldparti, 12100 author = {Gagan Agrawal and Alan Sussman and Joel Saltz}, 12101 title = {Compiler and Runtime Support for Unstructured and Block Structured Problems}, 12102 booktitle = {Proceedings of Supercomputing '93}, 12103 pages = {578--587}, 12104 year = {1993} 12105} 12106 12107@Article{ parti2, 12108 author = {S. S. Mukherjee and S. D. Sharma and M. DF. Hill and J. R. Larus and A. Rogers 12109 and J. Saltz}, 12110 title = {Efficient Support for Irregular Applications on Distributed Memory Machines}, 12111 journal = {ACM SIGPLAN Notices}, 12112 year = {1995}, 12113 pages = {68-79}, 12114 volume = {30}, 12115 number = {8} 12116} 12117 12118@Article{ parti3, 12119 author = {J. Saltz and R. Mirchandaney and K. Crowley}, 12120 title = {Run-Time Parallelization and Scheduling of Loops}, 12121 journal = {IEEE Trans. Computers}, 12122 year = {1991}, 12123 pages = {604-612}, 12124 volume = {40}, 12125 number = {5} 12126} 12127 12128@InProceedings{ disz-lusk:wamtrace, 12129 author = {Terrence Disz and Ewing Lusk}, 12130 title = {A Graphical Tool for Observing the Behavior of Parallel Logic Programs}, 12131 booktitle = {Proceedings of the 1987 Symposium on Logic Programming}, 12132 year = {1987}, 12133 pages = {46--53} 12134} 12135 12136@InProceedings{ gorlick-kesselman:gauge, 12137 author = {Michael Gorlick and Carl Kesselman}, 12138 title = {Timing {Prolog} programs without Clocks}, 12139 booktitle = {Proceedings of the 1987 Symposium on Logic Programming}, 12140 year = {1996}, 12141 publisher = {Birkhauser} 12142} 12143 12144@TechReport{ aztec, 12145 author = {Scott A. Hutchinson and John N. Shadid and Ray S. Tuminaro}, 12146 title = {Aztec User's Guide Version 1.1}, 12147 institution = {Sandia National Laboratories}, 12148 month = oct, 12149 year = {1995}, 12150 number = {SAND95/1559} 12151} 12152 12153@TechReport{ aztec2, 12154 author = {Ray S. Tuminaro and Micheal Heroux and Scott A. Hutchinson and John N. Shadid}, 12155 title = {Official {Aztec} User's Guide Version 2.1}, 12156 institution = {Sandia National Laboratories}, 12157 year = {1999} 12158} 12159 12160@Book{ taylor-chandy:pcn, 12161 author = {Chandy, M. and Taylor, S.}, 12162 title = {An Introduction to Parallel Programming}, 12163 year = {1991}, 12164 publisher = {Jones and Bartlett} 12165} 12166 12167@Book{ foster-taylor:strand, 12168 title = {Strand: New Concepts in Parallel Programming}, 12169 author = {Ian Foster and Stephen Taylor}, 12170 publisher = {Prentice-Hall}, 12171 adress = { Englewood Cliffs, New Jersey}, 12172 year = {1990} 12173} 12174 12175@Article{ aurora, 12176 author = {E. Lusk and R. Butler and T. Disz and R. Olson and R. Overbeek and R. Stevens and 12177 D.H.D. Warren and A. Calderwood and P. Szeredi and S. Haridi and P. Brand and M. 12178 Carlsson and A. Ciepielewski and B. Hausman}, 12179 title = {The Aurora OR-Parallel Prolog System}, 12180 journal = {New Generation Computing}, 12181 volume = {7}, 12182 number = {3}, 12183 year = {1990}, 12184 pages = {243--271} 12185} 12186 12187@TechReport{ roo, 12188 author = {E. Lusk and W. McCune and J. Slaney}, 12189 title = {Roo---a Parallel Theorem Prover}, 12190 institution = {Argonne National Laboratory}, 12191 number = {MCS--TM--149}, 12192 year = {1991} 12193} 12194 12195@TechReport{ heath-etheridge:vppp, 12196 author = {M. T. Heath and J. A. Etheridge}, 12197 title = {Visualizing the Performance of Parallel Programs}, 12198 institution = {Oak Ridge National Laboratory}, 12199 number = {ORNL TM-11813}, 12200 year = {1991} 12201} 12202 12203@TechReport{ chem:vis, 12204 author = {Ewing L. Lusk}, 12205 title = {Performance Visualization for Parallel Programs}, 12206 institution = {Argonne National Laboratory}, 12207 number = {ANL/MCS--P287--0192}, 12208 year = {1991}, 12209 note = {(to appear in {\em Theoretica Chimica Acta})} 12210} 12211 12212@TechReport{ picltrace, 12213 author = {P.~H.~Worley}, 12214 title = {A new {PICL} trace file format}, 12215 institution = {Oak Ridge National Laboratory}, 12216 number = {ORNL TM-12125}, 12217 month = jun, 12218 year = {1992} 12219} 12220 12221@InProceedings{ hideo, 12222 author = {Gary Olsen and Carl Woese and Ray Hagstrom and Hideo Matsuda and Ross Overbeek}, 12223 title = {Inference of Phylogenetic trees using maximum likelihood}, 12224 booktitle = {Proceedings of the First Intel Delta Applications Workshop}, 12225 year = {1992}, 12226 pages = {247--262} 12227} 12228 12229@InProceedings{ dw90, 12230 author = {M. Dryja and O. Widlund}, 12231 title = {Towards a Unified Theory of Domain Decomposition Algorithms for Elliptic 12232 Problems}, 12233 booktitle = {Third International Symposium on Domain Decomposition Methods}, 12234 editor = {T. F. Chan and R. Glowinski and J. P\'eriaux and O. B. Widlund}, 12235 year = {1990}, 12236 pages = {3-21}, 12237 publisher = {SIAM}, 12238 address = {Philadelphia}, 12239 annote = {Additive {S}chwarz. Surveys recent (1989) results; some comments on 3-d and how 12240 many approaches may be cast in the form of additive {S}chwarz-subspace form. 58 12241 references, good introduction to the theory. No computations}, 12242 key = {DryjaWidlund90 !AS} 12243} 12244 12245@Unpublished{ rosing, 12246 author = {Matt Rosing and Joel Saltz}, 12247 title = {Low Latency Messages on Distributed Memory Multiprocessors}, 12248 key = {LowLatency}, 12249 note = {manuscript, 1992} 12250} 12251 12252@TechReport{ jp:incomplete, 12253 author = {Mark T. Jones and Paul E. Plassmann}, 12254 title = {An Improved Incomplete {C}holesky Factorization}, 12255 institution = {Argonne National Laboratory}, 12256 address = {Argonne, IL}, 12257 type = {Preprint}, 12258 note = {(to appear in {\em ACM Trans. on Mathematical Software, 1995})}, 12259 number = {MCS-P206-0191}, 12260 year = {1991}, 12261 key = {jones} 12262} 12263 12264@InCollection{ jp:ima, 12265 author = {Mark Jones and Paul Plassmann}, 12266 title = {The Efficient Parallel Iterative Solution of Large Sparse Linear Systems}, 12267 booktitle = {Graph Theory and Sparse Matrix Computation}, 12268 publisher = {Springer-Verlag}, 12269 series = {The IMA Volumes in Mathematics and Its Applications}, 12270 editor = {Alan George and John Gilbert and Joseph W.H.~Liu}, 12271 volume = {56}, 12272 year = {1993}, 12273 pages = {229--245} 12274} 12275 12276@Article{ pw98, 12277 author = {M. Pernice and H. F. Walker}, 12278 title = {{NITSOL}: A {Newton} Iterative Solver for Nonlinear Systems}, 12279 journal = {SIAM J. Sci. Stat. Comput.}, 12280 year = {1998}, 12281 volume = {19}, 12282 pages = {302--318} 12283} 12284 12285@TechReport{ ysmp83, 12286 key = {Eisenstat}, 12287 author = {S.~C.~Eisenstat and H.~C.~Elman and M.~H.~Schultz and A.~H.~Sherman}, 12288 title = {The (New) {Y}ale {S}parse {M}atrix {P}ackage}, 12289 institution = {Department of Computer Science, Yale University}, 12290 number = {YALE/DCS/RR-265}, 12291 month = apr, 12292 year = {1983} 12293} 12294 12295@InBook{ ysmp84, 12296 author = {S.~C.~Eisenstat and H.~C.~Elman and M.~H.~Schultz and A.~H.~Sherman}, 12297 chaptertitle = {The (New) {Y}ale {S}parse {M}atrix {P}ackage}, 12298 title = {Elliptic Problem Solvers II}, 12299 publisher = {Academic Press}, 12300 pages = {45--52}, 12301 editors = {G. Birkhoff and A. Schoenstadt}, 12302 year = {1984} 12303} 12304 12305@TechReport{ sparsekit, 12306 key = {Saad}, 12307 author = {Youcef Saad}, 12308 title = {{SPARSKIT}, a basic tool kit for sparse matrix computations}, 12309 institution = {Center for Supercomputing Research and Development, University of Illinois at 12310 Urbana-Champaign}, 12311 number = {1029}, 12312 year = {1990} 12313} 12314 12315@TechReport{ pde-user-ref, 12316 author = {Barry F. Smith}, 12317 title = {Extensible {PDE} Solvers Package Users Manual}, 12318 institution = {Argonne National Laboratory}, 12319 month = sep, 12320 year = {1994}, 12321 number = {ANL-93/40}, 12322 key = {Smith94 ! PDE} 12323} 12324 12325@TechReport{ bs-user-ref, 12326 author = {Mark T. Jones and Paul E. Plassmann}, 12327 title = {{BlockSolve95} Users Manual: Scalable Library Software for the Parallel Solution 12328 of Sparse Linear Systems}, 12329 institution = {Argonne National Laboratory}, 12330 month = dec, 12331 year = {1995}, 12332 number = {ANL-95/48} 12333} 12334 12335@TechReport{ snes-user-ref, 12336 author = {William D. Gropp and Lois Curfman McInnes and Barry F. Smith}, 12337 title = {Using the {S}calable {N}onlinear {E}quations {S}olvers Package}, 12338 institution = {Argonne National Laboratory}, 12339 month = feb, 12340 year = {1995}, 12341 number = {ANL/MCS-TM-193}, 12342 key = {GroppMcInnesSmith95 ! SNES} 12343} 12344 12345@TechReport{ sles-user-ref, 12346 author = {William D. Gropp and Barry F. Smith}, 12347 title = {{S}implified {L}inear {E}quation {S}olvers Users Manual}, 12348 institution = {Argonne National Laboratory}, 12349 month = mar, 12350 year = {1993}, 12351 number = {ANL-93/8}, 12352 key = {GroppSmith93 ! SLES} 12353} 12354 12355@TechReport{ chameleon-user-ref, 12356 author = {William D. Gropp and Barry F. Smith}, 12357 title = {Chameleon Parallel programming tools Users Manual}, 12358 institution = {Argonne National Laboratory}, 12359 month = mar, 12360 year = {1993}, 12361 number = {ANL-93/23}, 12362 key = {GroppSmith93 ! Chameleon} 12363} 12364 12365@Article{ euclid2, 12366 author = {D. Hysom and A. Pothen}, 12367 title = {A Scalable Parallel Algorithm For Incomplete Factor Preconditioning}, 12368 journal = {SIAM J. Sci. Comput.}, 12369 volume = {22}, 12370 number = {6}, 12371 pages = {2194--2215} 12372} 12373 12374@TechReport{ euclid1, 12375 author = {D. Hysom and A. Pothen}, 12376 title = {Euclid User Manual (A Scalable {ILU} Preconditioning Library for the Parallel 12377 Solution of Sparse Linear Systems)}, 12378 institution = {Old Dominion University}, 12379 year = {2001} 12380} 12381 12382@TechReport{ ksp-user-ref, 12383 author = {William D. Gropp and Barry F. Smith}, 12384 title = {Users Manual for {KSP}: Data-Structure-Neutral Codes Implementing {K}rylov Space 12385 Methods}, 12386 institution = {Argonne National Laboratory}, 12387 month = aug, 12388 year = {1993}, 12389 number = {ANL-93/30}, 12390 key = {GroppSmith93 ! KSP} 12391} 12392 12393@TechReport{ mpi-chameleon, 12394 author = {William D. Gropp and Ewing Lusk}, 12395 title = {A Test Implementation of the {MPI} Draft Message-Passing Standard}, 12396 institution = {Argonne National Laboratory}, 12397 month = dec, 12398 year = {1992}, 12399 number = {ANL-92/47}, 12400 key = {GroppLusk92 ! MPI} 12401} 12402 12403@TechReport{ blockcomm-fortran, 12404 author = {William D. Gropp}, 12405 title = {Block{C}omm for {F}ortran}, 12406 institution = {Argonne National Laboratory}, 12407 month = may, 12408 year = {1993}, 12409 number = {ANL-93/00 (to appear)}, 12410 key = {Gropp93 ! BlockComm} 12411} 12412 12413@TechReport{ autodocument, 12414 author = {William D. Gropp}, 12415 title = {Automatic documentation of {C} programs}, 12416 institution = {Argonne National Laboratory}, 12417 month = may, 12418 year = {1993}, 12419 number = {ANL-93/00}, 12420 key = {Gropp93 ! Autodoc} 12421} 12422 12423@TechReport{ zipcode, 12424 author = {Anthony Skjellum and Steven G. Smith and Charles H Still and Alvin P. Leung and 12425 Manfred Morari}, 12426 title = {The {Z}ipcode message-passing system}, 12427 institution = {Lawrence Livermore National Laboratory}, 12428 month = sep, 12429 year = {1992}, 12430 number = {Unpublished}, 12431 key = {Skjellum92 ! Zipcode} 12432} 12433 12434@Article{ paragraph, 12435 author = {Michael T. Heath and Jennifer Etheridge Finger}, 12436 title = {Visualizing performance of parallel programs}, 12437 journal = {IEEE Software}, 12438 volume = {8}, 12439 number = {5}, 12440 month = sep, 12441 year = {1991}, 12442 pages = {29--39}, 12443 key = {Heath91 ! Paragraph} 12444} 12445 12446@Article{ gropp90, 12447 author = {William Gropp and Edward Smith}, 12448 title = {Computational Fluid Dynamics on Parallel Processors}, 12449 journal = {Computers and Fluids}, 12450 volume = {18}, 12451 year = {1990}, 12452 pages = {289--304}, 12453 key = {Gropp90 ! performance} 12454} 12455 12456@Article{ foster92, 12457 author = {Ian Foster and William Gropp and Rick Stevens}, 12458 title = {The parallel scalability of the spectral transform method}, 12459 journal = {Monthly Weather Review}, 12460 volume = {120}, 12461 year = {1992}, 12462 pages = {835--850}, 12463 key = {Foster92 ! performance} 12464} 12465 12466@InBook{ fgn, 12467 author = {R. Freund and G. H. Golub and N. Nachtigal}, 12468 title = {Iterative Solution of Linear Systems}, 12469 series = {Acta Numerica}, 12470 year = {1992}, 12471 publisher = {Cambridge University Press}, 12472 pages = {57--100} 12473} 12474 12475@TechReport{ nachtigal90, 12476 author = {No{\"e}l M. Nachtigal and Satish C. Reddy and Lloyd N. Trefethen}, 12477 title = {How Fast are Nonsymmetric Matrix Iterations?}, 12478 institution = {Massachusetts Institute of Technology}, 12479 month = mar, 12480 year = {1990}, 12481 number = {90-2}, 12482 key = {Nachtigal | Krylov} 12483} 12484 12485@Article{ nachtigal1992fnm, 12486 title = {How Fast are Nonsymmetric Matrix Iterations?}, 12487 author = {Nachtigal, N.M. and Reddy, S.C. and Trefethen, L.N.}, 12488 journal = {SIAM Journal on Matrix Analysis and Applications}, 12489 volume = {13}, 12490 pages = {778}, 12491 year = {1992}, 12492 publisher = {SIAM} 12493} 12494 12495@TechReport{ embree1999descriptive, 12496 title = {How descriptive are {GMRES} convergence bounds}, 12497 author = {Embree, M.}, 12498 year = {1999}, 12499 number = {08}, 12500 institution = {Oxford University Computing Laboratory} 12501} 12502 12503@Article{ vorst92, 12504 author = {H. van der Vorst}, 12505 title = {Bi-{CGSTAB}: A fast and smoothly converging variant of {Bi-CG} for the solution 12506 of nonsymmetric linear systems}, 12507 journal = {SIAM J. Sci. Stat. Comput.}, 12508 year = {1992}, 12509 volume = {13}, 12510 pages = {631--644} 12511} 12512 12513@Article{ eisenstat81, 12514 author = {S. Eisenstat}, 12515 title = {Efficient Implementation of a Class of {CG} Methods}, 12516 journal = {SIAM J. Sci. Stat. Comput.}, 12517 year = {1981}, 12518 volume = {2}, 12519 pages = {1--4} 12520} 12521 12522@Manual{ ibm-essl, 12523 title = {{E}ngineering and {S}cientific {S}ubroutine {L}ibrary Version 2: Guide and 12524 Reference}, 12525 organization = {IBM}, 12526 year = {1992}, 12527 key = {IBM-ESSL} 12528} 12529 12530@Manual{ ibm-eui, 12531 title = {{IBM} {AIX} Parallel Environment Parallel Programming Subroutine Reference 12532 Release 2.0}, 12533 organization = {IBM}, 12534 month = jun, 12535 year = {1994}, 12536 key = {IBM-EUI} 12537} 12538 12539@Manual{ ibm-euih, 12540 title = {Using {EUIH}: An Experimental {EUI} Implementation}, 12541 organization = {IBM}, 12542 author = {Peter Hochschild}, 12543 year = {1993}, 12544 key = {IBM-EUIH} 12545} 12546 12547@TechReport{ mpi, 12548 title = {Document for a Standard Message-Passing Interface}, 12549 author = {Message Passing Interface Forum}, 12550 institution = {University of Tennessee}, 12551 number = {CS-93-214}, 12552 month = nov, 12553 year = {1993}, 12554 key = {MPI Standard} 12555} 12556 12557@Unpublished{ mpi-final-web, 12558 author = {Message Passing Interface Forum}, 12559 title = {{MPI}: A Message-Passing Interface Standard}, 12560 note = {http://www.mcs.anl.gov/mpi/mpi-report/mpi-report.html}, 12561 year = {1994}, 12562 month = may 12563} 12564 12565@Book{ hockney-jesshope, 12566 author = {R. W. Hockney and C. R. Jesshope}, 12567 title = {Parallel Computers 2}, 12568 publisher = {Adam Hilger}, 12569 year = {1988} 12570} 12571 12572@Book{ cm-fortran, 12573 author = {{Thinking Machines Corporation}}, 12574 title = {Users Manual for CM-Fortran}, 12575 publisher = {Thinking Machines Corporation}, 12576 year = {1993} 12577} 12578 12579@TechReport{ chang93, 12580 title = {Experiments and Bounds on Block Diagonal Preconditioning}, 12581 author = {Mark Yan-Ming Chang and Martin H. Schultz}, 12582 institution = {Yale Department of Computer Science}, 12583 number = {YALEU/DCS/RR-994}, 12584 month = nov, 12585 year = {1993}, 12586 key = {BDD|diag} 12587} 12588 12589@InProceedings{ gropplevine93, 12590 author = {N. Galbreath and W. Gropp and D. Levine}, 12591 title = {Applications-Driven Parallel {I/O}}, 12592 booktitle = {Proceedings of Supercomputing '93}, 12593 year = {1993}, 12594 pages = {462--471} 12595} 12596 12597@Book{ siegle85, 12598 author = {H. J. Siegel}, 12599 title = {Interconnection Networks for Large Scale Parallel Processing}, 12600 publisher = {Lexington Books}, 12601 year = {1985}, 12602 key = {Network Comparison} 12603} 12604 12605@Article{ lawrie75, 12606 author = {D. H. Lawrie}, 12607 title = {Access and alignment of data in an array processor}, 12608 journal = {IEEE Transactions on Computers}, 12609 volume = {C-24}, 12610 number = {12}, 12611 month = dec, 12612 year = {1975}, 12613 pages = {1145--1155}, 12614 key = {Omega Network} 12615} 12616 12617@Book{ knuth1986, 12618 title = {The {\TeX}{Book}}, 12619 author = {Donald Ervin Knuth and Duane Bibby}, 12620 volume = {1993}, 12621 year = {1986}, 12622 publisher = {Addison-Wesley Reading, Massachusetts} 12623} 12624 12625@Book{ lamport86, 12626 author = {Leslie Lamport}, 12627 title = {{LaTeX}: A document preparation system}, 12628 publisher = {Addison-Wesley}, 12629 year = {1986}, 12630 key = {Latex Manual} 12631} 12632 12633@InProceedings{ gropp-lusk:unix-tools, 12634 author = {William Gropp and Ewing Lusk}, 12635 title = {Scalable {U}nix Tools on Parallel Processors}, 12636 booktitle = {Proceedings of the 1994 Scalable High Performanc Computing Conference}, 12637 publisher = {IEEE}, 12638 pages = {56--62} 12639} 12640 12641@InProceedings{ jp:bell_prize, 12642 author = {Mark Jones and Paul Plassmann}, 12643 title = {Solution of Large, Sparse Systems of Linear Equations in Massively Parallel 12644 Applications}, 12645 booktitle = {Proceedings of Supercomputing '92}, 12646 publisher = {IEEE Computer Society Press}, 12647 year = {1992}, 12648 pages = {551--560} 12649} 12650 12651@COMMENT{WEB, CWEB references (for doctext)} 12652@TechReport{ web, 12653 author = {Donald E. Knuth}, 12654 title = {The {\tt WEB} system of structured documentation}, 12655 institution = {Computer Science Department, Stanford University}, 12656 year = {1983}, 12657 number = {980}, 12658 month = sep 12659} 12660 12661@Article{ literatepgm, 12662 author = {Donald E. Knuth}, 12663 title = {Literate Programming}, 12664 journal = {Computer Journal}, 12665 year = {1984}, 12666 volume = {27}, 12667 number = {2}, 12668 pages = {91--111} 12669} 12670 12671@Unpublished{ cweb-code, 12672 author = {Silvio Levy and Donald E. Knuth}, 12673 title = {CWEB}, 12674 note = {CWEB is available at ftp://pip.shsu.edu/tex-archive/web/c\_cpp/cweb} 12675} 12676 12677@Article{ jp:scalable, 12678 author = {Mark Jones and Paul Plassmann}, 12679 title = {Scalable Iterative Solution of Sparse Linear Systems}, 12680 journal = {Parallel Computing}, 12681 volume = {20}, 12682 number = {5}, 12683 month = may, 12684 year = {1994}, 12685 pages = {753--773} 12686} 12687 12688@Article{ jp:pcolor, 12689 author = {Mark T. Jones and Paul E. Plassmann}, 12690 title = {A Parallel Graph Coloring Heuristic}, 12691 journal = {SIAM J. Sci. Comput.}, 12692 volume = {14}, 12693 number = {3}, 12694 pages = {654-669}, 12695 year = {1993} 12696} 12697 12698@TechReport{ block_solve, 12699 author = {Mark T. Jones and Paul E. Plassmann}, 12700 title = {{B}lock{S}olve v1.1: Scalable Library Software for the Parallel Solution of 12701 Sparse Linear Systems}, 12702 institution = {Argonne National Laboratory}, 12703 year = {1992}, 12704 number = {ANL-92/46}, 12705 key = {JonesPlassmann92 ! block_solve} 12706} 12707 12708@InProceedings{ supercond, 12709 author = {Lois Curfman Mc{I}nnes and Mario Palumbo}, 12710 title = {Parallel Solution of the Anisotropic {G}inzburg-{L}andau Model}, 12711 booktitle = {Proceedings of the Toward Teraflop Computing and New Grand Challenge Applications 12712 Conference}, 12713 month = feb, 12714 year = {1994}, 12715 key = {McInnesPalumbo94 ! superconductivity } 12716} 12717 12718@Unpublished{ preosti:93, 12719 author = {Gianfranco Preosti}, 12720 title = { }, 12721 note = {Unpublished information, {P}hysics {D}epartment, {P}urdue {U}niversity}, 12722 year = {1993}, 12723 key = {preosti93 ! GL-tilt3d} 12724} 12725 12726@Unpublished{ more:93, 12727 author = {Jorge J. Mor\'{e}}, 12728 title = { }, 12729 note = {Unpublished information, {M}athematics and {C}omputer {S}cience {D}ivision, 12730 {A}rgonne {N}ational {L}aboratory}, 12731 year = {1993}, 12732 key = {more93 ! MINPACK-2} 12733} 12734 12735@Article{ brownsaad:90, 12736 author = {Peter N. Brown and Youcef Saad}, 12737 title = {Hybrid {K}rylov Methods for Nonlinear Systems of Equations}, 12738 journal = {SIAM J. Sci. Stat. Comput.}, 12739 year = {1990}, 12740 volume = {11}, 12741 pages = {450-481} 12742} 12743 12744@Book{ using-mpi, 12745 author = {William Gropp and Ewing Lusk and Anthony Skjellum}, 12746 title = {Using MPI: Portable Parallel Programming with the Message Passing Interface}, 12747 publisher = {MIT Press}, 12748 year = {1994} 12749} 12750 12751@Book{ using-mpi2, 12752 author = {William Gropp and Ewing Lusk and Rajeev Thakur}, 12753 title = {Using MPI 2: Advanced Features of the Message Passing Interface}, 12754 publisher = {MIT Press}, 12755 year = {1999} 12756} 12757 12758@Article{ hs:52, 12759 author = {Magnus R. Hestenes and Eduard Steifel}, 12760 title = {Methods of Conjugate Gradients for Solving Linear Systems}, 12761 journal = {J. Research of the National Bureau of Standards}, 12762 year = {1952}, 12763 volume = {49}, 12764 pages = {409-436} 12765} 12766 12767@Article{ ss:86, 12768 author = {Youcef Saad and Martin H. Schultz}, 12769 title = {{GMRES}: A Generalized Minimal Residual Algorithm for Solving Nonsymmetric Linear 12770 Systems}, 12771 journal = {SIAM J. Sci. Stat. Comput.}, 12772 year = {1986}, 12773 volume = {7}, 12774 pages = {856-869} 12775} 12776 12777@Article{ so:89, 12778 author = {Peter Sonneveld}, 12779 title = {{CGS}, A Fast {L}anczos-type Solver for Nonsymmetric Linear Systems}, 12780 journal = {SIAM J. Sci. Stat. Comput.}, 12781 year = {1989}, 12782 volume = {10}, 12783 pages = {36-52} 12784} 12785 12786@Article{ v:92, 12787 author = {{H. A.} {van der Vorst}}, 12788 title = {{B}i{CGSTAB}: A fast and smoothly converging variant of {B}i{CG} for the solution 12789 of nonsymmetric linear systems}, 12790 journal = {SIAM J. Sci. Stat. Comput.}, 12791 volume = {13}, 12792 year = {1992}, 12793 pages = {631-644} 12794} 12795 12796@Article{ f:93, 12797 author = {Roland W. Freund}, 12798 title = {A Transpose-Free Quasi-Minimal Residual Algorithm for Non-{H}ermitian Linear 12799 Systems}, 12800 journal = {SIAM J. Sci. Stat. Comput.}, 12801 volume = {14}, 12802 year = {1993}, 12803 pages = {470-482} 12804} 12805 12806@Article{ ish:89, 12807 author = {S. Ishizuka}, 12808 title = {An Experimental Study on Extinction and Stablity of Tubular Flames}, 12809 journal = {Combustion and Flame}, 12810 volume = {75}, 12811 year = {1989}, 12812 pages = {367-379} 12813} 12814 12815@Book{ williams89, 12816 title = {Combustion Theory, The Fundamental Theory of Chemically Reacting Flow Systems}, 12817 author = {F.A. Williams}, 12818 publisher = {Addison-Wesley}, 12819 year = {1989}, 12820 pages = {367-379} 12821} 12822 12823@Book{ ra75, 12824 author = {R. Aris}, 12825 title = {The Mathematical Theory of Diffusion and Reaction in Permeable Catalysts}, 12826 publisher = {Oxford}, 12827 year = {1975} 12828} 12829 12830@Book{ bebernes89, 12831 author = {J. Bebernes and D. Eberly}, 12832 title = {Mathematical Problems from Combustion Theory}, 12833 publisher = {Springer-Verlag}, 12834 series = {Applied Mathematical Sciences 83}, 12835 year = {1989} 12836} 12837 12838@InProceedings{ kikuchi89, 12839 author = {F. Kikuchi}, 12840 booktitle = { Computing Methods in Applied Sciences and Engineering}, 12841 editor = {R. Glowinski and J. L. Lions}, 12842 publisher = {Springer-Verlag}, 12843 series = {Lecture Notes in Mathematics}, 12844 title = {Finite element approximations to bifurcation problems of turning point type}, 12845 year = {1977} 12846} 12847 12848@Article{ rg85, 12849 author = {R. Glowinski and H.B. Keller and L. Reinhart}, 12850 title = {Continuation-conjugate Gradient Methods fo the Least Squares Solution of 12851 Nonlinear Boundary Problems}, 12852 journal = {SIAM J. Sci. Stat. Comput.}, 12853 volume = {6}, 12854 year = {1985}, 12855 pages = {793-832} 12856} 12857 12858@InProceedings{ whitfield91, 12859 author = {D. Whitfield and L. Taylor}, 12860 title = {Discretized {N}ewton-Relaxation Solution of High Resolution Flux-Difference Split 12861 Schemes}, 12862 booktitle = {Proceedings of the AIAA Tenth Computational Fluid Dynamics Conference}, 12863 misc = {AIAA-91-1539}, 12864 pages = {134-145}, 12865 year = {1991} 12866} 12867 12868@InProceedings{ quinlan1, 12869 author = {M. Lemke and D. Quinlan}, 12870 title = {P++, a {C}++ Virtual Shared Grids Based Programming Environment for 12871 Architecture-Independent Development of Structured Grid Applications}, 12872 booktitle = {CONPAR/VAPP V, Lecture Notes in Computer Science}, 12873 publisher = {Springer Verlag}, 12874 year = {1992} 12875} 12876 12877@InProceedings{ quinlan2, 12878 author = {R. Parsons and D. Quinlan}, 12879 title = {A++/{P}++ Array Classes for Architecture Independent Finite Difference 12880 Computations}, 12881 booktitle = {Proceedings of the Second Annual Object-Oriented Numerics Conference}, 12882 year = {1994} 12883} 12884 12885% ***** Overview of functionality in Diffpack 12886@InBook{ dpoverview, 12887 author = {Bruaset, A. M. and Langtangen, H. P.}, 12888 booktitle = {Mathematical Models and Software Tools in Industrial Mathematics}, 12889 title = {A Comprehensive Set of Tools for Solving Partial Differential Equations; 12890 {Diffpack}}, 12891 publisher = {Birkh{\"{a}}user}, 12892 pages = {61--90}, 12893 year = {1997} 12894} 12895 12896% ***** Short overview of Diffpack 12897@InCollection{ dpoverview2, 12898 author = {Bruaset, A. M. and Langtangen, H. P.}, 12899 editor = {A. Sydow}, 12900 booktitle = {Proceedings of the 15th IMACS World Congress on Scientific Computation, Modelling 12901 and Applied Mathematics}, 12902 title = {Diffpack: A Software Environment for Rapid Prototyping of {PDE} Solvers}, 12903 pages = {553--558}, 12904 volume = {4}, 12905 year = {1997} 12906} 12907 12908% ***** Comprehensive documentation of Diffpack and 12909% associated numerical methods: 12910@Book{ dpbook, 12911 author = {H. P. Langtangen}, 12912 title = {Numerical Solution of Partial Differential Equations; Models, Algorithms and 12913 Software. Part I}, 12914 series = {Lecture Notes in Computational Science and Engineering}, 12915 publisher = {Springer-Verlag}, 12916 year = {1998} 12917} 12918 12919% ***** Design issues of the linear solvers in Diffpack, serves also as a 12920% collection of examples on O-O in numerical computing 12921@Article{ ambhpl97a, 12922 author = {A. M. Bruaset and H. P. Langtangen }, 12923 title = {Object-Oriented Design of Preconditioned Iterative Methods in {Diffpack}}, 12924 journal = {Transactions on Mathematical Software}, 12925 volume = {23 }, 12926 pages = {50--80}, 12927 year = {1997} 12928} 12929 12930@Misc{ dpurl, 12931 author = {{Diffpack Web page}}, 12932 howpublished = {\url{http://www.diffpack.com}} 12933} 12934 12935% ***** General intro to object-oriented numerics for "FORTRAN programmers" 12936@InCollection{ oonintro, 12937 author = {Arge, E. and Bruaset, A. M. and H. P. Langtangen}, 12938 editor = {D{\ae}hlen, M. and Tveito, A.}, 12939 booktitle = {Mathematical Models and Software Tools in Industrial Mathematics}, 12940 title = {Object-Oriented Numerics}, 12941 publisher = {Birkh{\"{a}}user}, 12942 year = {1997} 12943} 12944 12945% ***** Efficiency comparison: BLAS 1, Diffpack, C, 12946% and finite element applications (F77 vs Diffpack) 12947@InCollection{ dpefficiency, 12948 author = {Arge, E. and Bruaset, A. M. and Calvin, P. B. and Kanney, J. F. and Langtangen, 12949 H. P. and Miller, C. T.}, 12950 editor = {D{\ae}hlen, M. and Tveito, A.}, 12951 booktitle = {Mathematical Models and Software Tools in Industrial Mathematics}, 12952 title = {On the Efficiency of {C++} in Scientific Computing}, 12953 publisher = {Birkh{\"{a}}user}, 12954 pages = {91--118}, 12955 year = {1997} 12956} 12957 12958% ***** Parallel concept in Diffpack: 12959@InCollection{ dpparallel, 12960 author = {A.~M.~Bruaset and X. Cai and H. P. Langtangen and A. Tveito}, 12961 editor = {Y. Ishikawa and R. R. Oldehoeft and J. V. W. Reynders and M. Tholburn}, 12962 booktitle = {Scientific Computing in Object-Oriented Parallel Environments}, 12963 title = {Numerical Solution of {PDE}s on Parallel Computers Utilizing Sequential 12964 Simulators}, 12965 publisher = {Springer--Verlag}, 12966 series = {Lecture Notes in Computer Science}, 12967 pages = {161--168}, 12968 year = {1997} 12969} 12970 12971% ***** DD and ML methods in Diffpack: 12972@InCollection{ dpddml, 12973 author = {A.~M.~Bruaset and H. P. Langtangen and G. W. Zumbusch}, 12974 editor = {P. Bj{\o}rstad and M. Espedal and D. Keyes}, 12975 booktitle = {Proceedings of the 9th Conference on Domain Decomposition}, 12976 title = {Domain decomposition and multilevel methods in Diffpack}, 12977 year = {1997} 12978} 12979 12980@InProceedings{ bsca98, 12981 author = {David L. Bruhwiler and Svetlana G. Shasharina and John R. Cary and David 12982 Alexander}, 12983 title = {Design and Implementation of an Object Oriented C++ Library for Nonlinear 12984 Optimization}, 12985 booktitle = {Proceedings of the SIAM Workshop on Object Oriented Methods for Inter-operable 12986 Scientific and Engineering Computing}, 12987 editor = {Mike Henderson et al.}, 12988 pages = {165-173}, 12989 year = {1998} 12990} 12991 12992@Book{ scalapack-user-guide, 12993 author = {L. S. Blackford and J. Choi and A. Cleary and E. D'Azevedo and J. Demmel and I. 12994 Dhillon and J. Dongarra and S. Hammarling and G. Henry and A. Petitet and K. 12995 Stanley and D. Walker and R. C. Whaley}, 12996 title = {Sca{LAPACK} Users' Guide}, 12997 publisher = {SIAM}, 12998 address = {Philadelphia, PA}, 12999 year = {1997} 13000} 13001 13002@InProceedings{ keyes99, 13003 author = {D. E. Keyes}, 13004 title = {How Scalable is Domain Decomposition in Practice?}, 13005 booktitle = {Proceedings of the 11th International Conference on Domain Decomposition 13006 Methods}, 13007 editor = {C.-H. Lai et al.}, 13008 publisher = {Domain Decomposition Press, Bergen}, 13009 note = {To appear}, 13010 year = {1999} 13011} 13012 13013@Article{ fun3d, 13014 author = {W. K. Anderson and D. L. Bonhaus}, 13015 title = {An implicit upwind algorithm for computing turbulent flows on unstructured 13016 grids}, 13017 journal = {Computers and Fluids}, 13018 year = {1994}, 13019 volume = {23}, 13020 pages = {1--21} 13021} 13022 13023% ------------------------------------------------------------------------- 13024% ------------------------------------------------------------------------- 13025@Article{ torczon, 13026 author = {Dennis, Jr., J. E. and V.~Torczon}, 13027 title = {Direct Search Methods on Parallel Machines}, 13028 journal = {SIAM J. Optimization}, 13029 volume = {1}, 13030 pages = {448--474}, 13031 year = {1991}, 13032 key = {Torczon !PDS} 13033} 13034 13035@InProceedings{ wt91, 13036 author = {D. L. Whitfield and L. K. Taylor}, 13037 title = {Discretized {N}ewton-Relaxation Solution of High Resolution Flux-Difference Split 13038 Schemes}, 13039 booktitle = {Proceedings of the AIAA Tenth Annual Computational Fluid Dynamics Conference}, 13040 misc = {AIAA-91-1539}, 13041 pages = {134-145}, 13042 year = {1991} 13043} 13044 13045@Article{ ew96, 13046 author = {S. C. Eisenstat and H. F. Walker}, 13047 title = {Choosing the forcing terms in an inexact {N}ewton method}, 13048 journal = {SIAM J. Scientific Computing}, 13049 volume = {17}, 13050 year = {1996}, 13051 pages = {16--32} 13052} 13053 13054@Book{ thi93, 13055 author = {{Thinking Machines Corporation}}, 13056 title = {Users Manual for CM-Fortran}, 13057 publisher = {Thinking Machines Corporation}, 13058 year = {1993} 13059} 13060 13061@Book{ mortonmayers94, 13062 author = {K. W. Morton and D. F. Mayers}, 13063 title = {Numerical Solution of Partial Differential Equations}, 13064 publisher = {Press Syndicate of the University of Cambridge}, 13065 year = {1994} 13066} 13067 13068@Book{ heath97, 13069 author = {Michael T. Heath}, 13070 title = {Scientific Computing: An Introductory Survey}, 13071 publisher = {McGraw Hill}, 13072 year = {1997} 13073} 13074 13075@Article{ captools96, 13076 author = {C. S. Ierotheou and S. P Johnson and M. Cross and P. F. Leggett}, 13077 title = {Computer Aided Parallelization Tools ({CAPTools}) - Conceptual Overview and 13078 Performance on the Parallelization of Structured Mesh Codes}, 13079 journal = {Parallel Computing}, 13080 volume = {22}, 13081 pages = {197-226}, 13082 year = {1996} 13083} 13084 13085@Unpublished{ nastran-web-page, 13086 author = {{MSC Software Corporation}}, 13087 title = {{NASTRAN} {W}eb page}, 13088 note = {See {\tt http://www.mechsolutions.com\-/products\-/nastran/}} 13089} 13090 13091@Book{ hpf, 13092 author = {C. H. Koelbel and D. B. Loveman and R. S. Schreiber and G. L. Steele and M. E. 13093 Zosel}, 13094 title = {The High Performance Fotran Handbook}, 13095 publisher = {MIT Press}, 13096 year = {1994} 13097} 13098 13099@InProceedings{ keyes98, 13100 author = {D. E. Keyes}, 13101 title = {Trends in Algorithms for Nonuniform Applications on Hierarchical Distributed 13102 Architectures}, 13103 booktitle = {Proceedings of the Workshop on Computational Aerosciences for the 21st Century}, 13104 editors = {M. D. Salas and W. K. Anderson}, 13105 ppublisher = {Elsevier}, 13106 year = {1998} 13107} 13108 13109@InProceedings{ pooma-atlas, 13110 author = {S. Atlas and S. Banerjee and J. C. Cummings and P. J. Hinker and M. Srikant and 13111 J. V. W. Reynders and M. Tholburn}, 13112 title = {{POOMA}: A High-Performance Distributed Simulation Environment for Scientific 13113 Applications}, 13114 year = {1995}, 13115 month = dec, 13116 booktitle = {Supercomputing '95 Proceedings} 13117} 13118 13119% --------------------------------------------------------------------------------- 13120% New bib entries for CRPC paper 13121@Misc{ mgnet-web-page, 13122 author = {Craig C. Douglas}, 13123 title = {{MGNet Web page}}, 13124 note = {See {\tt http://\-www.mgnet.org}} 13125} 13126 13127@Misc{ dagh-web-page, 13128 author = {M. Parashar and J. C. Browne}, 13129 title = {{DAGH Web page}}, 13130 note = {\url{http://www.caip.rutgers.edu/~parashar/DAGH}} 13131} 13132 13133@Misc{ parasol-web-page, 13134 key = {PARASOL}, 13135 title = {{PARASOL Web page}}, 13136 note = {See {\tt http://\-www.genias.de/\-projects/\-parasol}} 13137} 13138 13139@Misc{ pooma-web-page, 13140 author = {{POOMA Web page}}, 13141 note = {See {\tt http://\-www.acl.lanl.gov/pooma}} 13142} 13143 13144@Misc{ mudpack-web-page, 13145 author = {John C. Adams}, 13146 title = {{MUDPACK Web page}}, 13147 note = {See {\tt http://\-www.scd.ucar.edu/\-css/\-software/\-mudpack}} 13148} 13149 13150@Misc{ pellpack-web-page, 13151 author = {Elias Houstis and John Rice and Apostolos Hadjidimos}, 13152 title = {{Parallel ELLPACK Web page}}, 13153 note = {See {\tt http://\-www.cs.purdue.edu/\-research/\-cse/\-pellpack/}} 13154} 13155 13156@InProceedings{ pellpack95, 13157 author = {E. N. Houstis and S. B. Kim and S. Markus and P. Wu and N. E. Houstis and A.C. 13158 Catlin and S. Weerawarana and T.S. Papatheodorou}, 13159 title = {Parallel {ELLPACK} Elliptic {PDE} Solvers}, 13160 booktitle = {Proceedings of INTEL Supercomputer User's Group Conference}, 13161 address = {Albuquerque, NM}, 13162 year = {1995} 13163} 13164 13165@Misc{ nhse-web-page, 13166 author = {{National High-Performance Software Exchange Web page}}, 13167 note = {See {\tt http://\-www.nhse.org}} 13168} 13169 13170@Misc{ doug-web-page, 13171 author = {Mark J. Hagger and Linda Stals}, 13172 title = {{DOUG Web Page}}, 13173 note = {See {\tt http://\-www.maths.bath.ac.uk/\~{ }parsoft/\-doug/}} 13174} 13175 13176@TechReport{ doug97, 13177 author = {Mark J. Hagger}, 13178 title = {Automatic Domain Decomposition on Unstructured Grids {(DOUG)}}, 13179 institution = {Mathematical Sciences, University of Bath}, 13180 year = {1997}, 13181 number = {9706}, 13182 note = {Advances in Computational Mathematics (to appear)} 13183} 13184 13185@Misc{ ug-web-page, 13186 author = {{UG Web Page}}, 13187 note = {See {\tt http://\-cox.iwr.uni-heidelberg.de/\~{ }ug/}} 13188} 13189 13190@Article{ ug97, 13191 author = {P. Bastian and K. Birken and K. Johannsen and S. Lang and N. Neuss and H. 13192 Rentz-Reichert and C. Wieners}, 13193 title = {{UG} -- A Flexible Software Toolbox for Solving Partial Differential Equations}, 13194 journal = {Computing and Visualization in Science}, 13195 year = {1997}, 13196 volume = {}, 13197 pages = {} 13198} 13199 13200@Misc{ vecfem-web-page, 13201 author = {Lutz Grosz}, 13202 title = {{VECFEM Web Page}}, 13203 note = {See {\tt http://\-wwwmaths.anu.edu.au/\-\~{ }vecfem/}} 13204} 13205 13206@Misc{ atlas-web-page, 13207 author = {R. Clint {Whaley et al.}}, 13208 title = {{ATLAS Web Page}}, 13209 howpublished = {\url{http://math-atlas.sourceforge.net}} 13210} 13211 13212@Misc{ fenics-web-page, 13213 author = {Todd Dupont and Johan Hoffman and Johan Jansson and Claes Johnson and Robert C. 13214 Kirby and Matthew Knepley and Mats Larson and Anders Logg and Ridgway Scott}, 13215 title = {{FEniCS Web Page}}, 13216 note = {\url{http://www.fenicsproject.org}}, 13217 year = {2005} 13218} 13219 13220@Misc{ matlab-web-page, 13221 author = {{The} {MathWorks}}, 13222 title = {{Matlab} {Web} page}, 13223 url = {http://www.mathworks.com} 13224} 13225 13226@Misc{ phipac-web-page, 13227 author = {J. A. Bilmes and K. Asanovic and R. Vudoc and S. Iyer and J. Demmel and C. Chin 13228 and D. Lam}, 13229 title = {{PHiPAC Web Page}}, 13230 note = {See {\tt http://\-www.icsi.berkeley.edu/\-\~{ }bilmes/\-phipac/}} 13231} 13232 13233@InProceedings{ kelp, 13234 author = {Stephan J. Fink and Scott B. Baden and Scott R. Kohn}, 13235 title = {Flexible Communication Mechanisms for Dynamic Structured Applications}, 13236 booktitle = {Irregular '96}, 13237 year = {1996} 13238} 13239 13240@Unpublished{ kelp-web-page, 13241 author = {Scott Baden}, 13242 title = {{KeLP} {W}eb page}, 13243 note = {See {\tt http://\-www-cse.ucsd.edu/\-groups/\-hpcl/\-scg/\-kelp/}} 13244} 13245 13246@InProceedings{ hk99, 13247 author = {R. Hornung and S. Kohn}, 13248 title = {The Use of Object-Oriented Design Patterns in the {SAMRAI} Structured {AMR} 13249 Framework}, 13250 booktitle = {Proceedings of the SIAM Workshop on Object-Oriented Methods for Inter-Operable 13251 Scientific and Engineering Computing}, 13252 pages = {235-244}, 13253 year = {1999}, 13254 note = {See \url{http://www.llnl.gov/CASC/samrai}} 13255} 13256 13257@Unpublished{ samrai-web-page, 13258 title = {{SAMRAI} {W}eb Page}, 13259 author = {Scott Kohn and Xabier Garaiza and Rich Hornung and Steve Smith}, 13260 note = {See {\tt http://www.llnl.gov/\-CASC/SAMRAI}} 13261} 13262 13263@Misc{ overture-web-page, 13264 author = {William Henshaw and Kyle Chand}, 13265 title = {{Overture} {W}eb page}, 13266 howpublished = {\url{http://www.llnl.gov/CASC/Overture}} 13267} 13268 13269@InProceedings{ overture99, 13270 author = {D.L. Brown and W.D. Henshaw and D.J. Quinlan}, 13271 title = {Overture: An Object-Oriented Framework for Solving Partial Differential Equations 13272 on Overlapping Grids}, 13273 publisher = {SIAM}, 13274 booktitle = {Proceedings of the SIAM Workshop on Object Oriented Methods for Inter-operable 13275 Scientific and Engineering Computing}, 13276 year = {1999}, 13277 pages = {215-224}, 13278 note = {See \url{http://www.llnl.gov/CASC/Overture}} 13279} 13280 13281@InProceedings{ diffpack, 13282 author = {A.M. Bruaset and H.P. Langtangen}, 13283 title = {A Comprehensive Set of Tools for Solving Partial Differential Equations: 13284 {D}iffpack}, 13285 booktitle = {Numerical Methods and Software Tools in Industrial Mathematics}, 13286 year = {1997}, 13287 pages = {61--90}, 13288 publisher = {Birkhauser Press} 13289} 13290 13291@Article{ dongarra:1984:ila, 13292 author = {J. J. Dongarra and F. G. Gustavson and A. Karp}, 13293 title = {Implementing Linear Algebra Algorithms for Dense Matrices on a Vector Pipeline 13294 Machine}, 13295 journal = {SIAM Review}, 13296 volume = {26}, 13297 number = {1}, 13298 pages = {91--112}, 13299 month = jan, 13300 year = {1984}, 13301 coden = {SIREAD}, 13302 issn = {0036-1445 (print), 1095-7200 (electronic)}, 13303 mrclass = {65F10 (65F30)}, 13304 mrnumber = {85c:65032}, 13305 bibdate = {Mon Jan 20 1997}, 13306 abstract = {The authors examine common implementations of linear algebra algorithms, such as 13307 matrix-vector multiplication, matrix-matrix multiplication and the solution of 13308 linear equations. The different versions are examined for efficiency on a computer 13309 architecture which uses vector processing and has pipelined instruction execution. 13310 By using the advanced architectural features of such machines, one can usually 13311 achieve maximum performance, and tremendous improvements in terms of execution 13312 speed can be seen over conventional computers.}, 13313 classification= {723; 921}, 13314 journalabr = {SIAM Rev}, 13315 keywords = {computer programming --- Algorithms; dense matrices; linear algebra algorithms; 13316 mathematical programming; vector pipeline machine} 13317} 13318 13319@Book{ qv99, 13320 author = {Alfio Quarteroni and Alberto Valli}, 13321 title = {Domain Decomposition Methods for Partial Differential Equations}, 13322 publisher = {Oxford Science Publications}, 13323 address = {Oxford}, 13324 year = {1999} 13325} 13326 13327@Book{ ksv97, 13328 editor = {David E. Keyes and Ahmed Sameh and V. Venkatakrishnan}, 13329 title = {Parallel Numerical Algorithms}, 13330 publisher = {Kluwer Academic Publishers}, 13331 address = {the Netherlands}, 13332 year = {1997} 13333} 13334 13335@Book{ hackbusch94, 13336 author = {Wolfgang Hackbusch}, 13337 title = {Iterative Solution of Large Sparse Systems of Equations}, 13338 publisher = {Springer-Verlag}, 13339 address = {New York}, 13340 year = {1994} 13341} 13342 13343@Article{ hackbusch1980fast, 13344 title = {Fast solution of elliptic control problems}, 13345 author = {Hackbusch, W.}, 13346 journal = {Journal of Optimization Theory and Applications}, 13347 volume = {31}, 13348 number = {4}, 13349 pages = {565--581}, 13350 year = {1980}, 13351 publisher = {Springer} 13352} 13353 13354@Book{ hackbusch1985multi, 13355 title = {{Multi-grid methods and applications}}, 13356 author = {Hackbusch, W.}, 13357 isbn = {3540127615}, 13358 issn = {0179-3632}, 13359 year = {1985}, 13360 publisher = {Springer Verlag} 13361} 13362 13363@Book{ axelsson94, 13364 author = {Owe Axelsson}, 13365 title = {Iterative Solution Methods}, 13366 publisher = {Cambridge University Press}, 13367 address = {Cambridge}, 13368 year = {1994} 13369} 13370 13371@Book{ saad96, 13372 author = {Yousef Saad}, 13373 title = {Iterative Methods for Sparse Linear Systems}, 13374 publisher = {PWS Publishing Company}, 13375 address = {Boston}, 13376 year = {1996} 13377} 13378 13379@Book{ saad2003, 13380 title = {Iterative Methods for Sparse Linear Systems}, 13381 author = {Saad, Yousef}, 13382 doi = {10.1016/S1570-579X(01)80025-2}, 13383 edition = {2nd}, 13384 publisher = {SIAM}, 13385 year = {2003} 13386} 13387 13388@Book{ vandervorst03, 13389 author = {Henk A. {van der Vorst}}, 13390 title = {Iterative Krylov Methods for Large Linear Systems}, 13391 publisher = {Cambridge Monographs on Applied ahd Computational Mathematics}, 13392 year = {2003} 13393} 13394 13395@Book{ koniges00, 13396 editor = {Alice E. Koniges}, 13397 title = {Industrial Strength Parallel Computing}, 13398 publisher = {Morgan Kaufmann Publishers}, 13399 address = {San Francisco}, 13400 year = {2000} 13401} 13402 13403@Misc{ fftw-web-page, 13404 key = {Fftw}, 13405 title = {{FFTW} {Web} page}, 13406 note = {\texttt{http://www.fftw.org/}}, 13407 annote = {fast FFT. Parallel versions with MPI and Cilk} 13408} 13409 13410@InProceedings{ frigojohnson93, 13411 author = {Matteo Frigo and Steven G. Johnson}, 13412 title = {The Design and Implementation of {FFTW3}}, 13413 booktitle = {Proceedings of the IEEE}, 13414 volume = {93}, 13415 number = {2}, 13416 pages = {216--231}, 13417 year = {2005} 13418} 13419 13420@Book{ kelley95, 13421 author = {C. T. Kelley}, 13422 title = {Iterative Methods for Linear and Nonlinear Equations}, 13423 year = {1995}, 13424 publisher = {SIAM}, 13425 address = {Philadelphia} 13426} 13427 13428@Unpublished{ spai-web-page, 13429 title = {{SPAI} {W}eb {P}age}, 13430 note = {http://www.sam.math.ethz.ch/\~{ }grote/spai/}, 13431 author = {Steven Bernard and Marcus Grote}, 13432 institution = {NASA Ames Research Center and ETH Zurich} 13433} 13434 13435@Article{ gh97, 13436 author = {M. J. Grote and T. Huckle}, 13437 title = {Parallel Preconditioning with Sparse Approximate Inverses}, 13438 year = {1997}, 13439 journal = {SIAM J. of Scient. Comput.}, 13440 volume = {18}, 13441 pages = {838-853} 13442} 13443 13444@Article{ zhang96, 13445 author = {Wen Zhang}, 13446 title = {Using {MOL} to Solve a high order nonlinear {PDE} with a moving boundary in the 13447 simulation of a sintering process}, 13448 year = {1996}, 13449 journal = {Appl. Numer. Math.}, 13450 volume = {20}, 13451 pages = {235-244} 13452} 13453 13454@Article{ zhang98, 13455 author = {Wen Zhang and Ian Gladwell}, 13456 title = {The sintering of two particles by surface and grain boundary diffusion - a 13457 three-dimensional numerical study}, 13458 journal = {Comp. Mater. Sci.}, 13459 year = {1998}, 13460 volume = {12} 13461} 13462 13463@InProceedings{ mollerschwartzbach01, 13464 author = {Anders M\o{}ller and Michael I. Schwartzbach}, 13465 title = {The Pointer Assertion Logic Engine}, 13466 booktitle = {ACM Proceedings of PLDI'01}, 13467 year = {2001} 13468} 13469 13470@InProceedings{ klarlandschwartzbach97, 13471 author = {Nils Klarland and Michael I. Schwartzbach}, 13472 title = {A Domain-Specific Languages for Regular Sets of Strings and Trees}, 13473 booktitle = {Proceedings of the Conference on Domain-Specific Languages}, 13474 publisher = {USENIX}, 13475 month = oct, 13476 year = {1997}, 13477 address = {Santa Barbara, CA} 13478} 13479 13480@InProceedings{ conselmarlet98, 13481 author = {C. Consel and R. Marlet}, 13482 title = {Architecturing software using a methodology for language development}, 13483 booktitle = {Proceedings of the 10th International Symposium on Programming Languages, 13484 Implementations, Logics and Programs}, 13485 year = {1998}, 13486 pages = {170-174}, 13487 month = sep, 13488 address = {Pisa, Italy} 13489} 13490 13491@Misc{ sundials:homepage, 13492 author = {C. {Woodward et al.}}, 13493 title = {{SUNDIALS {W}eb page}}, 13494 howpublished = {\url{https://computation.llnl.gov/casc/sundials/main.html}} 13495} 13496 13497@article{gardner2022sundials, 13498 title = {Enabling new flexibility in the {SUNDIALS} suite of nonlinear and differential/algebraic equation solvers}, 13499 author = {Gardner, David J and Reynolds, Daniel R and Woodward, Carol S and Balos, Cody J}, 13500 journal = {ACM Transactions on Mathematical Software (TOMS)}, 13501 publisher = {ACM}, 13502 year = {2022}, 13503 doi = {10.1145/3539801} 13504} 13505 13506@Misc{ sundials-user-ref, 13507 title = {{SUNDIALS}: Suite of Nonlinear and Differential/Algebraic Equation Solvers}, 13508 note = {See \url{http://www.llnl.gov/CASC/sundials}}, 13509 author = {Allan Hindmarsh and Peter Brown and Keith Grant and Steven Lee and Radu Serban 13510 and Dan Shumaker and Carol Woodward}, 13511 institution = {Center for Applied Scientific Computing, Lawrence Livermore National Laboratory}, 13512 number = {UCRL-JP-200037}, 13513 year = {2003} 13514} 13515 13516@Article{ sundials05, 13517 author = {A. Hindmarsh and P. Brown and K. Grant and S. Lee and R. Serban and D. Shumaker 13518 and C. Woodward}, 13519 title = {{SUNDIALS:} Suite of Nonlinear and Differential/Algebraic Equation Solvers}, 13520 journal = {ACM Transactions on Mathematical Software}, 13521 volume = {31}, 13522 number = {3}, 13523 pages = {363--396}, 13524 year = {2005} 13525} 13526 13527@InProceedings{ serban2005cvodes, 13528 title = {{CVODES}, the sensitivity-enabled {ODE} solver in {SUNDIALS}}, 13529 author = {Serban, Radu and Hindmarsh, Alan C}, 13530 booktitle = {Proceedings of the 5th International Conference on Multibody Systems, Nonlinear 13531 Dynamics and Control, Long Beach, CA}, 13532 year = {2005} 13533} 13534 13535@Article{ pvode99, 13536 author = {G. Byrne and A. Hindmarsh}, 13537 title = {{PVODE}, An {ODE} Solver for Parallel Computers}, 13538 journal = {Int. J. High Perf. Comput. Apps.}, 13539 volume = {13}, 13540 number = {4}, 13541 year = {1999}, 13542 pages = {354 -- 365} 13543} 13544 13545@Article{ cvode95, 13546 author = {S. Cohen and A. Hindmarsh}, 13547 title = {{CVODE}, A Stiff/Nonstiff {ODE} Solver in {C}}, 13548 journal = {Computers in Physics}, 13549 volume = {10}, 13550 number = {2}, 13551 year = {1996}, 13552 pages = {138 -- 143} 13553} 13554 13555@TechReport{ ifpack, 13556 title = {Robust Algebraic Preconditioners using {IFPACK} 3.0}, 13557 author = {Marzio Sala and Michael Heroux}, 13558 institution = {Sandia National Laboratories}, 13559 number = {SAND2005-0662}, 13560 year = {2005} 13561} 13562 13563@TechReport{ kinsol-user-ref, 13564 title = {User Documentation for {KINSOL}, A Nonlinear Solver for Sequential and Parallel 13565 Computers}, 13566 author = {Allan Taylor and Alan Hindmarsh}, 13567 institution = {Center for Applied Scientific Computing, Lawrence Livermore National Laboratory}, 13568 number = {UCRL-ID-131185}, 13569 year = {1998} 13570} 13571 13572@Article{ fiardmanteuffelmccormick98, 13573 author = {J.-M. Fiard and T. Manteuffel and S. McCormick}, 13574 title = {First-order system least squares {(FOSLS)} for convection-diffusion problems: 13575 numerical results}, 13576 journal = {SIAM J. Sci. Comp.}, 13577 year = {1998}, 13578 volume = {19}, 13579 pages = {1958--1979} 13580} 13581 13582@InProceedings{ vuduc02, 13583 author = {Richard Vuduc and James W. Demmel and Katherine A. Yelick and Shoaib Kamil and 13584 Rajesh Nishtala and Benjamin Lee}, 13585 title = {Performance Optimizations and Bounds for Sparse Matrix-Vector Multiply}, 13586 booktitle = {Proceedings of Supercomputing}, 13587 year = {2002}, 13588 month = nov, 13589 address = {Baltimore} 13590} 13591 13592@Article{ beckerbraackrannacher1999, 13593 title = {Numerical simulation of laminar flames at low Mach number by adaptive finite 13594 elements}, 13595 author = {Roland Becker and Malte Braack and Rolf Rannacher}, 13596 journal = {Combustion Theory and Modelling}, 13597 volume = {3}, 13598 pages = {503--534}, 13599 year = {1999} 13600} 13601 13602@Article{ beckerrannacher01, 13603 author = {R. Becker and R. Rannacher}, 13604 title = {An optimal control approach to a posteriori error estimation in finite element 13605 methods}, 13606 journal = {Acta Numerica}, 13607 year = {2001}, 13608 volume = {10}, 13609 pages = {1--102} 13610} 13611 13612@Article{ babuskamiller84a, 13613 author = {I. Babu$\check{s}$ka and A.D. Miller}, 13614 title = {The post-processing approach in the finite element method, {I}: Calculations of 13615 displacements, stresses, and other higher derivatives of the displacements}, 13616 journal = {Int. J. Numer. Meth. Eng.}, 13617 year = {1984}, 13618 volume = {20}, 13619 pages = {1085--1109} 13620} 13621 13622@Article{ babuskamiller84b, 13623 author = {I. Babu$\check{s}$ka and A.D. Miller}, 13624 title = {The post-processing approach in the finite element method, {II}: The calculation 13625 of stress intensity factors}, 13626 journal = {Int. J. Numer. Meth. Eng.}, 13627 year = {1984}, 13628 volume = {20}, 13629 pages = {1111--1129} 13630} 13631 13632@Article{ babuskamiller84c, 13633 author = {I. Babu$\check{s}$ka and A.D. Miller}, 13634 title = {The post-processing approach in the finite element method, {III}: A posteriori 13635 error estimation and adaptive mesh refinement}, 13636 journal = {Int. J. Numer. Meth. Eng.}, 13637 year = {1984}, 13638 volume = {20}, 13639 pages = {2311--2324} 13640} 13641 13642@Unpublished{ jtb-web-page, 13643 title = {{The Java Tree Builder}}, 13644 note = {See \url{http://www.cs.purdue.edu/jtb}}, 13645 author = {Jens Palsberg}, 13646 institution = {Purdue University} 13647} 13648 13649@Unpublished{ palsberg98, 13650 title = {Why Visitors?}, 13651 note = {See \url{http://www.cs.purdue.edu/jtb/whyvisitors}}, 13652 author = {Jens Palsberg}, 13653 institution = {Purdue University}, 13654 year = {1998} 13655} 13656 13657@Unpublished{ ply-web-page, 13658 title = {{PLY (Python Lex-Yacc)}}, 13659 note = {\url{http://systems.cs.chicago.edu/ply}}, 13660 author = {David Beazley}, 13661 institution = {University of Chicago} 13662} 13663 13664@Misc{ adic-web-page, 13665 title = {{ADIC Web page}}, 13666 note = {\url{http://www.mcs.anl.gov/autodiff}}, 13667 author = {Paul Hovland and Uwe Naumann and Boyana Norris}, 13668 institution = {Argonne National Laboratory} 13669} 13670 13671@Article{ naumann02, 13672 author = {Uwe Naumann}, 13673 title = {Optimal accumulation of {J}acobian matrices by elimination methods on the dual 13674 computational graph}, 13675 journal = {Mathematical Programming (to appear)}, 13676 note = {Preprint ANL/MCS-P944-0402, Argonne National Laboratory, April 2002}, 13677 year = {2003} 13678} 13679 13680@Article{ kaper1, 13681 author = {H. G. Kaper and T. J. Kaper}, 13682 title = {Asymptotic Analysis of Two Reduction Methods for Systems of Chemical Reactions}, 13683 journal = {Physica D}, 13684 year = {2002}, 13685 pages = {66--93}, 13686 volume = {165} 13687} 13688 13689@Misc{ veltisto-web-page, 13690 author = {George Biros}, 13691 title = {{Veltisto Web page}}, 13692 note = {\url{http://www.cs.nyu.edu/~biros/veltisto}} 13693} 13694 13695@Article{ karypiskumar98, 13696 author = {George Karypis and Vipin Kumar}, 13697 title = {A Parallel Algorithm for Multilevel Graph Partitioning and Sparse Matrix 13698 Ordering}, 13699 journal = {Journal of Parallel and Distributed Computing}, 13700 volume = {48}, 13701 pages = {71--85}, 13702 year = {1998} 13703} 13704 13705@TechReport{ karypiskumar97, 13706 author = {Karypis, George and Kumar, V.}, 13707 institution = {Department of Computer Science, University of Minnesota}, 13708 keywords = {graph partitioning; ParMetis}, 13709 note = {http://www.cs.umn.edu/~metis}, 13710 number = {97-060}, 13711 title = {{ParMETIS}: Parallel graph partitioning and sparse matrix ordering library}, 13712 year = {1997} 13713} 13714 13715@Misc{ parmetis-web-page, 13716 author = {George {Karypis et al.}}, 13717 title = {{ParMETIS Web page}}, 13718 note = {\url{http://www.cs.umn.edu/~karypis/metis/parmetis}}, 13719 year = {2005} 13720} 13721 13722@Misc{ sparskit-web-page, 13723 author = {Yousef {Saad et al.}}, 13724 title = {{SPARSKIT Web page}}, 13725 note = {\url{http://www.cs.umn.edu/~saad/software/SPARSKIT/sparskit.html}} 13726} 13727 13728@Misc{ dscpack-web-page, 13729 author = {Padma Raghavan}, 13730 title = {{DSCPACK Web page}}, 13731 note = {\url{http://www.cse.psu.edu/~raghavan/Dscpack}} 13732} 13733 13734@Misc{ gaussian-web-page, 13735 author = {}, 13736 title = {{Gaussian Web page}}, 13737 note = {\url{http://gaussian.com}}, 13738 key = {{Gaussian} {Web} page} 13739} 13740 13741@Book{ lapack-user-guide, 13742 author = {E. Anderson and Z. Bai and C. Bischof and S. Blackford and J. Demmel and J. 13743 Dongarra and J. Du Cris and A. Greenbaum and S. Hammarling and A. McKenney and D. 13744 Sorensen}, 13745 title = {LAPACK Users' Guide, Third Edition}, 13746 publisher = {SIAM}, 13747 year = {1999} 13748} 13749 13750@Manual{ nwchem4.1, 13751 author = {High Performance Computational Chemistry Group}, 13752 title = {{NWChem}, A Computational Chemistry Package for Parallel Computers, Version 4.1}, 13753 year = {2002}, 13754 organization = {Pacific Northwest National Laboratory}, 13755 address = {Richland, Washington 99325-0999 USA}, 13756 note = {See \url{http://www.emsl.pnl.gov/pub/docs/nwchem/}} 13757} 13758 13759@TechReport{ tchem, 13760 title = {{TC}hem: {A} Software Toolkit for the Analysis of Complex Kinetic Models}, 13761 author = {Cosmin Safta and Habib Najm and Omar Knio}, 13762 institution = {Sandia National Laboratories}, 13763 number = {SAND2011-3282}, 13764 year = {2011} 13765} 13766 13767@Misc{ scidac-web-page, 13768 author = {}, 13769 title = {{{SciDAC Initiative Web page}}}, 13770 note = {\url{http://www.osti.gov/scidac}}, 13771 key = {{SciDAC Initiative Web page}} 13772} 13773 13774@Misc{ cmrs:homepage, 13775 author = {Amitava {Bhattacharjee (PI)}}, 13776 title = {{Center for Magnetic Reconnection Studies}}, 13777 howpublished = {\url{http://www.physics.uiowa.edu/cmrs}} 13778} 13779 13780@Misc{ tops:homepage, 13781 author = {David {Keyes (PI)}}, 13782 title = {{Towards Optimal Petascale Simulations (TOPS) Center}}, 13783 howpublished = {\url{http://scalablesolvers.org}} 13784} 13785 13786@Misc{ tstt:homepage, 13787 author = {David Brown and Jim Glimm and Lori Freitag}, 13788 title = {{Terascale Simulation Tools and Technology (TSTT) Center}}, 13789 howpublished = {\url{http://www.tstt-scidac.org}}, 13790 year = {2005} 13791} 13792 13793@Misc{ petsc:applications, 13794 author = {B. F. {Smith et al.}}, 13795 title = {{Scientific Applications Using {PETSc}}}, 13796 howpublished = {\url{http://www.mcs.anl.gov/petsc/publications}} 13797} 13798 13799@Misc{ petsc:users, 13800 author = {B. F. {Smith et al.}}, 13801 title = {{PETSc User Statistics}}, 13802 howpublished = {\url{http://www.mcs.anl.gov/petsc/miscellaneous/usage.html}} 13803} 13804 13805@Misc{ cemm:homepage, 13806 author = {Steve {Jardin (PI)}}, 13807 title = {{Center for Extended MHD Modeling}}, 13808 howpublished = {\url{http://w3.pppl.gov/CEMM}} 13809} 13810 13811@Misc{ m3d:homepage, 13812 author = {Steve {Jardin et al.}}, 13813 title = {{M3D Web page}}, 13814 howpublished = {\url{http://w3.pppl.gov/m3d}} 13815} 13816 13817@Misc{ nimrod:homepage, 13818 author = {Carl R. {Sovinec et al.}}, 13819 title = {{NIMROD Web page}}, 13820 howpublished = {http://nimrodteam.org} 13821} 13822 13823@Misc{ grace-web-page, 13824 author = {Manish {Parashar et al.}}, 13825 title = {{GrACE Web Page}}, 13826 howpublished = {\url{http://www.caip.rutgers.edu/~parashar/TASSL/Projects/GrACE}} 13827} 13828 13829@Misc{ accel1, 13830 title = {Advanced Computing for 21st Century Accelerator Science and Technology Web page}, 13831 howpublished = {\url{http://scidac.nersc.gov/accelerator/}}, 13832 author = {K. Ko and R. Ryne (PIs)} 13833} 13834 13835@Unpublished{ katzspiegelman03, 13836 author = {Richard F. Katz and Marc Spiegelman}, 13837 title = {A semi-{L}agrangian {C}rank-{N}icholson algorithm for the numerical solution of 13838 advection-diffusion problems}, 13839 note = {Columbia University, in preparation} 13840} 13841 13842@Misc{ acts:homepage, 13843 author = {}, 13844 title = {{Advanced CompuTational Software (ACTS) Web page}}, 13845 howpublished = {\url{http://acts.nersc.gov}}, 13846 key = {{Advanced CompuTational Software (ACTS) Web page}} 13847} 13848 13849@Article{ superlu99, 13850 author = {James W. Demmel and Stanley C. Eisenstat and John R. Gilbert and Xiaoye S. Li and 13851 Joseph W. H. Liu}, 13852 title = {A supernodal approach to sparse partial pivoting}, 13853 journal = {SIAM J. Matrix Analysis and Applications}, 13854 year = {1999}, 13855 volume = {20}, 13856 number = {3}, 13857 pages = {720-755} 13858} 13859 13860@Misc{ superlu:homepage, 13861 author = {J. Demmel and J. Gilbert and X. Li}, 13862 title = {{SuperLU Web page}}, 13863 howpublished = {http://crd.lbl.gov/\~xiaoye/SuperLU} 13864} 13865 13866@InProceedings{ ccf98, 13867 author = {E. Chow and A. Cleary and R. Falgout}, 13868 title = {Design of the hypre Preconditioner Library}, 13869 booktitle = {Proceedings of the SIAM Workshop on Object Oriented Methods for Inter-operable 13870 Scientific and Engineering Computing}, 13871 publisher = {SIAM}, 13872 year = {1999} 13873} 13874 13875@TechReport{ hypre-users-manual, 13876 author = {R. Falgout}, 13877 title = {{hypre} Users Manual}, 13878 number = {Revision 2.28}, 13879 institution = {Lawrence Livermore National Laboratory}, 13880 year = {2023}, 13881 url = {https://hypre.readthedocs.io/} 13882} 13883 13884@Misc{ hypre:homepage, 13885 author = {R. Falgout}, 13886 title = {{hypre Web page}}, 13887 howpublished = {\url{https://www.llnl.gov/casc/hypre}} 13888} 13889 13890@InProceedings{ trilinos:gpu, 13891 author = {C.G. Baker and M.A. Heroux. and H.C. Edwards and A.B. Williams}, 13892 title = {A Light-weight API for Portable Multicore Programming}, 13893 booktitle = {18th Euromicro International Conference on Parallel, Distributed and 13894 Network-Based Processing (PDP)}, 13895 pages = {601--606}, 13896 publisher = {IEEE}, 13897 year = {2010} 13898} 13899 13900@InProceedings{ heroux2004design, 13901 title = {The design of {T}rilinos}, 13902 author = {Heroux, Michael A and Sala, Marzio}, 13903 booktitle = {International Workshop on Applied Parallel Computing}, 13904 pages = {620--628}, 13905 year = {2004}, 13906 organization = {Springer} 13907} 13908 13909@Misc{ trilinos:homepage, 13910 author = {M. {Heroux et al.}}, 13911 title = {{Trilinos Web page}}, 13912 howpublished = {{\tt http://trilinos.sandia.gov/}} 13913} 13914 13915@Article{ trilinos:overview, 13916 author = {Michael A. Heroux and Roscoe A. Bartlett and Vicki E. Howle and Robert J. 13917 Hoekstra and Jonathan J. Hu and Tamara G. Kolda and Richard B. Lehoucq and Kevin 13918 R. Long and Roger P. Pawlowski and Eric T. Phipps and Andrew G. Salinger and Heidi 13919 K. Thornquist and Ray S. Tuminaro and James M. Willenbring and Alan Williams and 13920 Kendall S. Stanley}, 13921 title = {An overview of the {T}rilinos project}, 13922 journal = {ACM Transactions on Mathematical Software}, 13923 volume = {31}, 13924 number = {3}, 13925 year = {2005}, 13926 issn = {0098-3500}, 13927 pages = {397--423}, 13928 publisher = {ACM Press}, 13929 doi = {10.1145/1089014.1089021} 13930} 13931 13932@Misc{ rythmos:homepage, 13933 author = {T. Coffey and R. Bartlett}, 13934 title = {Rythmos: Transient Integration of Differential Equations}, 13935 howpublished = {\url{http://trilinos.sandia.gov/packages/rythmos}} 13936} 13937 13938@Misc{ triangle:homepage, 13939 author = {J. {Shewchuk}}, 13940 title = {{Triangle: A Two-Dimensional Quality Mesh Generator and Delaunay Triangulator}}, 13941 howpublished = {\url{http://www-2.cs.cmu.edu/~quake/triangle.html}}, 13942 year = {2005} 13943} 13944 13945@Misc{ tetgen:homepage, 13946 author = {Hang {Si}}, 13947 title = {{TetGen: A Quality Tetrahedral Mesh Generator and Three-Dimensional Delaunay 13948 Triangulator}}, 13949 howpublished = {\url{http://tetgen.berlios.de}}, 13950 year = {2005} 13951} 13952 13953@Misc{ eigen:homepage, 13954 author = {Benoit Jacob and Ga\"el Guennebaud}, 13955 title = {{Eigen} {W}eb page}, 13956 key = {Jacob}, 13957 url = {http://eigen.tuxfamily.org/}, 13958 howpublished = {\url{http://eigen.tuxfamily.org/}}, 13959 year = {2015} 13960} 13961 13962@Misc{ dune:homepage, 13963 author = {Peter Bastian and Markus Blatt and Andreas Dedner and Christian Engwer and Jorrit 13964 Fahlke and Christoph Gersbacher and Carsten Gr\"aser and Christoph Gr\"uninger 13965 Robert Kl\"ofkorn and Steffen M\"uthing and Martin Nolte and Mario Ohlberger and 13966 Oliver Sander}, 13967 title = {{DUNE} {W}eb page}, 13968 key = {Bastian}, 13969 url = {http://www.dune-project.org/}, 13970 howpublished = {\url{http://www.dune-project.org/}}, 13971 year = {2015} 13972} 13973 13974@Misc{ thrust, 13975 author = {N. Bell and J. Hoberock}, 13976 title = {The {T}hrust Library}, 13977 howpublished = {{\tt http://code.google.com/p/thrust/}}, 13978 year = {2010} 13979} 13980 13981@Misc{ cusp, 13982 author = {N. Bell and M. Garland}, 13983 title = {The {C}usp Library}, 13984 howpublished = {{\tt http://code.google.com/p/cusp-library/}}, 13985 year = {2010} 13986} 13987 13988@Misc{ cig:homepage, 13989 author = {M. {Gurnis et al.}}, 13990 title = {{Computational Infrastructure for Geodynamics}}, 13991 howpublished = {\url{http://www.geodynamics.org}} 13992} 13993 13994@Article{ maltsevselkov00, 13995 author = {R. Overbeek and N. Larsen and G. Pusch and M. D'Souza and E. Selkov Jr. and N. 13996 Kyrpides and M. Fonstein and N. Maltsev and E. Selkov}, 13997 title = {{WIT}: {I}ntegrated system for high-throughput genome sequence analysis and 13998 metabolic reconstruction}, 13999 journal = {Nucleic Acids Res.}, 14000 year = {2000}, 14001 month = jan, 14002 pages = {123-125}, 14003 volume = {28}, 14004 number = {1} 14005} 14006 14007@Article{ more:coloring, 14008 author = {Thomas F. Coleman and Jorge J. Mor\'{e}}, 14009 title = {Estimation of sparse {J}acobian matrices and graph coloring problems}, 14010 journal = {SIAM Journal on Numerical Analysis}, 14011 year = {1983}, 14012 month = feb, 14013 pages = {187--209}, 14014 volume = {20}, 14015 number = {1} 14016} 14017 14018@Article{ selkovmaltsev97, 14019 author = {E. Selkov and N. Maltsev and G.J. Olsen and R. Overbeek and W. B. Whitman}, 14020 title = {A reconstruction of the metabolism of Methanococcus jannaschii from sequence 14021 data}, 14022 journal = {Gene}, 14023 year = {1997}, 14024 pages = {GC11-GC26}, 14025 volume = {197}, 14026 number = {1-2} 14027} 14028 14029@Unpublished{ rocketcenter, 14030 title = {Center for Simulation of Advanced Rockets}, 14031 note = {http://www.csar.uiuc.edu}, 14032 institution = {University of Illinois at Urbana-Champaign} 14033} 14034 14035@Article{ kirby03, 14036 title = {A posteriori error estimates for the mixed hybrid finite element method}, 14037 author = {Robert C Kirby}, 14038 journal = {Computational Geosciences}, 14039 volume = {7}, 14040 pages = {197--214}, 14041 note = {\url{http://www.ices.utexas.edu/~clint/nsf/apostmfem.ps}}, 14042 year = {2003} 14043} 14044 14045@Article{ kirby2003b, 14046 title = {On the convergence of high resolution methods with multiple time scales for 14047 hyperbolic conservation laws}, 14048 author = {Robert C Kirby}, 14049 journal = {Mathematics of computation}, 14050 volume = {72}, 14051 number = {243}, 14052 pages = {1239--1250}, 14053 year = {2003} 14054} 14055 14056@Article{ dawsonkirby2001, 14057 title = {High resolution schemes for conservation laws with locally varying time steps}, 14058 author = {Clint Dawson and Robert C Kirby}, 14059 journal = {SIAM Journal on Scientific Computing}, 14060 volume = {22}, 14061 number = {6}, 14062 pages = {2256--2281}, 14063 year = {2001}, 14064 publisher = {SIAM} 14065} 14066 14067@Article{ dawsonkirby1999, 14068 title = {Solution of parabolic equations by backward Euler-mixed finite element methods on 14069 a dynamically changing mesh}, 14070 author = {Clint Dawson and Robert C Kirby}, 14071 journal = {SIAM Journal on Numerical Analysis}, 14072 volume = {37}, 14073 number = {2}, 14074 pages = {423--442}, 14075 year = {1999}, 14076 publisher = {SIAM} 14077} 14078 14079@Article{ barthlarson00, 14080 author = {T. J. Barth and M. G. Larson}, 14081 title = {{\em A posteriori} Error Estimation for Discontiuous {G}alerkin Approximations of 14082 Hyperbolic Systems}, 14083 journal = {LNCS}, 14084 year = {2000}, 14085 volume = {11}, 14086 publisher = {Spinger-Verlag} 14087} 14088 14089@Article{ xu1, 14090 author = {J. Xu}, 14091 title = {Iterative Methods by Space Decomposition and Subspace Correction}, 14092 journal = {SIAM Review}, 14093 volume = {34}, 14094 pages = {581--613}, 14095 year = {1992} 14096} 14097 14098@Article{ brandt77, 14099 author = {Achi Brandt}, 14100 title = {Multi-Level Adaptive Solutions to Boundary-Value Problems}, 14101 journal = {Mathematics of Computation}, 14102 month = apr, 14103 year = {1977}, 14104 pages = {333--390}, 14105 volume = {31}, 14106 number = {138}, 14107 doi = {10.2307/2006422} 14108} 14109 14110@Article{ brandt1979multigrid, 14111 title = {{Multigrid solutions to elliptic flow problems}}, 14112 author = {Brandt, A. and Dinar, N.}, 14113 journal = {Numerical Methods for Partial Differential Equations}, 14114 pages = {53--147}, 14115 year = {1979} 14116} 14117 14118@InCollection{ brandt1979singular, 14119 title = {Multi-Level Adaptive Techniques(MLAT) for singular-perturbation problems}, 14120 author = {Achi Brandt}, 14121 booktitle = {Numerical Analysis of Singular Perturbation Problems}, 14122 editor = {Hemker, Pieter W. and Miller, John J.H.}, 14123 pages = {53--142}, 14124 year = {1979}, 14125 publisher = {Academic Press} 14126} 14127 14128@Article{ amge1, 14129 author = {M. Brezina and A. J. Cleary and R. D. Falgout and V. E. Henson and J. E. Jones 14130 and T. A. Manteuffel and S. F. McCormick and J. W. Ruge}, 14131 title = {Algebraic Multigrid Based on Element Interpolation (AMGe)}, 14132 journal = {SIAM J. Scientific Computing}, 14133 volume = {22}, 14134 pages = {1570--1592}, 14135 year = {2000} 14136} 14137 14138@Book{ bramble1, 14139 author = {J. H. Bramble}, 14140 title = {Multigrid Methods}, 14141 publisher = {Longman Scientific and Technical}, 14142 address = {Essex, England}, 14143 year = {1993} 14144} 14145 14146@Book{ arpack98, 14147 author = {R. B. Lehoucq and D. C. Sorensen and C. Yang}, 14148 title = {ARPACK, Users' Guide}, 14149 publisher = {SIAM}, 14150 year = {1998} 14151} 14152 14153@Article{ bbder96, 14154 author = {R. Barrett and M. Berry and J. Dongarra and V. Eijkhout and C. Romine}, 14155 title = {Algorithmic bombardment for the iterative solution of linear systems: A 14156 polyIterative approach}, 14157 journal = {J. of Computational and Applied Mathematics}, 14158 year = {1996}, 14159 volume = {74}, 14160 pages = {91--110} 14161} 14162 14163@Article{ egks94, 14164 author = {A. Ern and V. Giovangigli and D. E. Keyes and M. D. Smooke}, 14165 title = {Towards polyalgorithmic linear system solvers for nonlinear elliptic problems,}, 14166 journal = {SIAM J. Scientific Computing}, 14167 year = {1994}, 14168 volume = {15}, 14169 number = {3}, 14170 pages = {681--703} 14171} 14172 14173@Article{ dftb02, 14174 author = {P. Zapol and M. Sternberg and L.A. Curtiss and Th. Frauenheim and D.M. Gruen}, 14175 title = {Tight-binding molecular-dynamics simulation of impurities in ultrananocrystalline 14176 diamond grain boundaries,}, 14177 journal = {Phys. Rev}, 14178 year = {2002}, 14179 volume = {B65}, 14180 pages = {045403} 14181} 14182 14183@InBook{ lsa, 14184 author = {R. Bramley and D. Gannon and T. Stuckey and J. Villacis and J. Balasubramanian 14185 and E. Akman and F. Berg and S. Diwan and M. Govindaraju}, 14186 title = {The linear system analyzer}, 14187 series = {enabling technologies for computational science}, 14188 year = {2002}, 14189 publisher = {Kluwer}, 14190 location = {Dordrecht} 14191} 14192 14193@Article{ kk97, 14194 author = {Carl T. Kelley and David E. Keyes}, 14195 title = {Convergence analysis of pseudo-transient continuation}, 14196 journal = {SIAM J. Numerical Analysis}, 14197 year = {1998}, 14198 volume = {35}, 14199 pages = {508--523} 14200} 14201 14202@Article{ swtm01, 14203 author = {R. Shepard and A. F. Wagner and J. L. Tilson and M. Minkoff}, 14204 journal = {Journal of Computational Physics}, 14205 year = {2001}, 14206 volume = {172}, 14207 number = {2}, 14208 pages = {472--514}, 14209 title = {The Subspace Projected Approximate Matrix {(SPAM)} Modification of the {D}avidson 14210 Method} 14211} 14212 14213@TechReport{ zhou03, 14214 author = {Y. Zhou}, 14215 title = {Eigenvalue Computation from the Optimization Perspective: On {Jacobi-Davidson, 14216 IIGD, RQI and Newton} Updates}, 14217 institution = {Argonne National Laboratory}, 14218 number = {ANL/MCS-P1074-0803}, 14219 note = {Submitted to Numerical Linear Algebra with Applications}, 14220 year = {2003} 14221} 14222 14223@Unpublished{ mtwm03, 14224 author = {G. G. Maisuradze and D. L. Thompson and A. F. Wagner and M. Minkoff}, 14225 title = {Interpolating moving least squares methods for fitting potential energy surfaces: 14226 Detailed analysis of one-dimensional applications}, 14227 note = {to appear in the Journal of Chemical Physics}, 14228 year = {2003} 14229} 14230 14231@Article{ singhjosephheslaglowinskipan00, 14232 author = {P. Singh and D. D. Joseph and T. Hesla and R. Glowinski and T.-W. Pan}, 14233 title = {A distributed {L}agrange multiplier/fictitious domain model for viscoelastic 14234 particulate flows}, 14235 journal = {J. Non-Newtonian Fluid Mech.}, 14236 volume = {91}, 14237 pages = {165--188}, 14238 year = {2000} 14239} 14240 14241@Book{ joseph02, 14242 author = {Daniel D. Joseph}, 14243 title = {Interrogations of Direct Numerical Simulations of Sloid-Liquid Flows}, 14244 publisher = {Springer-Verlag}, 14245 month = mar, 14246 year = {2002}, 14247 note = {\url{http://www.efluids.com/efluids/books/joseph.htm}} 14248} 14249 14250@Misc{ triangle-web-page, 14251 author = {Jonathan R. Shewchuk}, 14252 title = {{Triangle Web} page}, 14253 note = {\url{http://www-2.cs.cmu.edu/~quake/triangle.html}} 14254} 14255 14256@InCollection{ shewchuk96, 14257 author = {Jonathan R. Shewchuk}, 14258 title = {Triangle: {E}ngineering a {2D} Quality Mesh Generator and {D}elaunay 14259 Triangulator}, 14260 booktitle = {Applied Computational Geometry: Towards Geometric Engineering}, 14261 editor = {Ming C. Lin and Dinesh Manocha}, 14262 series = {Lecture Notes in Computer Science}, 14263 volume = {1148}, 14264 publisher = {Springer-Verlag}, 14265 pages = {203--222}, 14266 month = may, 14267 year = {1996}, 14268 note = {From the First ACM Workshop on Applied Computational Geometry} 14269} 14270 14271@Article{ leaf1, 14272 author = {Transient Dynamics of Pinning of Domain Walls}, 14273 title = {G. K. Leaf and S. Obukhov and S. Scheidl and V. M. Vinokur}, 14274 journal = {J. Magnetism and Magnetic Materials}, 14275 volume = {241}, 14276 pages = {118--123}, 14277 year = {2002} 14278} 14279 14280@Article{ leaf2, 14281 author = {D. O. Gunter and H. G. Kaper and G. K. Leaf}, 14282 title = {Implicit Integration of the Time-Dependent {Ginzburg-Landau} Equations of 14283 Superconductivity}, 14284 journal = {SIAM J. Sci. Comp.}, 14285 volume = {23}, 14286 pages = {1944--1959}, 14287 year = {2002} 14288} 14289 14290@Article{ leaf3, 14291 author = { J. S. Jiang and H. G. Kaper and G. K. Leaf}, 14292 title = {Hysteresis in Layered Spring Magnets}, 14293 journal = { Discreet and Continuous Dynamical Systems, Series B}, 14294 volume = {1}, 14295 pages = {219--232}, 14296 year = {2001} 14297} 14298 14299@Article{ leaf4, 14300 author = {J. S. Jiang and S. D. Bader and H. G. Kaper and G. K. Leaf}, 14301 title = {Rotational Hysteresis of Exchange-Spring Magnets}, 14302 journal = {J. Phys. D Appl. Phys.}, 14303 volume = {35}, 14304 pages = {2339--2343}, 14305 year = {2002} 14306} 14307 14308@Article{ leaf5, 14309 author = {M. Grimsditch and G. K. Leaf and H. G. Kaper and D. A. Karpeev and R. E. Camley}, 14310 title = {Normal Modes of Spin Excitation in Magnetic Nanoparticles}, 14311 journal = {Submitted to Phys. Rev. B.}, 14312 note = {Submitted}, 14313 year = {2003} 14314} 14315 14316@Article{ graysumpternoidbarnes01, 14317 author = {S. K. Gray and B. G. Sumpter and D. W. Noid and M. d. Barnes}, 14318 title = {Quantum Mechanical Model of Localized Electrons on the Surface of Polymer 14319 Nanospheres}, 14320 journal = {Chem. Phys. Lett.}, 14321 volume = {333}, 14322 pages = {308--313}, 14323 year = {2001} 14324} 14325 14326@InProceedings{ petsc-efficient, 14327 author = {Satish Balay and William~D. Gropp and Lois Curfman McInnes and Barry~F. Smith}, 14328 title = {Efficient Management of Parallelism in Object Oriented Numerical Software 14329 Libraries}, 14330 booktitle = {Modern Software Tools in Scientific Computing}, 14331 editor = {E. Arge and A.~M. Bruaset and H.~P. Langtangen}, 14332 publisher = {Birkh{\"{a}}user Press}, 14333 pages = {163--202}, 14334 year = {1997} 14335} 14336 14337@Article{ mumps01, 14338 author = {Patrick R. Amestoy and Ian S. Duff and Jean-Yves L'Excellent and Jacko Koster}, 14339 title = {A fully asynchronous multifrontal solver using distributed dynamic scheduling}, 14340 journal = {SIAM Journal on Matrix Analysis and Applications}, 14341 volume = {23}, 14342 number = {1}, 14343 pages = {15--41}, 14344 year = {2001} 14345} 14346 14347@Article{ mumps19, 14348 title = {{Performance and Scalability of the Block Low-Rank Multifrontal Factorization on 14349 Multicore Architectures}}, 14350 author = {P.R. Amestoy and A. Buttari and J.-Y. L'Excellent and T. Mary}, 14351 journal = {ACM Transactions on Mathematical Software}, 14352 volume = {45}, 14353 issue = {1}, 14354 pages = {2:1--2:26}, 14355 year = {2019} 14356} 14357 14358@Article{ zoltan06, 14359 author = {Karen D. Devine and Erik G. Boman and Robert T. Heaphy and \"Umit V. 14360 \c{C}ataly\"urek and Robert H. Bisseling}, 14361 title = {Parallel Hypergraph Partitioning for Irregular Problems}, 14362 journal = {SIAM Parallel Processing for Scientific Computing}, 14363 month = feb, 14364 year = {2006} 14365} 14366 14367@Article{ lidemmel03, 14368 author = {Xiaoye S. Li and James W. Demmel}, 14369 title = {{SuperLU\_DIST}: a scalable distributed-memory sparse direct solver for 14370 unsymmetric linear systems}, 14371 journal = {ACM Transactions on Mathematical Software}, 14372 year = {2003}, 14373 month = jun, 14374 volume = {29}, 14375 number = {2}, 14376 pages = {110--140} 14377} 14378 14379@TechReport{ superlu, 14380 author = {James W. Demmel and John R. Gilbert and Xiaoye S. Li}, 14381 title = {{SuperLU} Users' Guide}, 14382 number = {LBNL-44289}, 14383 institution = {Lawrence Berkeley National Laboratory}, 14384 year = {2003}, 14385 url = {http://crd.lbl.gov/\~xiaoye/SuperLU/} 14386} 14387 14388@TechReport{ trilinos-overview03, 14389 title = {{An Overview of {T}rilinos}}, 14390 author = {Michael Heroux and Roscoe Bartlett and Vicki Howle Robert Hoekstra and Jonathan 14391 Hu and Tamara Kolda and Richard Lehoucq and Kevin Long and Roger Pawlowski and 14392 Eric Phipps and Andrew Salinger and Heidi Thornquist and Ray Tuminaro and James 14393 Willenbring and Alan Williams}, 14394 institution = {Sandia National Laboratories}, 14395 number = {SAND2003-2927}, 14396 year = {2003} 14397} 14398 14399@TechReport{ trilinos-users-guide, 14400 title = {{Trilinos} Users Guide}, 14401 author = {Michael A. Heroux and James M. Willenbring}, 14402 institution = {Sandia National Laboratories}, 14403 number = {SAND2003-2952}, 14404 url = {http://trilinos.sandia.gov/}, 14405 year = {2003} 14406} 14407 14408@Article{ pilut01, 14409 author = {David Hysom and Alex Pothen}, 14410 title = {A scalable parallel algorithm for incomplete factor preconditioning}, 14411 journal = {SIAM Journal on Scientific Computing}, 14412 volume = {22}, 14413 pages = {2194--2215}, 14414 year = {2001} 14415} 14416 14417@TechReport{ boomeramg00, 14418 author = {V.~E. Henson and U.~M. Yang}, 14419 title = {{BoomerAMG}: A parallel algebraic multigrid solver and preconditioner}, 14420 institution = {Lawrence Livermore National Laboratory}, 14421 number = {UCRL-JC-133948}, 14422 year = {2000} 14423} 14424 14425@InCollection{ baker2012scaling, 14426 title = {Scaling algebraic multigrid solvers: {O}n the road to exascale}, 14427 author = {Baker, Allison H. and Falgout, Robert D. and Gamblin, Todd and Kolev, Tzanio V. 14428 and Schulz, Martin and Yang, Ulrike Meier}, 14429 booktitle = {Competence in High Performance Computing 2010}, 14430 pages = {215--226}, 14431 year = {2012}, 14432 publisher = {Springer} 14433} 14434 14435@Article{ knollkeyes:04, 14436 author = {D. A. Knoll and D. E. Keyes}, 14437 year = {2004}, 14438 title = {Jacobian-free {Newton-Krylov} Methods: A Survey of Approaches and Applications}, 14439 journal = {J. Comp. Phys.}, 14440 volume = {193}, 14441 pages = {357-397} 14442} 14443 14444@Article{ chacon02, 14445 author = {Luis Chacon and Dana A. Knoll and John M. Finn}, 14446 title = {An implicit nonlinear reduced resistive {MHD} solver}, 14447 journal = {J. Comput. Phys}, 14448 volume = {188}, 14449 year = {2002}, 14450 pages = {15--36} 14451} 14452 14453@Article{ mousseau03, 14454 author = {V. A. Mousseau and D. A. Knoll}, 14455 title = {New Physics-based Preconditioning of Implicit Methods for Non-Equilibrium 14456 Radiation Diffusion}, 14457 journal = {J. Comput. Physics}, 14458 year = {2003} 14459} 14460 14461@Article{ mousseau00, 14462 author = {V. A. Mousseau and D. A. Knoll and W. J. Rider}, 14463 title = {Physics-based Preconditioning and the {Newton-Krylov} Method for Non-Equilibrium 14464 Radiation Diffusion}, 14465 journal = {J. Comput. Physics}, 14466 year = {2000}, 14467 pages = {743--765}, 14468 volume = {160} 14469} 14470 14471@Unpublished{ facets:homepage, 14472 author = {John {Cary (PI)}}, 14473 title = {{Framework Application for Core-Edge Transport Simulations (FACETS)}}, 14474 note = {Proto-FSP project, see \url{http://www.facetsproject.org}} 14475} 14476 14477@Unpublished{ cpes:homepage, 14478 author = {{C.S.} {Chang (PI)}}, 14479 title = {{Center for Plasma Edge Simulation (CPES)}}, 14480 note = {Proto-FSP project, see \url{http://www.cims.nyu.edu/cpes}} 14481} 14482 14483@Misc{ epsi:homepage, 14484 author = {{C.S.} {Chang (PI)}}, 14485 title = {{Center for Edge Physics Simulation (EPSI)}}, 14486 note = {\url{http://epsi.pppl.gov}} 14487} 14488 14489@Unpublished{ groundwater-scidac2:web, 14490 author = {Peter {Lichtner (PI)}}, 14491 title = {Modeling Multiscale-Multiphase-Multicomponent Subsurface Reactive Flows Using 14492 Advanced Computing}, 14493 howpublished = {http://www.scidac.gov/groundwater/gwflow.html} 14494} 14495 14496@Misc{ pflotran:web, 14497 author = {Peter {Lichtner (PI)}}, 14498 title = {{Modeling Multiscale-Multiphase-Multicomponent Subsurface Reactive Flows Using 14499 Advanced Computing}}, 14500 note = {\url{http://ees.lanl.gov/pflotran/}} 14501} 14502 14503@Misc{ accel-scidac2-solicitation, 14504 author = {{DOE Office of Science}}, 14505 title = {{Program Announcement LAB 07-09, SciDAC: Accelerator Science and Simulation}}, 14506 year = {2006}, 14507 note = {\url{http://www.science.doe.gov/grants/LAB07_09.html}} 14508} 14509 14510@Article{ nieter04, 14511 author = {C. Nieter and J. R. Cary}, 14512 title = {{VORPAL}: A Versatile Plasma Simulation Code}, 14513 journal = {J. Comp. Phys.}, 14514 year = {2004}, 14515 volume = {196}, 14516 pages = {448} 14517} 14518 14519@Article{ synergia06, 14520 author = {J. Amundson and P. Spentzouris and J. Qiang and R. Ryne}, 14521 title = {Synergia: An accelerator modeling tool with {3-D} space charge}, 14522 journal = {J. Comp. Phys.}, 14523 year = {2006}, 14524 volume = {211}, 14525 pages = {229-248} 14526} 14527 14528@Unpublished{ stoltz07, 14529 author = {P. H. Stoltz}, 14530 title = {Maps of {RF} cavities generated from electromagnetic simulations}, 14531 year = {2007}, 14532 note = {to appear in Proceedings of the 2007 Particle Accelerator Conference (PAC07), 14533 Albuquerque, NM, 2007} 14534} 14535 14536@Misc{ iter:homepage, 14537 key = {{International Thermonuclear Experimental Reactor (ITER) homepage}}, 14538 year = {2007}, 14539 title = {{International Thermonuclear Experimental Reactor (ITER) homepage}}, 14540 howpublished = {\url{http://www.iter.org}} 14541} 14542 14543@Misc{ epp2010, 14544 author = {{Committee on Elementary Particle Physics in the 21st Century, National Research 14545 Council}}, 14546 title = {Revealing the Hidden Nature of Space and Time: Charting the Course for Elementary 14547 Particle Physics}, 14548 year = {2006}, 14549 howpublished = {The National Academies Press, ISBN: 0309101948} 14550} 14551 14552@Misc{ post-fsp-report, 14553 author = {D.~E.~Post and D.~B.~Batchelor and R.~B.~Bramley and J.~R.~Cary and R.~H.~Cohen 14554 and P.~Colella and S.~C.~Jardin}, 14555 title = {{Report of Fusion Simulation Project Steering Committee}}, 14556 month = aug, 14557 year = {2004}, 14558 note = {Available via \url{http://w3.pppl.gov/usjapanim/FSPReport.pdf}} 14559} 14560 14561@Misc{ fsp:workshop2011, 14562 key = {{Fusion Simulation Project (FSP) Planning Workshop}}, 14563 title = {{Fusion Simulation Project (FSP) Planning Workshop}}, 14564 month = feb, 14565 year = {2011}, 14566 note = {\url{https://ice.txcorp.com/trac/2011_FspDefinitionWorkshop}} 14567} 14568 14569@Book{ hazeltine-meiss-book, 14570 author = {R.~D.~Hazeltine and J.~D.~Meiss}, 14571 title = {Plasma Confinement}, 14572 year = {1991}, 14573 publisher = {Addison-Wesley, Redwood City, CA} 14574} 14575 14576@Article{ falgout05a, 14577 author = {R. D. Falgout and J. E. Jones and U. M. Yang}, 14578 title = {Conceptual Interfaces in hypre}, 14579 journal = {Future Generation Computer Systems}, 14580 note = {Special issue on PDE software}, 14581 volume = {22}, 14582 year = {2005}, 14583 pages = {239--251} 14584} 14585 14586@Article{ falgout05b, 14587 author = {R. D. Falgout and J. E. Jones and U. M. Yang}, 14588 title = {Pursuing Scalability for hypre's Conceptual Interfaces}, 14589 journal = {ACM Trans. Math. Softw.}, 14590 volume = {31}, 14591 year = {2005}, 14592 pages = {326--350} 14593} 14594 14595@Unpublished{ compass:homepage, 14596 author = {Panagiotis {Spentzouris (PI)}}, 14597 title = {Community Petascale Project for Accelerator Science and Simulation (ComPASS)}, 14598 note = {SciDAC2 project, see \url{https://compass.fnal.gov/}} 14599} 14600 14601@Unpublished{ cmsnf:homepage, 14602 author = {{Todd Allen, Director}}, 14603 title = {{Center for Materials Science of Nuclear Fuel}}, 14604 note = {Energy Frontier Research Center, see 14605 \url{https://inlportal.inl.gov/portal/server.pt/community/center_for_materials_science_of_nuclear_fuel}} 14606} 14607 14608@Unpublished{ dvi-materials:project, 14609 author = {{L.~C.} {McInnes (PI)}}, 14610 title = {Large-Scale Differential Variational Inequalities for Heterogeneous Materials}, 14611 note = {{SciDAC}-e project}, 14612 year = {2011} 14613} 14614 14615@Misc{ scidac:homepage, 14616 author = {{DOE Office of Science}}, 14617 title = {{Scientific Discovery through Advanced Computing}}, 14618 year = {2007}, 14619 howpublished = {\url{http://www.scidac.gov}} 14620} 14621 14622@Misc{ corba, 14623 author = {{Object Management Group}}, 14624 year = {2007}, 14625 title = {{Common Object Request Broker Architecture (CORBA)}}, 14626 howpublished = {\url{http://www.corba.org}} 14627} 14628 14629@Article{ uedge, 14630 author = {T.~D. Rognlien and D.~D. Ryutov and N. Mattor and G.~D. Porter}, 14631 title = {Two-Dimensional Electric Fields and Drifts near the Magnetic Separatrix in 14632 Divertor Tokamak}, 14633 journal = {J. Plasma Physics}, 14634 year = {1999}, 14635 volume = {6}, 14636 pages = {1851}, 14637 note = {also see user manual at http://www.mfescience.org, then UEDGE link} 14638} 14639 14640@Article{ bout, 14641 author = {X.~Q. Xu and R.~H. Cohen and T.~D. Rognlien and J.~R. Myra}, 14642 title = {Low-to-High Confinement Transition Simulations in Divertor Geometry}, 14643 journal = {J. Plasma Physics}, 14644 year = {2000}, 14645 volume = {7}, 14646 pages = {1951}, 14647 note = {} 14648} 14649 14650@Article{ bout++, 14651 author = {B. Dudson and M. Umansky and X.~Q. Xu and P. B. Snyder and H. R. Wilson}, 14652 title = {{BOUT++}: A Framework for Parallel Plasma Fluid Simulations}, 14653 journal = {Computer Physics Communications}, 14654 year = {2009}, 14655 volume = {180}, 14656 issue = {9}, 14657 pages = {1467 -- 1480}, 14658 note = {} 14659} 14660 14661@Article{ tempest, 14662 author = {Z. Xiong and X.Q. Xu and B.I. Cohen and R. Cohen and M.R. Dorr and J.A. Hittinger 14663 and G. Kerbel and W.M. Nevins and T. Rognlien}, 14664 title = {Simulation of Plasma Transport in a Toroidal Annulus with TEMPEST}, 14665 journal = {Bull. Am. Phys. Soc. }, 14666 year = {2005}, 14667 volume = {50}, 14668 number = {86}, 14669 pages = {CP1}, 14670 note = {} 14671} 14672 14673@Article{ ccahpc, 14674 author = {David E. Bernholdt and Benjamin A. Allan and Robert Armstrong and Felipe Bertrand 14675 and Kenneth Chiu and Tamara L. Dahlgren and Kostadin Damevski and Wael R. Elwasif 14676 and Thomas G. W. Epperly and Madhusudhan Govindaraju and Daniel S. Katz and James 14677 A. Kohl and Manoj Krishnan and Gary Kumfert and J. Walter Larson and Sophia 14678 Lefantzi and Michael J. Lewis and Allen D. Malony and Lois C. McInnes and Jarek 14679 Nieplocha and Boyana Norris and Steven G. Parker and Jaideep Ray and Sameer Shende 14680 and Theresa L. Windus and Shujia Zhou}, 14681 title = {A Component Architecture for High-Performance Scientific Computing}, 14682 journal = {Intl. J. High-Perf. Computing Appl.}, 14683 volume = {20}, 14684 pages = {163--202}, 14685 year = {2006}, 14686 note = {ACTS Collection special issue} 14687} 14688 14689@Misc{ cca-forum:homepage, 14690 author = {{Common Component Architecture Forum}}, 14691 note = {\url{http://www.cca-forum.org}}, 14692 year = {2010} 14693} 14694 14695@Misc{ petsc:driven-cavity-example, 14696 title = {{PETSc Driven Cavity Example Code}}, 14697 author = {B. F. {Smith et al.}}, 14698 howpublished = {\url{https://petsc.org/release/src/snes/tutorials/ex19.c.html}} 14699} 14700 14701@Misc{ petsc-dm:webpage, 14702 author = {B. F. {Smith et al.}}, 14703 title = {{PETSc DM Webpage}}, 14704 howpublished = {\url{https://petsc.org/release/manualpages/DM/}}, 14705 year = {2018} 14706} 14707 14708@Misc{ unic-ref, 14709 author = {Giuseppe Palmiotti}, 14710 title = {{UNIC} Neutronics Software}, 14711 note = {Nuclear Engineering Division, Argonne National Laboratory} 14712} 14713 14714% ----------------------------------------------------------------------- 14715% Model coupling refs 14716@Book{ greve-blatter, 14717 author = {Ralf Greve and Heinz Blatter}, 14718 title = {Dynamics of Ice Sheets and Glaciers}, 14719 series = {Advances in Geophysical and Environmental Mechanics and Mathematics}, 14720 publisher = {Springer}, 14721 year = {2009} 14722} 14723 14724@Misc{ doe-isicles, 14725 key = {ISICLES}, 14726 title = {Ice {S}heet {I}nitiative for {CL}-imate {E}xtreme{S}}, 14727 howpublished = {\url{http://www.csm.ornl.gov/ISICLES/index.html}} 14728} 14729 14730@Article{ safta2011tchem, 14731 title = {TChem-a software toolkit for the analysis of complex kinetic models}, 14732 author = {Safta, Cosmin and Najm, Habib N and Knio, Omar}, 14733 journal = {Sandia Report, SAND2011-3282}, 14734 year = {2011} 14735} 14736 14737@Misc{ chemkin-website, 14738 key = {chemkin}, 14739 title = {ANSYS Chemkin-Pro Website}, 14740 howpublished = {\url{http://www.ansys.com/products/fluids/ansys-chemkin-pro}}, 14741 year = {2017} 14742} 14743 14744@Misc{ mct-website, 14745 key = {MCT}, 14746 title = {{M}odel {C}oupling {T}oolkit ({MCT}) {W}eb {S}ite}, 14747 howpublished = {\url{http://www.mcs.anl.gov/mct}} 14748} 14749 14750@Article{ larson:05, 14751 author = {Jay Larson and Robert Jacob and Everest Ong}, 14752 title = {{The Model Coupling Toolkit}: A New {Fortran90} Toolkit for Building 14753 Multi-Physics Parallel Coupled Models}, 14754 journal = {Int. J. High Perf. Comp. App.}, 14755 year = {2005}, 14756 pages = {277--292} 14757} 14758 14759@Article{ dennis2012computational, 14760 title = {Computational performance of ultra-high-resolution capability in the Community 14761 Earth System Model}, 14762 author = {Dennis, John M and Vertenstein, Mariana and Worley, Patrick H and Mirin, Arthur A 14763 and Craig, Anthony P and Jacob, Robert and Mickelson, Sheri}, 14764 journal = {International Journal of High Performance Computing Applications}, 14765 volume = {26}, 14766 number = {1}, 14767 pages = {5--16}, 14768 year = {2012}, 14769 publisher = {SAGE Publications} 14770} 14771 14772@InProceedings{ bettge01, 14773 author = {T. Bettge and A. Craig and R. James and V. Wayland and G. Strand}, 14774 year = {2001}, 14775 title = {The {DOE} Parallel Climate Model {(PCM)}: The Computational Highway and 14776 Backroads}, 14777 booktitle = {Proc. International Conference on Computational Science (ICCS) 2001}, 14778 editors = {V. N. Alexandrow and J. J. Dongarra and C. J. K. Tan}, 14779 pages = {148 -- 156}, 14780 series = {Lecture Notes in Computer Science}, 14781 volume = {2073}, 14782 publisher = {Springer-Verlag} 14783} 14784 14785@InProceedings{ jacob01, 14786 author = {R. Jacob and C. Schafer and I. Foster and M. Tobis and J. Anderson}, 14787 year = {2001}, 14788 title = {Computational Design and Performance of the {Gast} Ocean Atmosphere Model}, 14789 booktitle = {Proc. International Conference on Computational Science (ICCS) 2001}, 14790 editors = {V. N. Alexandrow and J. J. Dongarra and C. J. K. Tan}, 14791 series = {Lecture Notes in Computer Science}, 14792 volume = {2073}, 14793 publisher = {Springer-Verlag} 14794} 14795 14796@Article{ chen2008new, 14797 title = {New generation of multi-scale {NWP} system {(GRAPES)}: General scientific 14798 design}, 14799 author = {Chen, DeHui and Xue, JiShan and Yang, XueSheng and Zhang, HongLiang and Shen, 14800 XueShun and Hu, JiangLin and Wang, Yu and Ji, LiRen and Chen, JiaBin}, 14801 journal = {Chinese Science Bulletin}, 14802 volume = {53}, 14803 number = {22}, 14804 pages = {3433--3445}, 14805 year = {2008}, 14806 publisher = {Springer} 14807} 14808 14809@InProceedings{ baum01, 14810 author = {J. Baum and H. Luo and E. Mestreau and D. Sharov and R. Loehner and D. Pelessone 14811 and C. Charman}, 14812 year = {2001}, 14813 title = {Recent Developments of a Coupled {CFD/CSD} Methodology}, 14814 booktitle = {Proc. International Conference on Computational Science (ICCS) 2001}, 14815 editors = {V. N. Alexandrow and J. J. Dongarra and C. J. K. Tan}, 14816 series = {Lecture Notes in Computer Science}, 14817 volume = {2073}, 14818 publisher = {Springer-Verlag} 14819} 14820 14821@InProceedings{ lefantzi03, 14822 author = {S. Lefantzi and J. Ray}, 14823 year = {2003}, 14824 title = {A Component-based Scientific Toolkit for Reacting Flows}, 14825 booktitle = {Proc. Second MIT Conference on Computational Fluid and Solid Mechanics}, 14826 volume = {2}, 14827 publisher = {Elsevier} 14828} 14829 14830@Article{ boville98, 14831 author = {B. A. Boville and P. R. Gent}, 14832 title = {The {NCAR} Climate System Model, Version One}, 14833 journal = {Journal of Climate}, 14834 volume = {11}, 14835 year = {1998}, 14836 pages = {1115--1130} 14837} 14838 14839@Misc{ paraschivoiu99, 14840 author = {M. Paraschivoiu and X.-C. Cai and M. Sarkis and D. P. Young and D. Keyes}, 14841 title = {Multi-domain multi-model formulation for compressible flows: Conservative 14842 interface coupling and parallel implicit solvers for {3D} unstructured meshes}, 14843 note = {AIAA Paper 99-0784}, 14844 year = {1999} 14845} 14846 14847@Article{ peszynska, 14848 author = {M. Peszynska and M. F. Wheeler and I. Yotov}, 14849 title = {Mortar upscaling for multiphysics flow in porous media}, 14850 journal = {Computational Geosciences} 14851} 14852 14853@TechReport{ wheeler00, 14854 author = {M. F. Wheeler and J. Wheeler and M. Peszynska}, 14855 title = {A distributed computing portal for coupling multi-physics and multiple domains in 14856 porous media}, 14857 institution = {University of Texas at Austin}, 14858 number = {TICAM 00-03}, 14859 year = {2000} 14860} 14861 14862@TechReport{ peszynska00, 14863 author = {M. Peszynska and Q. Lu and M. F. Wheeler}, 14864 title = {Multiphysics Coupling of Codes}, 14865 institution = {University of Texas at Austin}, 14866 number = {TICAM 00-02}, 14867 year = {2000} 14868} 14869 14870@Article{ joshaghanijoodatnakshatrala2019, 14871 title = {A stabilized mixed discontinuous Galerkin formulation for double 14872 porosity/permeability model}, 14873 author = {MS Joshaghani and SHS Joodat and KB Nakshatrala}, 14874 journal = {Computer Methods in Applied Mechanics and Engineering}, 14875 volume = {352}, 14876 pages = {508--560}, 14877 year = {2019} 14878} 14879 14880@InProceedings{ cai99, 14881 author = {X.-C. Cai and M. Paraschivoiu and M. Sarkis}, 14882 title = {An explicit multi-model compressible flow formulation based on the full potential 14883 equation and the {Euler} equations on {3D} unstructured meshes}, 14884 booktitle = {Proceedings of the 11th International Conference on Domain Decomposition 14885 Methods}, 14886 editor = {C-H. Lai and P. Bjorstad and M. Cross and O. Widlund}, 14887 year = {1999} 14888} 14889 14890@Article{ he05, 14891 author = {Yun He and Chris H. Q. Ding}, 14892 title = {Coupling Multi-Component Models with {MPH} on Distributed Memory Computer 14893 Architectures}, 14894 year = {2005}, 14895 volume = {19}, 14896 pages = {329--240}, 14897 number = {3}, 14898 journal = {Int. Journal of High Performance Computing Applications} 14899} 14900 14901@InProceedings{ uiuc-rocket-center02, 14902 author = {W. A. Dick and M. T. Heath}, 14903 title = {Whole System Simulation of Solid Propellant Rockets}, 14904 booktitle = {Proceedings of the AIAA Joint Propulsion Conference, AIAA2002-4345}, 14905 month = jul, 14906 year = {2002} 14907} 14908 14909@InProceedings{ toth04, 14910 author = {G. Toth and O. Volberg and A. J. Ridley and T. I Gombosi and D. DeZeeuw and K. W. 14911 Hansen and D. R. Chesney and Q. F. Stout and K. G. Powell and K. Kane and R. 14912 Oehmke}, 14913 title = {A Physics-Based Software Framework for Sun-Earth Connection Modeling}, 14914 editor = {A. T. Y. Lui and Y. Kamide and G. Consolini}, 14915 booktitle = {Multiscale Coupling of Sun-Earth Processes, Proceedings of the Conference on the 14916 Sun-Earth Connection}, 14917 year = {2004}, 14918 publisher = {Elsevier}, 14919 pages = {383--397} 14920} 14921 14922@Misc{ csdrm:web, 14923 author = {M. Aivazis and B. Goddard and D. Meiron and M. Ortiz and J. Pool and J. 14924 Shepherd}, 14925 title = {{Center for Simulation of Dynamic Response of Materials}}, 14926 note = {California Institute of Technology, see \url{http://csdrm.caltech.edu}} 14927} 14928 14929@Misc{ csar:web, 14930 author = {M. {Heath (Director)}}, 14931 title = {{Center for Simulation of Advanced Rockets}}, 14932 note = {University of Illinois at Urbana-Champaign, see \url{http://www.csar.uiuc.edu}} 14933} 14934 14935@Misc{ csafe:web, 14936 author = {D. {Pershing (Director)}}, 14937 title = {{Center for Simulation of Accidental Fires and Explosions}}, 14938 note = {University of Utah, see \url{http://www.csafe.utah.edu}} 14939} 14940 14941@Misc{ cits:web, 14942 author = {P. {Moin (Director)}}, 14943 title = {{Center for Integrated Turbulence Simulations}}, 14944 note = {Stanford University, see \url{http://www.stanford.edu/group/cits}} 14945} 14946 14947@Misc{ flash:web, 14948 author = {D. {Lamb (Director)}}, 14949 title = {{Center for Integrated Turbulence Simulations}}, 14950 note = {University of Chicago, see \url{http://flash.uchicago.edu}} 14951} 14952 14953@TechReport{ utah-csafe03, 14954 author = {J. Guilkey and T. Harman and A. Xia and B. Kashiwa and P. McMurtry}, 14955 title = {An Eulerian-Lagrangian Approach for Large Deformation Fluid Structure Interaction 14956 Problems, Part 1: Algorithm Development}, 14957 institution = {University of Utah, Center for the Simulation of Accidental Fires and 14958 Explosions}, 14959 year = {2003} 14960} 14961 14962@InBook{ shepherd07, 14963 author = {M. Shepherd and E. Seol and B. FrantzDale}, 14964 title = {Toward a Multi-Model Hierarchy to Support Multiscale Simulations}, 14965 year = {2007}, 14966 booktitle = {CRC Handbook of Dynamic System Modeling}, 14967 publisher = {Wiley}, 14968 pages = {1--41}, 14969 note = {also available as SCOREC Report 2007-2, Rensselaer Polytechnic Institute} 14970} 14971 14972@InProceedings{ cactus02, 14973 author = {Tom Goodale and Gabrielle Allen and Gerd Lanfermann and Joan Masso and Thomas 14974 Radke and Edward Seidel and John Shalf}, 14975 title = {The {Cactus} Framework and Toolkit: Design and Applications}, 14976 booktitle = {VECPAR'2002, 5th International Conference, Lecture Notes in Computer Science}, 14977 year = {2002}, 14978 url = {http://www.cactuscode.org/Papers/VecPar_2002.pdf} 14979} 14980 14981@Misc{ cactus:homepage, 14982 author = {G. {Allen et al.}}, 14983 title = {{Cactus Web page}}, 14984 howpublished = {\url{http://cactuscode.org}} 14985} 14986 14987@Misc{ open-grid-forum:web, 14988 key = {{Open Grid Forum}}, 14989 title = {{Open Grid Forum}}, 14990 note = {See \url{http://www.ogf.org}} 14991} 14992 14993@Misc{ nox:web, 14994 author = {Tamara Kolda and Roger {Pawlowski et al.}}, 14995 title = {Nonlinear Object-Oriented Solutions {(NOX)}}, 14996 note = {See \url{http://software.sandia.gov/nox}} 14997} 14998 14999@Misc{ chombo:web, 15000 author = {P. {Colella (PI)}}, 15001 title = {{Chombo}}, 15002 note = {See \url{http://seesar.lbl.gov/anag/chombo}} 15003} 15004 15005@Article{ lanzkron96, 15006 author = {P. J. Lanzkron and D. J. Rose and J. T. Wilkes}, 15007 title = {An Analysis of Approximate Nonlinear Elimination}, 15008 journal = {SIAM J. Sci. Comput.}, 15009 volume = {17}, 15010 year = {1996}, 15011 pages = {538--559} 15012} 15013 15014@Article{ jiang95, 15015 author = {J. Jiang and P. Forsyth}, 15016 title = {Robust Linear and Nonlinear Strategies for Solution of the Transonic {Euler} 15017 Equations}, 15018 journal = {Computers and Fluids}, 15019 volume = {24}, 15020 pages = {753--770}, 15021 year = {1995} 15022} 15023 15024@Article{ young90, 15025 author = {D. Young and R. Melbin and M. Bieterman and F. Johnson and S. Samant}, 15026 title = {Global Convergence of Inexact {Newton} Methods for Transonic Flow}, 15027 journal = {Int. J. Numer. Methods Fluids}, 15028 volume = {11}, 15029 pages = {1075--1095}, 15030 year = {1990} 15031} 15032 15033@Article{ fishwick04, 15034 author = {Paul A. Fishwick}, 15035 title = {Toward an Integrated Multimodeling Interface: A Human-Computer Interface Approach 15036 to Interrelating Model Structures}, 15037 journal = {SCS Trans. on Simulation}, 15038 note = {Special Issue in Grand Challenges in Computer Simulation}, 15039 year = {2004} 15040} 15041 15042@Article{ fishwick03, 15043 author = {Paul Fishwick and Jinho Lee and Minho Park and Jyunju Shim}, 15044 title = {{RUBE}: A Customized {2D} and {3D} Modeling Framework for Simulation}, 15045 booktitle = {Proceedings of the 2003 Winter Simulation Conference}, 15046 editor = {S. Chick and P. J. Sanchez and D. Ferrin and D. J. Morrice}, 15047 year = {2003} 15048} 15049 15050@InProceedings{ kirner00, 15051 author = {T. G. Kirner and V. F. Martins}, 15052 title = {Development of an Information Visualization Tool Using Virtual Reality}, 15053 booktitle = {Proceedings of the 2000 ACM Symposium on Applied Computing}, 15054 year = {2000}, 15055 pages = {604--606} 15056} 15057 15058@InProceedings{ orso03, 15059 author = {A. Orso and J. Jones and M. J. Harrold}, 15060 title = {Visualization of Program-Execution Data for Deployed Software}, 15061 booktitle = {Proceedings of the 2003 ACM Symposium on Software Visualization}, 15062 year = {2003}, 15063 pages = {67--76} 15064} 15065 15066@Book{ tiller01, 15067 author = {M. Tiller}, 15068 title = {Introduction to Physical System Modeling with Modelica}, 15069 series = {Kluwer International Series inEngineering and Computer Science}, 15070 volume = {615}, 15071 publisher = {Kluwer}, 15072 year = {2001} 15073} 15074 15075@Article{ buck94, 15076 author = {J. Buck and S. Ha and E. Lee and D. Messerschmitt}, 15077 title = {Ptolemy: A Framework for Simulating and Prototyping Heterogeneous Systems}, 15078 journal = {Int. Journal of Computer Simulation}, 15079 volume = {4}, 15080 pages = {155--182}, 15081 year = {1994} 15082} 15083 15084@Article{ mu95, 15085 author = {M. Mu and J.R. Rice}, 15086 title = {Modeling with collaborating {PDE} solvers - Theory and practice}, 15087 journal = {Comp. Syst. Engr.}, 15088 volume = {6}, 15089 year = {1995}, 15090 pages = {87--95} 15091} 15092 15093@TechReport{ drashansky96, 15094 title = {Multidisciplinary Problem Solving using Agents in a Cluster Environment}, 15095 author = {R. Drashansky and A. Joshi and J. R. Rice}, 15096 institution = {Emory Universtity, Department of Mathematics and Computer Science}, 15097 year = {1996} 15098} 15099 15100@Article{ michopoulos05, 15101 title = {Survey on Modeling and Simulation of Multiphysics Systems}, 15102 author = {John G. Michopoulos and Charbel Farhat and Jacob Fish}, 15103 journal = {Journal of Computing and Information Science in Engineering}, 15104 volume = {5}, 15105 issue = {3}, 15106 pages = {198--213}, 15107 year = {2005} 15108} 15109 15110@Article{ dubey09, 15111 title = {Extensibe Component-Based Architecture for {FLASH}, a Massively Parallel 15112 Multiphysics Simulation Code}, 15113 author = {A. Dubey and K. Antypass and M. Ganapathy and L. Reid and D. Sheeler and A. 15114 Siegel and K. Weide}, 15115 journal = {Parallel Computing}, 15116 volume = {35}, 15117 issue = {10 -- 11}, 15118 pages = {512 -- 522}, 15119 year = {2009} 15120} 15121 15122@Book{ bottloring95, 15123 author = {Raoul Bott and Loring W. Tu}, 15124 title = {Differential Forms in Algebraic Topology}, 15125 publisher = {Springer}, 15126 year = {1995} 15127} 15128 15129@Book{ kobayashinomizu96, 15130 author = {Shoshichi Kobayashi and Katsumi Nomizu}, 15131 title = {Foundations of Differential Geometry}, 15132 publisher = {Wiley-Interscience}, 15133 year = {1996} 15134} 15135 15136@Article{ hornungkohn02, 15137 author = {Richard D. Hornung and Scott R. Kohn}, 15138 title = {Managing Application Complexity in the SAMRAI Object-Oriented Framework}, 15139 journal = {Concurrency and Computation: Practice and Experience}, 15140 volume = {14}, 15141 pages = {347--368}, 15142 year = {2002} 15143} 15144 15145@InProceedings{ concepts06, 15146 author = {Douglas Gregor and Jaakko J{\"a}rvi and Jeremy Siek and Bjarne Stroustrup and 15147 Gabriel Dos Reis and Andrew Lumsdaine}, 15148 title = {Concepts: Linguistic Support for Generic Programming in C++}, 15149 booktitle = {Proceedings of OOPSLA 2006}, 15150 year = {2006}, 15151 pages = {???--???} 15152} 15153 15154@Book{ hatcher02, 15155 author = {Hatcher, Allen}, 15156 title = {Algebraic Topology}, 15157 publisher = {Cambridge University Press}, 15158 year = {2002} 15159} 15160 15161@Book{ gammahelmjohnsonvlissides95, 15162 abstract = {{Design Patterns is a modern classic in the literature of object-oriented 15163 development, offering timeless and elegant solutions to common problems in 15164 software design. It describes patterns for managing object creation, composing 15165 objects into larger structures, and coordinating control flow between objects. The 15166 book provides numerous examples where using composition rather than inheritance 15167 can improve the reusability and flexibility of code. Note, though, that it's not a 15168 tutorial but a catalog that you can use to find an object-oriented design pattern 15169 that's appropriate for the needs of your particular application--a selection for 15170 virtuoso programmers who appreciate (or require) consistent, well-engineered 15171 object-oriented designs.} {Now on CD, this internationally acclaimed bestseller is 15172 more valuable than ever! 15173 15174 Use the contents of the CD to create your own design documents and reusable 15175 components. The CD contains: 23 patterns you can cut and paste into your own 15176 design documents; sample code demonstrating pattern implementation; complete 15177 Design Patterns content in standard HTML format, with numerous hyperlinked 15178 cross-references; accessed through a standard web browser; Java-based dynamic 15179 search mechanism, enhancing online search capabilities; graphical user environment, 15180 allowing ease of navigation. 15181 15182 First published in 1995, this landmark work on object-oriented software design 15183 presents a catalog of simple and succinct solutions to common design problems. 15184 Created by four experienced designers, the 23 patterns contained herein have 15185 become an essential resource for anyone developing reusable object-oriented 15186 software. In response to reader demand, the complete text and pattern catalog are 15187 now available on CD-ROM. This electronic version of Design Patterns enables 15188 programmers to install the book directly onto a computer or network for use as an 15189 online reference for creating reusable object-oriented software. 15190 15191 The authors first describe what patterns are and how they can help you in the 15192 design process. They then systematically name, explain, evaluate, and catalog 15193 recurring designs in object-oriented systems. All patterns are compiled from 15194 real-world examples and include code that demonstrates how they may be implemented 15195 in object-oriented programming languages such as C++ and Smalltalk. Readers who 15196 already own the book will want the CD to take advantage of its dynamic search 15197 mechanism and ready-to-install patterns.}}, 15198 author = {Gamma, Erich and Helm, Richard and Johnson, Ralph and Vlissides, John}, 15199 citeulike-article-id={115158}, 15200 howpublished = {Hardcover}, 15201 isbn = {0201633612}, 15202 keywords = {1995 algorithms architecture book books computer computing design design-pattern 15203 design-patterns design_patterns designpatterns development diplom entwurfsmuster 15204 four gang gof java mathgamespatterns no-tag object object-orientation 15205 object-oriented of oo-patterns oop oriented pattern patterns programming se 15206 software software-development software-engineering software_design 15207 softwareengineering standard}, 15208 month = jan, 15209 publisher = {{Addison-Wesley Professional}}, 15210 title = {Design Patterns}, 15211 url = {http://www.amazon.ca/exec/obidos/redirect?tag=citeulike04-20{\&}path=ASIN/0201633612}, 15212 year = {1995} 15213} 15214 15215@InProceedings{ chaco95, 15216 author = {Bruce Hendrickson and Robert Leland}, 15217 title = {A multilevel algorithm for partitioning graphs}, 15218 booktitle = {Supercomputing '95: Proceedings of the 1995 ACM/IEEE Conference on Supercomputing 15219 (CDROM)}, 15220 year = {1995}, 15221 isbn = {0-89791-816-9}, 15222 pages = {28}, 15223 location = {San Diego, California, United States}, 15224 doi = {10.1145/224170.224228}, 15225 publisher = {ACM Press}, 15226 address = {New York} 15227} 15228 15229@Book{ aleksandrov98, 15230 author = {Aleksandrov, Pavel S.}, 15231 title = {Combinatorial Topology}, 15232 publisher = {Dover}, 15233 volume = {3}, 15234 year = {1998} 15235} 15236 15237@Book{ steenrod99, 15238 abstract = {{ Fibre bundles, now an integral part of differential geometry, are also of great 15239 importance in modern physics--such as in gauge theory. This book, a succinct 15240 introduction to the subject by renown mathematician Norman Steenrod, was the first 15241 to present the subject systematically. 15242 15243 It begins with a general introduction to bundles, including such topics as 15244 differentiable manifolds and covering spaces. The author then provides brief 15245 surveys of advanced topics, such as homotopy theory and cohomology theory, before 15246 using them to study further properties of fibre bundles. The result is a classic 15247 and timeless work of great utility that will appeal to serious mathematicians and 15248 theoretical physicists alike. }}, 15249 author = {Steenrod, Norman}, 15250 citeulike-article-id={712999}, 15251 howpublished = {Paperback}, 15252 isbn = {0691005486}, 15253 keywords = {fibre_bundles topology}, 15254 month = apr, 15255 publisher = {{Princeton University Press}}, 15256 title = {The Topology of Fibre Bundles. (PMS-14)}, 15257 url = {http://www.amazon.ca/exec/obidos/redirect?tag=citeulike04-20{\&}path=ASIN/0691005486}, 15258 year = {1999} 15259} 15260 15261@Book{ bredon97, 15262 author = {Bredon, Glen E.}, 15263 title = {Sheaf Theory}, 15264 publisher = {Springer}, 15265 pages = {524}, 15266 series = {Graduate Texts in Mathematics}, 15267 year = {1997} 15268} 15269 15270@TechReport{ tautgesmeyers04, 15271 title = {{MOAB}: A Mesh-Oriented Database}, 15272 author = {Timothy J. Tautges and Ray Meyers and Karl Merkley and Clint Stimpson and Corey 15273 Ernst}, 15274 institution = {Sandia National Laboratories}, 15275 number = {SAND2004-1592}, 15276 month = apr, 15277 year = {2004} 15278} 15279 15280@Article{ tautges04, 15281 author = {Timothy J. Tautges}, 15282 title = {{MOAB}-{SD}: Integrated Structured and Unstructured Mesh Representation}, 15283 journal = {Engineering With Computers}, 15284 volume = {20}, 15285 pages = {286--293}, 15286 year = {2004} 15287} 15288 15289@InProceedings{ meyers02, 15290 author = {Ray Meyers et. al}, 15291 title = {{SNL} Implementation of the {TSTT} Mesh Interface}, 15292 booktitle = {8th International conference on numerical grid generation in computational field 15293 simulations}, 15294 month = jun, 15295 year = {2002} 15296} 15297 15298@InProceedings{ seolshepard05, 15299 author = {E. S. Seol and Mark S. Shephard}, 15300 title = {A Flexible Distributed Mesh Data Structure to Support Parallel Adaptive 15301 Analysis}, 15302 booktitle = {Proceedings of the 8th US National Congress on Computational Mechanics}, 15303 year = {2005} 15304} 15305 15306@Article{ beallwalshshephard04, 15307 author = {Mark W. Beall and Joe Walsh and Mark S. Shephard}, 15308 title = {A comparison of techniques for geometry access related to mesh generation}, 15309 journal = {Engineering With Computers}, 15310 volume = {20}, 15311 number = {3}, 15312 pages = {210--221}, 15313 year = {2004} 15314} 15315 15316@Article{ careyandersoncarneskirk04, 15317 author = {Graham F. Carey and Michael L. Anderson and Brian R. Carnes and Benjamin S. 15318 Kirk}, 15319 title = {Some aspects of adaptive grid technology related to boundary and interior 15320 layers}, 15321 journal = {Journal of Computational Applied Mathematics}, 15322 volume = {166}, 15323 number = {1}, 15324 pages = {55--86}, 15325 year = {2004} 15326} 15327 15328@PhDThesis{ gralthesis, 15329 author = {Guntram Berti}, 15330 title = {Generic Software Components for Scientific Computing}, 15331 school = {TU Cottbus}, 15332 year = {2000}, 15333 note = {\url{http://www.math.tu-cottbus.de/~berti/diss}} 15334} 15335 15336@Article{ whitehead1949, 15337 title = {Combinatorial homotopy. I}, 15338 author = {John HC Whitehead}, 15339 journal = {Bulletin of the American Mathematical Society}, 15340 volume = {55}, 15341 number = {3. P1}, 15342 pages = {213--245}, 15343 year = {1949}, 15344 publisher = {American Mathematical Society} 15345} 15346 15347@Article{ beylkincoifmanrokhlin91, 15348 author = {Gregory Beylkin and Ronald Coifman and Vladimir Rokhlin}, 15349 title = {Fast Wavelet Transforms and Numerical Algorithms {I}}, 15350 journal = {Communications on Pure and Applied Mathematics}, 15351 volume = {44}, 15352 pages = {141--183}, 15353 year = {1991} 15354} 15355 15356@Book{ wesseling92, 15357 author = {Pieter Wesseling}, 15358 title = {An Introduction to Multigrid Methods}, 15359 publisher = {John Wiley and Sons}, 15360 year = {1992} 15361} 15362 15363@Book{ grakakos04, 15364 author = {Loukas Grakakos}, 15365 title = {Classical and Modern Fourier Analysis}, 15366 publisher = {Pearson Education}, 15367 address = {New Jersey}, 15368 year = {2004} 15369} 15370 15371@Misc{ hlib-web-page, 15372 key = {HLib}, 15373 title = {{HLib} {Web} page}, 15374 note = {{\texttt{http://www.hlib.org/}}}, 15375 annote = {Hierarchical matrices for fast integral transform} 15376} 15377 15378@Article{ hackbusch99, 15379 author = {Wolfgang Hackbusch}, 15380 title = {A sparse matrix arithmetic based on {$\mathcal H$}-matrices. Part {I}: 15381 Introduction to {$\mathcal H$}-matrices}, 15382 journal = {Computing}, 15383 volume = {62}, 15384 pages = {89--108}, 15385 year = {1999} 15386} 15387 15388@TechReport{ kay1999green, 15389 title = {A {G}reen's function preconditioner for the steady-state {N}avier-{S}tokes 15390 equations}, 15391 author = {Kay, D. and Loghin, D.}, 15392 year = {1999}, 15393 institution = {Oxford University Computing Laboratory}, 15394 number = {99/06} 15395} 15396 15397@Article{ bebendorf2003existence, 15398 title = {Existence of {$\mathcal H$}-matrix approximants to the inverse {FE}-matrix of 15399 elliptic operators with {$L^\infty$}-coefficients}, 15400 author = {Bebendorf, M. and Hackbusch, W.}, 15401 journal = {Numerische Mathematik}, 15402 volume = {95}, 15403 number = {1}, 15404 pages = {1--28}, 15405 year = {2003}, 15406 publisher = {Springer} 15407} 15408 15409@Article{ hackbusch2005direct, 15410 title = {Direct {S}chur complement method by domain decomposition based on {$\mathcal 15411 H$}-matrix approximation}, 15412 author = {Hackbusch, W. and Khoromskij, B.N. and Kriemann, R.}, 15413 journal = {Computing and Visualization in Science}, 15414 volume = {8}, 15415 number = {3}, 15416 pages = {179--188}, 15417 year = {2005}, 15418 publisher = {Springer} 15419} 15420 15421@TechReport{ duphof2003, 15422 author = {T. Dupont and J. Hoffman and C. Johnson and R. C. Kirby and M. G. Larson and A. 15423 Logg and L. R. Scott}, 15424 title = {The {FE}ni{CS} project}, 15425 institution = {Chalmers Finite Element Center Preprint Series}, 15426 number = {2003--21}, 15427 year = {2003} 15428} 15429 15430@Article{ flame01, 15431 author = {John A. Gunnels and Fred G. Gustavson and Greg M. Henry and Robert A. van de 15432 Geijn}, 15433 title = {{FLAME}: Formal Linear Algebra Methods Environment}, 15434 journal = {Transactions on Mathematical Software}, 15435 volume = {27}, 15436 number = {4}, 15437 year = {2001}, 15438 pages = {422--455} 15439} 15440 15441@Article{ puschel05, 15442 author = {Markus P{\"u}schel and Jos{\'e} M. F. Moura and Jeremy Johnson and David Padua 15443 and Manuela Veloso and Bryan W. Singer and Jianxin Xiong and Franz Franchetti and 15444 Aca Ga\v{c}i\'{c} and Yevgen Voronenko and Kang Chen and Robert W. Johnson and 15445 Nick Rizzolo}, 15446 title = {{SPIRAL}: Code Generation for {DSP} Transforms}, 15447 journal = {Proceedings of the IEEE}, 15448 volume = {93}, 15449 number = {2}, 15450 year = {2005}, 15451 note = {special issue on "Program Generation, Optimization, and Adaptation"} 15452} 15453 15454@Article{ kirbylogg06, 15455 author = {Robert C. Kirby and Anders Logg}, 15456 title = {A compiler for variational forms}, 15457 journal = {ACM Transactions on Mathematical Software}, 15458 volume = {32}, 15459 number = {3}, 15460 year = {2006}, 15461 issn = {0098-3500}, 15462 pages = {417--444}, 15463 doi = {10.1145/1163641.1163644}, 15464 publisher = {ACM Press}, 15465 address = {New York, NY} 15466} 15467 15468@Article{ kirbylogg07, 15469 author = {Robert C. Kirby and Anders Logg}, 15470 title = {Efficient compilation of a class of variational forms}, 15471 journal = {ACM Transactions on Mathematical Software}, 15472 volume = {33}, 15473 number = {3}, 15474 year = {2007}, 15475 issn = {0098-3500}, 15476 pages = {17}, 15477 doi = {10.1145/1268769.1268771}, 15478 publisher = {ACM Press}, 15479 address = {New York, NY} 15480} 15481 15482@Article{ bankdupont81, 15483 author = {Randolph Bank and Todd Dupont}, 15484 title = {An optimal order process for solving finite element equations}, 15485 journal = {Mathematics of Computation}, 15486 volume = {36}, 15487 pages = {35--51}, 15488 year = {1981} 15489} 15490 15491@TechReport{ adams00, 15492 author = {Mark F. Adams}, 15493 title = {Evaluation of three unstructured multigrid methods on 3D finite element problems 15494 in solid mechanics}, 15495 institution = {UC Berkeley}, 15496 number = {CSD-00-1103}, 15497 year = {2000}, 15498 url = {citeseer.ist.psu.edu/article/adams00evaluation.html} 15499} 15500 15501@Article{ bergengradlhuelsemannruede06, 15502 author = {Benjamin Bergen and Tobias Gradl and Frank H\"ulsemann and Ulrich R\"ude}, 15503 title = {A Massively Parallel Multigrid Method for Finite Elements}, 15504 journal = {Computing in Science \& Engineering}, 15505 volume = {8}, 15506 number = {6}, 15507 pages = {56--62}, 15508 year = {2006} 15509} 15510 15511@MastersThesis{ brunethesis08, 15512 author = {Peter R. Brune}, 15513 title = {Enabling Unstructured Multigrid Under the Sieve Framework}, 15514 school = {University of Chicago}, 15515 address = {Chicago, IL}, 15516 year = {2008}, 15517 month = feb 15518} 15519 15520@Article{ arnoldwinther02, 15521 author = {Douglas N. Arnold and Ragnar Winther}, 15522 title = {Mixed finite elements for elasticity}, 15523 journal = {Numerische Mathematik}, 15524 volume = {92}, 15525 number = {3}, 15526 month = sep, 15527 year = {2002}, 15528 pages = {401--419}, 15529 doi = {10.1007/s002110100348} 15530} 15531 15532@Article{ arnoldfalkwinther06, 15533 author = {Douglas N. Arnold and Richard S. Falk and Ragnar Winther}, 15534 title = {Finite element exterior calculus, homological techniques, and applications}, 15535 journal = {Acta Numerica}, 15536 year = {2006}, 15537 volume = {15}, 15538 pages = {1--155}, 15539 publisher = {Cambridge University Press}, 15540 doi = {10.1017/S0962492906210018} 15541} 15542 15543@Article{ kirby04, 15544 author = {Robert C. Kirby}, 15545 title = {Algorithm 839: {FIAT}, a new paradigm for computing finite element basis 15546 functions}, 15547 journal = {ACM Transactions on Mathematical Software}, 15548 volume = {30}, 15549 number = {4}, 15550 year = {2004}, 15551 issn = {0098-3500}, 15552 pages = {502--516}, 15553 doi = {10.1145/1039813.1039820}, 15554 publisher = {ACM Press}, 15555 address = {New York, NY} 15556} 15557 15558@Article{ kirby06, 15559 author = {Robert C. Kirby}, 15560 title = {Optimizing {FIAT} with level 3 {BLAS}}, 15561 journal = {ACM Transactions on Mathematical Software}, 15562 volume = {32}, 15563 number = {2}, 15564 year = {2006}, 15565 issn = {0098-3500}, 15566 pages = {223--235}, 15567 doi = {10.1145/1141885.1141889}, 15568 publisher = {ACM Press}, 15569 address = {New York, NY} 15570} 15571 15572@Misc{ bluecrystal08, 15573 author = {{B}lue {C}rystal Cluster}, 15574 title = {Advanced {C}omputing {R}esearch {C}entre{,} {University of Bristol}}, 15575 year = {2008}, 15576 note = {\url{http://www.acrc.bris.ac.uk/acrc/hpc.htm}} 15577} 15578 15579@Article{ beylkin95, 15580 author = {Gregory Beylkin}, 15581 title = {On the Fast Fourier Transform of Functions With Singularities}, 15582 journal = {Applied and Computational Harmonic Analysis}, 15583 volume = {2}, 15584 pages = {363--381}, 15585 year = {1995} 15586} 15587 15588@InProceedings{ riehl08, 15589 author = {Jonathan Riehl}, 15590 title = {Implementing the MyFEM Embedded Domain-specific Language}, 15591 booktitle = {Proceedings of the Second International Workshop on Domain-specific Program 15592 Development (DSPD'08)}, 15593 address = {Nashville, TN}, 15594 year = {2008} 15595} 15596 15597@Article{ appel85, 15598 author = {Andrew W. Appel}, 15599 date-added = {2008-02-27 12:23:39 +0000}, 15600 date-modified = {2008-02-27 12:24:02 +0000}, 15601 doi = {10.1137/0906008}, 15602 journal = {SIAM Journal on Scientific and Statistical Computing}, 15603 keywords = {treecodes}, 15604 number = {1}, 15605 pages = {85-103}, 15606 publisher = {SIAM}, 15607 title = {An Efficient Program for Many-Body Simulation}, 15608 volume = {6}, 15609 year = {1985} 15610} 15611 15612@Article{ ewald21, 15613 author = {{Ewald}, P.~P.}, 15614 title = {{Die Berechnung optischer und elektrostatischer Gitterpotentiale}}, 15615 journal = {Annalen der Physik}, 15616 year = {1921}, 15617 volume = {369}, 15618 pages = {253-287}, 15619 doi = {10.1002/andp.19213690304}, 15620 adsurl = {http://adsabs.harvard.edu/abs/1921AnP...369..253E}, 15621 adsnote = {Provided by the SAO/NASA Astrophysics Data System} 15622} 15623 15624@Article{ greengardrokhlin87, 15625 author = {L. Greengard and V. Rokhlin}, 15626 date-added = {2008-02-15 18:43:55 +0000}, 15627 date-modified = {2008-02-26 20:09:11 +0000}, 15628 doi = {10.1016/0021-9991(87)90140-9}, 15629 journal = {J. Comput.\ Phys.}, 15630 keywords = {FMM}, 15631 number = {2}, 15632 pages = {325--348}, 15633 title = {A Fast Algorithm for Particle Simulations}, 15634 url = {citeseer.ist.psu.edu/greengard87fast.html}, 15635 volume = {73}, 15636 year = {1987}, 15637 bdsk-url-1 = {citeseer.ist.psu.edu/greengard87fast.html} 15638} 15639 15640@Article{ greengardrokhlin97, 15641 author = {L. Greengard and V. Rokhlin}, 15642 title = {A New Version of the Fast Multipole Method for the Laplace Equation in Three 15643 Dimensions}, 15644 journal = {Acta Numerica}, 15645 volume = {6}, 15646 year = {1997}, 15647 pages = {229--269} 15648} 15649 15650@Article{ luchenghuangmccammon06, 15651 author = {Benzhuo Lu and Xiaolin Cheng and Jingfang Huang and J. Andrew McCammon}, 15652 title = {Order {N} algorithm for computation of electrostatic interactions in biomolecular 15653 systems}, 15654 journal = {PNAS}, 15655 doi = {10.1073/pnas.0605166103}, 15656 volume = {102}, 15657 number = {51}, 15658 year = {2006}, 15659 pages = {19314--19319} 15660} 15661 15662@Article{ schussnadlereisenberg01, 15663 author = {Zev Schuss and Boaz Nadler and Robert S. Eisenberg}, 15664 title = {Derivation of {P}oisson and {N}ernst-{P}lanck equations in a bath and channel 15665 from a molecular model}, 15666 journal = {Physical Review E}, 15667 volume = {64}, 15668 number = {3}, 15669 year = {2001} 15670} 15671 15672@Book{ hairerlubichwanner02, 15673 author = {E. Hairer and Ch. Lubich and G. Wanner}, 15674 title = {Geometric Numerical Integration}, 15675 publisher = {Springer-Verlag}, 15676 address = {Berlin Heidelberg}, 15677 year = {2002} 15678} 15679 15680@Article{ holstbakerwang00, 15681 author = {M. Holst and N. Baker and F. Wang}, 15682 title = {The adaptive multilevel finite element solution of the {P}oisson-{B}oltzmann 15683 equation on massively parallel computers}, 15684 journal = {Journal of Computational Chemistry}, 15685 volume = {21}, 15686 year = {2000} 15687} 15688 15689@Book{ hockneyeastwood81, 15690 author = {R. Hockney and J. Eastwood}, 15691 title = {Computer simulation using particles}, 15692 publisher = {McGraw-Hill}, 15693 address = {New York}, 15694 year = {1981} 15695} 15696 15697@Article{ lutydavistironigunsteren94, 15698 author = {Brock A. Luty and Malcolm E. Davis and Ilario G. Tironi and Wilfred F. Van 15699 Gunsteren}, 15700 title = {A Comparison of {P}article-{P}article, {P}article-{M}esh and {E}wald Methods for 15701 Calculating Electrostatic Interactions in Periodic Molecular Systems}, 15702 journal = {Molecular Simulation}, 15703 volume = {14}, 15704 number = {1}, 15705 year = {1994}, 15706 pages = {11--20} 15707} 15708 15709@Book{ briggshensonmccormick00, 15710 author = {Briggs,, William L. and Henson,, Van Emden and McCormick,, Steve F.}, 15711 title = {A Multigrid Tutorial (2nd ed.)}, 15712 year = {2000}, 15713 isbn = {0-89871-462-1}, 15714 publisher = {Society for Industrial and Applied Mathematics}, 15715 address = {Philadelphia, PA} 15716} 15717 15718@Article{ chartier2003spectral, 15719 title = {Spectral AMGe ($\rho$ AMGe)}, 15720 author = {Chartier, Tim and Falgout, RD and Henson, VE and Jones, J and Manteuffel, T and 15721 McCormick, S and Ruge, J and Vassilevski, PS}, 15722 journal = {SIAM Journal on Scientific Computing}, 15723 volume = {25}, 15724 number = {1}, 15725 pages = {1--26}, 15726 year = {2003}, 15727 publisher = {SIAM} 15728} 15729 15730@Article{ galvis2010domain, 15731 title = {Domain decomposition preconditioners for multiscale flows in high-contrast 15732 media}, 15733 author = {Galvis, Juan and Efendiev, Yalchin}, 15734 journal = {Multiscale Modeling \& Simulation}, 15735 volume = {8}, 15736 number = {4}, 15737 pages = {1461--1483}, 15738 year = {2010}, 15739 publisher = {SIAM} 15740} 15741 15742@Book{ brennerscott02, 15743 author = {Susanne~C. Brenner and L.~Ridgway Scott}, 15744 title = {The mathematical theory of finite element methods}, 15745 year = {2002}, 15746 isbn = {0-38795-451-1}, 15747 publisher = {Springer}, 15748 pages = {361} 15749} 15750 15751@Book{ trefethenbau97, 15752 author = {Lloyd N. Trefethen and David {Bau, III}}, 15753 title = {Numerical Linear Algebra}, 15754 publisher = {Society for Industrial and Applied Mathematics}, 15755 address = {Philadelphia, PA}, 15756 pages = {xii + 361}, 15757 year = {1997}, 15758 isbn = {0-89871-361-7}, 15759 isbn-13 = {978-0-89871-361-9}, 15760 lccn = {QA184 .T74 1997}, 15761 mrclass = {65-01 (65-02 65Fxx)}, 15762 mrnumber = {MR1444820 (98k:65002)}, 15763 mrreviewer = {Moody T. Chu}, 15764 bibdate = {Wed Jan 07 15:23:19 1998}, 15765 bibsource = {ftp://ftp.math.utah.edu/pub/bibnet/authors/t/trefethen-lloyd-n.bib} 15766} 15767 15768@Article{ liptonreagan2014, 15769 title = {Quantum Algorithms via Linear Algebra: A Primer}, 15770 author = {Richard J Lipton and Kenneth W Regan}, 15771 pages = {206}, 15772 isbn = {978-0-26202-839-4}, 15773 year = {2014} 15774} 15775 15776@InProceedings{ rhea08, 15777 author = {Carsten Burstedde and Omar Ghattas and Michael Gurnis and Georg Stadler and Eh 15778 Tan and T.~Tu and Lucas~C. Wilcox and Shijie Zhong}, 15779 title = {Scalable adaptive mantle convection simulation on petascale supercomputers}, 15780 booktitle = {Proceedings of IEEE/ACM SC '08}, 15781 year = {2008} 15782} 15783 15784@Misc{ bursteddewilcox09, 15785 author = {Carsten Burstedde and Lucas~C. Wilcox}, 15786 title = {The p4est library: A parallel scalable forest of adaptive octrees}, 15787 note = {in preparation} 15788} 15789 15790@Article{ skeeltezcanhardy02, 15791 author = {R. D. Skeel and I. Tezcan and D. J. Hardy}, 15792 title = {Multiple Grid Methods for Classical Molecular Dynamics}, 15793 journal = {J. Comp. Chem.}, 15794 volume = {23}, 15795 pages = {673--684}, 15796 year = {2002} 15797} 15798 15799@Article{ verschelde99, 15800 author = {Jan Verschelde}, 15801 title = {Algorithm 795: PHCpack: a general-purpose solver for polynomial systems by 15802 homotopy continuation}, 15803 journal = {ACM Trans. Math. Softw.}, 15804 volume = {25}, 15805 number = {2}, 15806 issn = {0098-3500}, 15807 pages = {251--276}, 15808 doi = {10.1145/317275.317286}, 15809 publisher = {ACM}, 15810 address = {New York, NY}, 15811 year = {1999} 15812} 15813 15814@InProceedings{ sommeseverscheldewampler08, 15815 author = {Andrew J. Sommese and Jan Verschelde and Charles W. Wampler}, 15816 title = {Solving Polynomial Systems Equation by Equation}, 15817 booktitle = {IMA Volume 146: Algorithms in Algebraic Geometry}, 15818 editor = {Alicia Dickenstein and Frank-Olaf Schreyer and Andrew J. Sommese}, 15819 pages = {133--152}, 15820 publisher = {Springer-Verlag}, 15821 year = {2008} 15822} 15823 15824@Article{ phanthientanner77, 15825 author = {N. Phan-Thien and R.~I. Tanner}, 15826 title = {A new constitutive equation derived from network theory}, 15827 journal = {J. Non-Newt. Fluid Mech.}, 15828 volume = {2}, 15829 pages = {353}, 15830 year = {1977} 15831} 15832 15833@Manual{ sage, 15834 key = {SAGE}, 15835 author = {W.\thinspace{}A. Stein and others}, 15836 organization = {The Sage~Development Team}, 15837 title = {{S}age {M}athematics {S}oftware ({V}ersion 3.3)}, 15838 note = {{\tt http://www.sagemath.org}}, 15839 year = {2009} 15840} 15841 15842@Misc{ bateshauensteinsommesewampler06, 15843 author = {Daniel J. Bates and Jonathan D. Hauenstein and Andrew J. Sommese and Charles W. 15844 Wampler}, 15845 title = {{B}ertini: {S}oftware for {N}umerical {A}lgebraic {G}eometry}, 15846 howpublished = {Available at http://www.nd.edu/$\sim$sommese/bertini} 15847} 15848 15849@Article{ archer09, 15850 author = {A. J. Archer}, 15851 collaboration = {}, 15852 title = {Dynamical density functional theory for molecular and colloidal fluids: A 15853 microscopic approach to fluid mechanics}, 15854 publisher = {AIP}, 15855 year = {2009}, 15856 journal = {The Journal of Chemical Physics}, 15857 volume = {130}, 15858 number = {1}, 15859 eid = {014509}, 15860 numpages = {8}, 15861 pages = {014509}, 15862 keywords = {colloids; continuum mechanics; density functional theory; free energy; glass 15863 transition; statistical distributions; stochastic processes}, 15864 doi = {10.1063/1.3054633} 15865} 15866 15867@Article{ giesekus1966, 15868 author = {Hanswalter Giesekus}, 15869 title = {Die Elastizit\"at von Fl\"ussigkeiten}, 15870 journal = {Rheologica Acta}, 15871 publisher = {Springer Berlin / Heidelberg}, 15872 volume = {5}, 15873 number = {1}, 15874 month = mar, 15875 year = {1966}, 15876 doi = {10.1007/BF01973575}, 15877 pages = {29-35} 15878} 15879 15880@Article{ baaijens98, 15881 author = {F.P. Baaijens}, 15882 title = {Mixed finite element methods for viscoelastic flow analysis: a review}, 15883 journal = {Journal of Non-Newtonian Fluid Mechanics}, 15884 volume = {79}, 15885 year = {1998}, 15886 pages = {361--385} 15887} 15888 15889@Book{ joseph90, 15890 author = {D.~D. Joseph}, 15891 title = {Fluid Dynamics of Viscoelastic Liquids}, 15892 publisher = {Springer}, 15893 address = {New York, NY}, 15894 year = {1990} 15895} 15896 15897@Article{ oldroyd50, 15898 author = {J.~G. Oldroyd}, 15899 title = {On the Formulation of Rheological Equations of State}, 15900 journal = {Proceedings of the Royal Society of London. Series A, Mathematical and Physical 15901 Sciences}, 15902 volume = {200}, 15903 year = {1950}, 15904 pages = {523--541} 15905} 15906 15907@InProceedings{ bynasungroppthakur04, 15908 author = {S. Byna and X.-H. Sun and W. Gropp and R. Thakur}, 15909 title = {Predicting Memory-Access Cost Based on Data-Access Patterns}, 15910 booktitle = {Proceedings of IEEE International Conference on Cluster Computing, San Diego}, 15911 year = {2004} 15912} 15913 15914@Book{ pozrikidis07, 15915 author = {C. Pozrikidis}, 15916 title = {Fluid Dynamics: Theory, Computation, and Numerical Simulation}, 15917 publisher = {Kluwer (Springer)}, 15918 pages = {675}, 15919 year = {2001}, 15920 isbn = {0792373510} 15921} 15922 15923@Misc{ kritzkeyesfsp07, 15924 author = {A. Kritz and D. Keyes}, 15925 title = {{Fusion Simulation Project Workshop Report}}, 15926 month = jul, 15927 year = {2007}, 15928 note = {Available via 15929 \url{http://www.sc.doe.gov/ofes/More_HTML/FESAC/FESAC07/FSP_report_070702d.pdf}} 15930} 15931 15932@Misc{ dahlburg02, 15933 author = {J. {Dahlburg (Chair)}}, 15934 title = {{Final Report of the FESAC ISOFS SubCommittee}}, 15935 year = {2002}, 15936 note = {Available via 15937 \url{http://www.ofes.fusion.doe.gov/More_HTML/FESAC/FESAC11-02/Dahlburg.pdf}} 15938} 15939 15940@Misc{ brown08, 15941 author = {D. {Brown (Chair)}}, 15942 title = {{Applied Mathematics at the U.S. Department of Energy: Past, Present, and a View 15943 to the Future}}, 15944 year = {2008}, 15945 howpublished = {Office of Science, U.S. Department of Energy}, 15946 url = {http://science.energy.gov/~/media/ascr/pdf/program-documents/docs/Brown_report_may_08.pdf} 15947} 15948 15949@Misc{ crosscutting10, 15950 author = {D. Brown and P. {Messina (Chairs)}}, 15951 title = {{Scientific Grand Challenges: Crosscutting Technologies for Computing at the 15952 Exascale}}, 15953 year = {2010}, 15954 howpublished = {Office of Science, U.S. Department of Energy}, 15955 url = {http://extremecomputing.labworks.org/SumReps/Crosscutting-SumRep-PNNL_20168.pdf} 15956} 15957 15958@Misc{ extreme-scale-solvers-workshop12, 15959 author = {J. Ang and K. Evans and A. Geist and M. Heroux and P. Hovland and O. Marques and 15960 L.C. McInnes and E. Ng and S. Wild}, 15961 title = {Report on the Workshop on Extreme-Scale Solvers: Transitions to Future 15962 Architectures}, 15963 howpublished = {Office of Advanced Scientific Computing Research, U.S. Department of Energy}, 15964 note = {{Washington, DC}, March 8-9, 2012}, 15965 url = {http://science.energy.gov/~/media/ascr/pdf/program-documents/docs/reportExtremeScaleSolvers2012.pdf}, 15966 year = {2012} 15967} 15968 15969@Misc{ monizrosner09, 15970 author = {{E. Moniz and R. Rosner}}, 15971 title = {{Workshop on Science Based Nuclear Energy Systems Enabled by Advanced Modeling 15972 and Simulation at the Extreme Scale}}, 15973 month = may, 15974 year = {2009}, 15975 note = {See 15976 \url{http://extremecomputing.labworks.org/crosscut/references/nuclearenergy10exascael.pdf}} 15977} 15978 15979@Misc{ blanford08, 15980 author = {{R. Blandord (Chair)}}, 15981 title = {{Workshop on Challenges for Understanding the Quantum Universe and the Role of 15982 Computing at the Extreme Scale}}, 15983 month = dec, 15984 year = {2008}, 15985 note = {See 15986 \url{http://extremecomputing.labworks.org/crosscut/references/HEPreport10exascale.pdf}} 15987} 15988 15989@Misc{ exascale07, 15990 author = {H. Simon and T. Zacharia and R. Stevens}, 15991 title = {{Modeling and Simulation at the Exascale for Energy and the Environment}}, 15992 year = {2007}, 15993 note = {See \url{http://www.sc.doe.gov/ascr/ProgramDocuments/Docs/TownHall.pdf}} 15994} 15995 15996@Misc{ ascrbreakthroughs08, 15997 author = {{Panel on Recent Significant Advancements in Computational Science}}, 15998 title = {Breakthroughs}, 15999 year = {2008}, 16000 note = {See 16001 \url{http://www.er.doe.gov/ASCR/ProgramDocuments/Docs/Breakthroughs_2008.pdf}} 16002} 16003 16004@Misc{ petsc-rd100-2009, 16005 author = {{R\&D Magazine}}, 16006 title = {{PETSc} {R}\&{D} 100 Award}, 16007 year = {2009}, 16008 note = {See 16009 \url{http://www.rdmag.com/Awards/RD-100-Awards/2009/07/PETSc-Release-3-0-Expands-Capabilities}} 16010} 16011 16012@Article{ compass-scidac08, 16013 author = {P. Spentzouris and J. Cary and L. C. McInnes and W. Mori and C. Ng and E. Ng and 16014 R. Ryne}, 16015 title = {Community Petascale Project for Accelerator Science and Simulation: Advancing 16016 Computational Science for Future Accelerators and Accelerator Technologies}, 16017 journal = {J. Phys.: Conf. Ser.}, 16018 volume = {125}, 16019 year = {2008}, 16020 pages = {012001}, 16021 url = {http://iopscience.iop.org/1742-6596/125/1/012001} 16022} 16023 16024@Article{ compass-amundson-scidac08, 16025 title = {Multiscale, Multiphysics Beam Dynamics Framework Design and Applications}, 16026 author = {J. Amundson and D. Dechow and L. McInnes and B. Norris and P. Spentzouris and P. 16027 Stoltz}, 16028 journal = {J. Phys.: Conf. Ser.}, 16029 volume = {125}, 16030 year = {2008} 16031} 16032 16033@InProceedings{ muszala09, 16034 title = {Two-tiered Component Design and Performance Analysis of {Synergia2} Accelerator 16035 Simulations}, 16036 author = {S. Muszala and J. Amundson and L. C. McInnes and B. Norris}, 16037 booktitle = {Proceedings of the 2009 Workshop on Component-Based High Performance Computing 16038 {(CBHPC 2009)}}, 16039 year = {2009} 16040} 16041 16042@Article{ gaston09, 16043 title = {{MOOSE}: A Parallel Computational Framework for Coupled Systems of Nonlinear 16044 Equations}, 16045 author = {Derek Gaston and Chris Newman and Glen Hansen and Damien Lebrun-Grandie}, 16046 journal = {Nuclear Engineering and Design}, 16047 volume = {239}, 16048 number = {10}, 16049 year = {2009}, 16050 pages = {1768 -- 1778} 16051} 16052 16053@Article{ gaston09b, 16054 title = {Parallel Multiphysics Algorithms and Software for Computational Nuclear 16055 Engineering}, 16056 author = {D. Gaston and G. Hansen and S. Kadioglu and D. Knoll and C. Newman and H. Park 16057 and C. Permann and W. Taitano}, 16058 journal = {J. Phys.: Conf. Ser.}, 16059 volume = {180}, 16060 year = {2009}, 16061 pages = {012012} 16062} 16063 16064@Article{ newman09, 16065 title = {Three Dimensional Coupled Simulation of Thermomechanics, Heat, and Oxygen 16066 Diffusion in {UO$_2$} Nuclear Fuel Rods}, 16067 author = {Chris Newman and Glen Hansen and Derek Gaston}, 16068 journal = {Journal of Nuclear Materials}, 16069 volume = {392}, 16070 issue = {1}, 16071 year = {2009}, 16072 pages = {6 -- 15} 16073} 16074 16075@Misc{ www:fenics, 16076 author = {{FE}ni{CS}}, 16077 title = {{FE}ni{CS} Project}, 16078 howpublished = {\url{http://www.fenics.org/}}, 16079 year = {2018} 16080} 16081 16082@InProceedings{ zwart08, 16083 title = {A Multiphysics and Multiscale Software Environment for Modeling Astrophysical 16084 Systems}, 16085 author = {S. Zwart and S. McMillan and B. Nuallain and D. Heggie and J. Lombarsi and P. Hut 16086 and S. Banerjee and H. Belkus and T. Fragos and J. Fregeau and M. Fuji and E. 16087 Gaburov and E. Glebbeek and D. Groen and S. Harfst and R. Izzard and J. Juric and 16088 S. Justham and P. Teuben and J. van Bever and O. Yaron and M. Zemp}, 16089 booktitle = {Proceedings of ICCS 2008}, 16090 year = {2008} 16091} 16092 16093@Article{ klocknerwarburtonbridgehesthaven09, 16094 author = {Kl\"{o}ckner, A. and Warburton, T. and Bridge, J. and Hesthaven, J. S.}, 16095 title = {Nodal discontinuous {G}alerkin methods on graphics processors}, 16096 journal = {J. Comput. Phys.}, 16097 volume = {228}, 16098 number = {21}, 16099 year = {2009}, 16100 issn = {0021-9991}, 16101 pages = {7863--7882}, 16102 doi = {10.1016/j.jcp.2009.06.041}, 16103 publisher = {Academic Press Professional}, 16104 address = {San Diego, CA} 16105} 16106 16107@PhDThesis{ rankin99, 16108 author = {Rankin, W. T.}, 16109 keywords = {FMM, parallel FMM}, 16110 school = {Department of Electrical and Computer Engineering, Duke University}, 16111 title = {Efficient parallel implementations of multipole-based {$N$}-body algorithms}, 16112 year = {1999} 16113} 16114 16115@InProceedings{ warrensalmon93, 16116 abstract = {We report on an efficient adaptive N-body method which we have recently designed 16117 and implemented. The algorithm computes the forces on an arbitrary distribution of 16118 bodies in a time which scales as N log N with the particle number. The accuracy of 16119 the force calculations is analytically bounded, and can be adjusted via a user 16120 defined parameter between a few percent relative accuracy, down to machine 16121 arithmetic accuracy. Instead of using pointers to indicate the topology of the 16122 tree, we identify...}, 16123 address = {New York}, 16124 author = {Warren, Michael S. and Salmon, John K.}, 16125 booktitle = {Proceedings of the 1993 ACM/IEEE Conference on Supercomputing}, 16126 citeulike-article-id={580952}, 16127 keywords = {oct-tree}, 16128 pages = {12--21}, 16129 publisher = {ACM}, 16130 title = {A parallel hashed Oct-Tree {N}-body algorithm}, 16131 year = {1993}, 16132 doi = {10.1145/169627.169640}, 16133 url = {http://citeseerx.ist.psu.edu/viewdoc/summary?doi=10.1.1.50.100} 16134} 16135 16136@Unpublished{ cruzwccm10, 16137 author = {Felipe A. Cruz}, 16138 title = {Heterogeneous extension of the PetFMM a Fast Multipole Library}, 16139 note = {Presentation at WCCM 2010, Sydney Australia}, 16140 year = {2010} 16141} 16142 16143@Article{ mcguffee06, 16144 author = {S.~R. {McGuffee} and A.~H. Elcock}, 16145 title = {Atomistically detailed simulations of concentrated protein solutions: the effects 16146 of salt, {pH}, point mutations, and protein concentration in simulations of 16147 1000-molecule systems}, 16148 journal = {Journal of the American Chemical Society}, 16149 volume = {128}, 16150 pages = {12098--12110}, 16151 year = {2006} 16152} 16153 16154@Article{ nilsencaihoylandlangtangen10, 16155 author = {{Nilsen}, J.~K. and {Cai}, X. and {Hoyland}, B. and {Petter Langtangen}, H.}, 16156 title = {{Simplifying Parallelization of Scientific Codes by a Function-Centric Approach 16157 in Python}}, 16158 journal = {ArXiv e-prints}, 16159 archiveprefix = {arXiv}, 16160 eprint = {1002.0705}, 16161 primaryclass = {cs.DC}, 16162 keywords = {Computer Science - Distributed, Parallel, and Cluster Computing, Computer Science 16163 - Programming Languages}, 16164 year = {2010}, 16165 month = feb, 16166 adsurl = {http://adsabs.harvard.edu/abs/2010arXiv1002.0705N}, 16167 adsnote = {Provided by the SAO/NASA Astrophysics Data System} 16168} 16169 16170@Misc{ mcinnes:siam09:minisymposium, 16171 title = {Implicit Nonlinear Solvers in Multimodel Simulations}, 16172 author = {L. C. McInnes and C. {Woodward (co-organizers)}}, 16173 note = {invited minisymposium session at the SIAM Annual Meeting, July 9-10, 2009, 16174 Denver, CO, speakers were: C. Woodward (LLNL), E. Myra (Univ. of Michigan), J. 16175 White (Stanford Univ.), A. Barker (Univ. of Colorado, Boulder), L. Wilcox (Univ. 16176 of Texas at Austin), R. Mills (ORNL), B. F. Smith (ANL), J. Shadid (SNL), D. Knoll 16177 (INL), G. Hansen (INL), J. Cary (Tech-X Corp.), T. Wildey (Univ. of Texas at 16178 Austin).} 16179} 16180 16181@Misc{ mcinnes:fsp-summary:feb2011, 16182 author = {Lois Curfman McInnes and Luis Chacon and John Shadid}, 16183 title = {Solvers and Time Integration Breakout Summary}, 16184 note = {FSP Planning Workshop, General Atomics, Feb 8-11, 2011, see 16185 \url{https://ice.txcorp.com/trac/2011_FspDefinitionWorkshop}} 16186} 16187 16188@Misc{ dvi-materials:siamcse11, 16189 title = {Progress in Large-Scale Differential Variational Inequalities for Heterogeneous 16190 Materials}, 16191 author = {M. Anitescu and A. El-Azab and J. Lee and L. C. McInnes and T. Munson and B. F. 16192 Smith and L. Wang}, 16193 note = {minisymposium presentation at the 2011 SIAM Conference on Computational Science 16194 and Engineering, March 3, 2011} 16195} 16196 16197@Misc{ jamroz:cemm10, 16198 title = {{JFNK} within the semi-implicit scheme in {NIMROD}}, 16199 author = {B. Jamroz and S. Kruger and T. Austin}, 16200 note = {presentation, CEMM Meeting, Chicago, IL, Nov 7, 2010} 16201} 16202 16203@Misc{ kruger:feb4-2011, 16204 title = {personal communication}, 16205 author = {S. Kruger}, 16206 note = {February, 2011} 16207} 16208 16209@Article{ elman1996, 16210 author = {H.C. Elman}, 16211 title = {Preconditioning for the steady-state {Navier-Stokes} equations for low 16212 viscosity}, 16213 journal = {SIAM J. Sci. Comput.}, 16214 volume = {20}, 16215 year = {1996}, 16216 pages = {1299--1316} 16217} 16218 16219@Article{ kayloghinwathen2002, 16220 author = {D. Kay and D. Loghin and A. Wathen}, 16221 title = {A preconditioning for the steady-state {Navier-Stokes} equations}, 16222 journal = {SIAM J. Sci. Comput.}, 16223 volume = {24}, 16224 year = {2002}, 16225 pages = {237--256} 16226} 16227 16228@Article{ elmanhowleshadidshuttleworthtuminaro2006, 16229 author = {H.C. Elman and V.E. Howle and J. Shadid and R. Shuttleworth and R. Tuminaro}, 16230 title = {Block preconditioners based on approximate commutators}, 16231 journal = {SIAM J. Sci. Comput.}, 16232 volume = {27}, 16233 number = {5}, 16234 year = {2006}, 16235 pages = {1651--1668} 16236} 16237 16238@Article{ braesssarazin1997, 16239 author = {Dietrich Braess and Regina Sarazin}, 16240 title = {An efficient smoother for the {Stokes} problem}, 16241 journal = {Applied Numerical Mathematics}, 16242 volume = {23}, 16243 number = {1}, 16244 year = {1997}, 16245 pages = {3--19}, 16246 doi = {10.1016/S0168-9274(96)00059-1} 16247} 16248 16249@Article{ wright2001large, 16250 title = {Large-Scale Computation of Pseudospectra Using {ARPACK} and \texttt{eigs}}, 16251 author = {Wright, T.G. and Trefethen, L.N.}, 16252 journal = {SIAM Journal on Scientific Computing}, 16253 volume = {23}, 16254 pages = {591}, 16255 year = {2001} 16256} 16257 16258@Misc{ wright2002eigtool, 16259 title = {Eig{T}ool}, 16260 author = {Wright, T.G. and Trefethen, LN}, 16261 howpublished = {Software available at \url{http://www.comlab.ox.ac.uk/pseudospectra/eigtool}}, 16262 year = {2002} 16263} 16264 16265@Misc{ visit-web-site, 16266 key = {{VisIt}}, 16267 title = {{VisIt web site}}, 16268 howpublished = {\url{http://wci.llnl.gov/codes/visit/}}, 16269 url = {http://wci.llnl.gov/codes/visit/}, 16270 year = {2011} 16271} 16272 16273@Book{ trefethen1996, 16274 title = {Finite difference and spectral methods for ordinary and partial differential 16275 equations}, 16276 author = {Lloyd Nicholas Trefethen}, 16277 year = {1996}, 16278 publisher = {Cornell University-Department of Computer Science and Center for Applied 16279 Mathematics} 16280} 16281 16282@Book{ trefethen2005spectra, 16283 title = {Spectra and pseudospectra: the behavior of nonnormal matrices and operators}, 16284 author = {Trefethen, L.N. and Embree, M.}, 16285 year = {2005}, 16286 publisher = {Princeton University Press} 16287} 16288 16289@Article{ gomez2010isogeometric, 16290 title = {Isogeometric analysis of the isothermal {N}avier-{S}tokes-{K}orteweg equations}, 16291 author = {Gomez, H. and Hughes, T.J.R. and Nogueira, X. and Calo, V.M.}, 16292 journal = {Computer Methods in Applied Mechanics and Engineering}, 16293 volume = {199}, 16294 number = {25-28}, 16295 pages = {1828--1840}, 16296 issn = {0045-7825}, 16297 year = {2010}, 16298 publisher = {Elsevier} 16299} 16300 16301@Article{ gomez2008isogeometric, 16302 title = {Isogeometric analysis of the {C}ahn-{H}illiard phase-field model}, 16303 author = {G{\'o}mez, H. and Calo, V.M. and Bazilevs, Y. and Hughes, T.J.R.}, 16304 journal = {Computer Methods in Applied Mechanics and Engineering}, 16305 volume = {197}, 16306 number = {49-50}, 16307 pages = {4333--4352}, 16308 year = {2008}, 16309 publisher = {Elsevier} 16310} 16311 16312@Misc{ fastmath:project, 16313 author = {Lori {Diachin (PI)}}, 16314 title = {{SciDAC Frameworks, Algorithms, and Scalable Technologies for Mathematics 16315 (FASTMath) Institute}}, 16316 howpublished = {\url{https://fastmath-scidac.llnl.gov}} 16317} 16318 16319@Misc{ exascale-software:proposal, 16320 author = {Peter {Beckman (PI)}}, 16321 title = {{Exascale Software Center}}, 16322 note = {proposal to DOE} 16323} 16324 16325@Misc{ imex:project, 16326 author = {Barry {Smith (PI)}}, 16327 title = {{Scalable Implicit-Explicit (IMEX) Algorithms and Software for Time-Dependent 16328 Multimodel PDEs}}, 16329 note = {DOE ASCR applied math project} 16330} 16331 16332@Misc{ intel-mic:website, 16333 author = {Intel}, 16334 title = {{Many Integrated Core Architecture}}, 16335 note = {\url{http://www.intel.com/technology/architecture-silicon/mic}} 16336} 16337 16338@Article{ dudson:2009, 16339 author = {B.D. Dudson and M.V. Umansky and X.Q. Xu and P.B. Snyder and H.R. Wilson}, 16340 title = {{{BOUT++:}} a framework for parallel plasma fluid simulations}, 16341 journal = {Computer Physics Communications}, 16342 volume = {180}, 16343 pages = {1467}, 16344 year = {2009} 16345} 16346 16347@Article{ umansky:2009, 16348 author = {M.V. Umansky and X.Q. Xu and B. Dudson and L.L. LoDestro and J.R. Myra}, 16349 title = {{Status and verification of edge plasma turbulence code BOUT}}, 16350 journal = {Computer Physics Communications}, 16351 year = {2009}, 16352 volume = {180}, 16353 pages = {887-903} 16354} 16355 16356@Article{ xu:1998, 16357 author = {X.Q. Xu and R.H. Cohen}, 16358 title = {{Scrape-Off Layer Turbulence Theory and Simulations}}, 16359 journal = {Computer Physics Communications}, 16360 year = {1998}, 16361 volume = {36}, 16362 number = {1-2}, 16363 pages = {158} 16364} 16365 16366@Article{ tron:1999, 16367 title = {Newton's Method for Large Bound-constrained Optimization Problems}, 16368 author = {Chih-Jen Lin and Jorge Mor\'{e}}, 16369 journal = {SIAM Journal on Optimization}, 16370 volume = {9}, 16371 number = {4}, 16372 pages = {1100-1127}, 16373 year = {1999} 16374} 16375 16376@Article{ stubenamg, 16377 author = {K. St\"{u}ben}, 16378 title = {A review of algebraic multigrid}, 16379 journal = {J. Comput. Appl. Math.}, 16380 volume = {128}, 16381 number = {1-2}, 16382 year = {2001}, 16383 issn = {0377-0427}, 16384 pages = {281--309}, 16385 doi = {10.1016/S0377-0427(00)00516-1}, 16386 publisher = {Elsevier Science Publishers B. V.}, 16387 address = {Amsterdam, The Netherlands, The Netherlands} 16388} 16389 16390@Article{ feuchtermg, 16391 author = {D. Feuchter and I. Heppner and S. Sauter and G. Wittum}, 16392 title = {Bridging the gap between geometric and algebraic multigrid methods}, 16393 journal = {Computing and visualization in science}, 16394 publisher = {Springer}, 16395 volume = {6}, 16396 number = {1}, 16397 year = {2003}, 16398 pages = {1--13} 16399} 16400 16401@Article{ chowmgsmoothness, 16402 abstract = {For non-M-matrices, this paper proposes an unstructured multigrid method that 16403 only attempts to interpolate in the directions of geometrical smoothness. These 16404 directions are determined by analyzing samples of algebraically smooth error, e. 16405 Neighboring grid points i and j are called smoothly coupled if e i and e j are 16406 consistently nearby in value. In addition, these dierences may be used to dene 16407 interpolation weights. These new ideas may be incorporated into the algebraic 16408 multigrid method. Test results show that the new method can have much lower grid 16409 and operator complexities compared to AMG, leading to lower solve timings. 1 }, 16410 author = {Chow, Edmond}, 16411 citeulike-article-id={7675372}, 16412 citeulike-linkout-0={http://citeseerx.ist.psu.edu/viewdoc/summary?doi=10.1.1.22.4305}, 16413 journal = {American Journal of Mathematics}, 16414 keywords = {fem, multigrid}, 16415 pages = {197--215}, 16416 posted-at = {2010-08-17 23:29:51}, 16417 priority = {2}, 16418 title = {An Unstructured Multigrid Method Based on Geometric Smoothness}, 16419 url = {http://citeseerx.ist.psu.edu/viewdoc/summary?doi=10.1.1.22.4305}, 16420 volume = {65}, 16421 year = {2001} 16422} 16423 16424@Article{ jonesamge, 16425 abstract = {{This paper contains the main ideas for an AMGe (algebraic multigrid for finite 16426 elements) method based on element agglomeration. In the method, coarse grid 16427 elements are formed by agglomerating fine grid elements. Compatible interpolation 16428 operators are constructed which yield coarse grid basis functions with a minimal 16429 energy property. Heuristics based on interpolation quality measures are used to 16430 guide the agglomeration procedure. The performance of the resulting method is 16431 demonstrated in two-level numerical experiments.}}, 16432 author = {Jones, Jim E. and Vassilevski, Panayot S.}, 16433 citeulike-article-id={8598569}, 16434 citeulike-linkout-0={http://scitation.aip.org/getabs/servlet/GetabsServlet?prog=normal&id=SJOCE3000023000001000109000001&idtype=cvips&gifs=yes}, 16435 citeulike-linkout-1={http://link.aip.org/link/?SCE/23/109}, 16436 journal = {SIAM Journal on Scientific Computing}, 16437 keywords = {amg, fem, multigrid}, 16438 number = {1}, 16439 pages = {109--133}, 16440 posted-at = {2011-01-13 18:05:55}, 16441 priority = {2}, 16442 publisher = {SIAM}, 16443 title = {{AMGE Based on Element Agglomeration}}, 16444 url = {http://scitation.aip.org/getabs/servlet/GetabsServlet?prog=normal&id=SJOCE3000023000001000109000001&idtype=cvips&gifs=yes}, 16445 volume = {23}, 16446 year = {2001} 16447} 16448 16449@Article{ saad1993, 16450 author = {Saad, Youcef}, 16451 doi = {10.1137/0914028}, 16452 issn = {10648275}, 16453 journal = {SIAM Journal on Scientific Computing}, 16454 keywords = {65f10,ams,especially since the popularization,gate gradient,general purpose 16455 iterative methods,gmres,krylov subspace methods,mos,non-hermitian systems,of 16456 precondition-,preconditioned conju-,subject classi cations,variable 16457 preconditioners}, 16458 number = {2}, 16459 pages = {461--469}, 16460 title = {{A flexible inner-outer preconditioned GMRES algorithm}}, 16461 volume = {14}, 16462 year = {1993} 16463} 16464 16465@Misc{ path:homepage, 16466 author = {S. Dirkse and M. Ferris and T. Munson}, 16467 title = {{{PATH} {W}eb page}}, 16468 howpublished = {\url{http://pages.cs.wisc.edu/~ferris/path.html}} 16469} 16470 16471@Article{ ketcheson2008, 16472 author = {David I Ketcheson}, 16473 title = {Highly Efficient Strong Stability Preserving {Runge-Kutta} Methods with 16474 Low-Storage Implementations}, 16475 volume = {30}, 16476 journal = {SIAM Journal on Scientific Computing}, 16477 year = {2008}, 16478 pages = {2113--2136} 16479} 16480 16481@Article{ elman2009boundary, 16482 title = {{Boundary conditions in approximate commutator preconditioners for the 16483 Navier-Stokes equations}}, 16484 author = {Elman, H.C. and Tuminaro, R.}, 16485 journal = {Electronic Transactions on Numerical Analysis}, 16486 volume = {35}, 16487 pages = {257--280}, 16488 year = {2009} 16489} 16490 16491@Article{ elman2008tcp, 16492 title = {{A taxonomy and comparison of parallel block multi-level preconditioners for the 16493 incompressible Navier-Stokes equations}}, 16494 author = {Elman, H.C. and Howle, V.E. and Shadid, J. and Shuttleworth, R. and Tuminaro, 16495 R.}, 16496 journal = {Journal of Computational Physics}, 16497 volume = {227}, 16498 number = {1}, 16499 pages = {1790--1808}, 16500 year = {2008}, 16501 publisher = {Academic Press}, 16502 url = {http://chess.cs.umd.edu/~elman/papers/tax.pdf} 16503} 16504 16505@Article{ arioli2013, 16506 title = {Generalized {G}olub--{K}ahan bidiagonalization and stopping criteria}, 16507 author = {Arioli, Mario}, 16508 journal = {SIAM Journal on Matrix Analysis and Applications}, 16509 volume = {34}, 16510 number = {2}, 16511 pages = {571--592}, 16512 year = {2013}, 16513 publisher = {SIAM} 16514} 16515 16516@Book{ wesseling2009, 16517 title = {Principles of computational fluid dynamics}, 16518 author = {Wesseling, Pieter}, 16519 volume = {29}, 16520 year = {2009}, 16521 publisher = {Springer Science \& Business Media} 16522} 16523 16524@Article{ silvester2001efficient, 16525 title = {{Efficient preconditioning of the linearized Navier-Stokes equations for 16526 incompressible flow}}, 16527 author = {Silvester, D. and Elman, H. and Kay, D. and Wathen, A.}, 16528 journal = {Journal of Computational and Applied Mathematics}, 16529 volume = {128}, 16530 number = {1-2}, 16531 pages = {261--279}, 16532 issn = {0377-0427}, 16533 year = {2001}, 16534 publisher = {Elsevier} 16535} 16536 16537@Article{ elman1999bfbt, 16538 title = {{Preconditioning for the steady-state Navier-Stokes equations with low 16539 viscosity}}, 16540 author = {Elman, H.C.}, 16541 journal = {SIAM Journal on Scientific Computing}, 16542 volume = {20}, 16543 number = {4}, 16544 pages = {1299--1316}, 16545 issn = {1064-8275}, 16546 year = {1999}, 16547 publisher = {Citeseer} 16548} 16549 16550@Article{ elman2006bpb, 16551 title = {{Block preconditioners based on approximate commutators}}, 16552 author = {Elman, H. and Howle, V.E. and Shadid, J. and Shuttleworth, R. and Tuminaro, R.}, 16553 journal = {SIAM Journal on Scientific Computing}, 16554 volume = {27}, 16555 number = {5}, 16556 pages = {1651--1668}, 16557 year = {2006}, 16558 publisher = {Philadelphia, PA: SIAM, c1993-} 16559} 16560 16561@Article{ olshanskii2006analysis, 16562 title = {{Analysis of a Stokes interface problem}}, 16563 author = {Olshanskii, M.A. and Reusken, A.}, 16564 journal = {Numerische Mathematik}, 16565 volume = {103}, 16566 number = {1}, 16567 pages = {129--149}, 16568 issn = {0029-599X}, 16569 year = {2006}, 16570 publisher = {Springer} 16571} 16572 16573@Article{ patankar1972cph, 16574 title = {{A calculation procedure for heat, mass and momentum transfer in 16575 three-dimensional parabolic flows}}, 16576 author = {Patankar, S.V. and Spalding, D.B.}, 16577 journal = {Int. J. Heat Mass Transfer}, 16578 volume = {15}, 16579 pages = {1787--1806}, 16580 year = {1972} 16581} 16582 16583@Article{ rannacher1992simple, 16584 title = {{Simple nonconforming quadrilateral Stokes element}}, 16585 author = {Rannacher, R. and Turek, S.}, 16586 journal = {Numerical Methods for Partial Differential Equations}, 16587 volume = {8}, 16588 number = {2}, 16589 pages = {97--111}, 16590 issn = {1098-2426}, 16591 year = {1992}, 16592 publisher = {Wiley Online Library} 16593} 16594 16595@Article{ rannacher2000finite, 16596 title = {Finite Element Methods for the Incompressible {N}avier-{S}tokes Equations}, 16597 author = {Rannacher, R.}, 16598 journal = {Fundamental Directions in Mathematical Fluid Mechanics}, 16599 pages = {191}, 16600 isbn = {3764364149}, 16601 year = {2000}, 16602 publisher = {Birkhauser} 16603} 16604 16605@Article{ vanka1986block, 16606 title = {{Block-implicit multigrid solution of Navier-Stokes equations in primitive 16607 variables}}, 16608 author = {Vanka, S.P.}, 16609 journal = {Journal of Computational Physics}, 16610 volume = {65}, 16611 number = {1}, 16612 pages = {138--158}, 16613 issn = {0021-9991}, 16614 year = {1986}, 16615 publisher = {Elsevier} 16616} 16617 16618@Article{ eisenstat1983variational, 16619 title = {Variational iterative methods for nonsymmetric systems of linear equations}, 16620 author = {Eisenstat, S.C. and Elman, H.C. and Schultz, M.H.}, 16621 journal = {SIAM Journal on Numerical Analysis}, 16622 volume = {20}, 16623 number = {2}, 16624 pages = {345--357}, 16625 year = {1983}, 16626 publisher = {JSTOR} 16627} 16628 16629@InProceedings{ burstedde2008scalable, 16630 title = {Scalable adaptive mantle convection simulation on petascale supercomputers}, 16631 author = {Burstedde, C. and Ghattas, O. and Gurnis, M. and Stadler, G. and Tan, E. and Tu, 16632 T. and Wilcox, L.C. and Zhong, S.}, 16633 booktitle = {Proceedings of the 2008 ACM/IEEE conference on Supercomputing}, 16634 pages = {62}, 16635 year = {2008}, 16636 organization = {IEEE Press} 16637} 16638 16639@Article{ burstedde2009parallel, 16640 title = {Parallel scalable adjoint-based adaptive solution of variable-viscosity {Stokes} 16641 flow problems}, 16642 author = {Burstedde, C. and Ghattas, O. and Stadler, G. and Tu, T. and Wilcox, L.C.}, 16643 journal = {Computer Methods in Applied Mechanics and Engineering}, 16644 volume = {198}, 16645 number = {21-26}, 16646 pages = {1691--1700}, 16647 year = {2009}, 16648 publisher = {Elsevier} 16649} 16650 16651@Article{ stadler2010dynamics, 16652 title = {The dynamics of plate tectonics and mantle flow: From local to global scales}, 16653 author = {Stadler, G. and Gurnis, M. and Burstedde, C. and Wilcox, L.C. and Alisic, L. and 16654 Ghattas, O.}, 16655 journal = {Science}, 16656 volume = {329}, 16657 number = {5995}, 16658 pages = {1033}, 16659 year = {2010}, 16660 publisher = {American Association for the Advancement of Science} 16661} 16662 16663@Article{ tackley2008modelling, 16664 title = {Modelling compressible mantle convection with large viscosity contrasts in a 16665 three-dimensional spherical shell using the yin-yang grid}, 16666 author = {Tackley, P.J.}, 16667 journal = {Physics of the Earth and Planetary Interiors}, 16668 volume = {171}, 16669 number = {1-4}, 16670 pages = {7--18}, 16671 year = {2008}, 16672 publisher = {Elsevier} 16673} 16674 16675@Article{ moresizhonggurnis96, 16676 author = {Louis N. Moresi and Shijie Zhong and Michael Gurnis}, 16677 title = {The accuracy of finite element solutions of {S}tokes' flow with strongly varying 16678 viscosity}, 16679 journal = {Physics of the Earth and Planetary Interiors}, 16680 volume = {97}, 16681 pages = {83-–94}, 16682 year = {1996} 16683} 16684 16685@Article{ moresisolomatov95, 16686 author = {Louis N. Moresi and V. S. Solomatov}, 16687 title = {Numerical investigation of {2D} convection with extremely large viscosity 16688 variations}, 16689 journal = {Physics of Fluids}, 16690 volume = {7}, 16691 number = {9}, 16692 pages = {2154-–2162}, 16693 year = {1995} 16694} 16695 16696@Article{ chenmolnar83, 16697 author = {W.-P. Chen and P. Molnar}, 16698 title = {Focal depths of intra-continental and intraplate earthquakes and their 16699 implications for the thermal and mechanical properties of the lithosphere}, 16700 journal = {Journal of Geophysical Research}, 16701 volume = {88}, 16702 pages = {4183–-4214}, 16703 year = {1983} 16704} 16705 16706@Article{ jackson02, 16707 author = {J. Jackson}, 16708 title = {Strength of the continental lithosphere: time to abandon the jelly sandwich?}, 16709 journal = {GSA Today}, 16710 volume = {12}, 16711 pages = {4–-10}, 16712 year = {2002} 16713} 16714 16715@Article{ burovwatts06, 16716 author = {E.B. Burov and A.B. Watts}, 16717 title = {The long-term strength of continental lithosphere: jelly sandwich or creme 16718 brulee?}, 16719 journal = {GSA Today}, 16720 volume = {16}, 16721 pages = {4–-10}, 16722 year = {2006} 16723} 16724 16725@InProceedings{ yang:brent:2002, 16726 title = {The Improved {BiCGStab} Method for Large and Sparse Unsymmetric Linear Systems on 16727 Parallel Distributed Memory Architectures}, 16728 author = {Laurence T. Yang and Richard Brent}, 16729 booktitle = {Proceedings of the Fifth International Conference on Algorithms and Architectures 16730 for Parallel Processing}, 16731 year = {2002}, 16732 publisher = {IEEE} 16733} 16734 16735@Article{ demmel2008communication, 16736 title = {Communication-optimal parallel and sequential {QR} and {LU} factorizations}, 16737 author = {Demmel, J. and Grigori, L. and Hoemmen, M. and Langou, J.}, 16738 journal = {Arxiv preprint arXiv:0808.2664}, 16739 year = {2008} 16740} 16741 16742@Article{ demmel09, 16743 author = {J. Demmel and M. Hoemmen and M. Mohiyuddin and K Yelick}, 16744 title = {Communication-optimal Iterative Methods}, 16745 journal = {Journal of Physics: Conf. Series}, 16746 volume = {180}, 16747 year = {2009} 16748} 16749 16750@TechReport{ parms04, 16751 author = {Yousef Saad and Masha Sosonkina}, 16752 title = {{pARMS}: A package for the parallel iterative solution of general large sparse 16753 linear systems user's guide}, 16754 number = {UMSI2004-8}, 16755 institution = {Minnesota Supercomputer Institute, University of Minnesota}, 16756 year = {2004} 16757} 16758 16759@Article{ picard1890, 16760 author = {Emile Picard}, 16761 title = {M\'emoire sur la th\'eorie des \'equations aux d\'eriv\'ees partielles et la 16762 m\'ethode des approximations successives}, 16763 journal = {Journal De Math\'ematiques Pures et Appliqu\'ees}, 16764 volume = {4}, 16765 number = {6}, 16766 pages = {145--210}, 16767 year = {1890}, 16768 url = {http://math-doc.ujf-grenoble.fr/JMPA/PDF/JMPA_1890_4_6_A3_0.pdf} 16769} 16770 16771@Book{ rall1969, 16772 author = {Louis B. Rall}, 16773 title = {Computational solution of nonlinear operator equations}, 16774 publisher = {Krieger Pub Co.}, 16775 pages = {225}, 16776 year = {1969} 16777} 16778 16779@Article{ fletcherreeves1964, 16780 author = {R. Fletcher and C. M. Reeves}, 16781 title = {Function Minimization by Conjugate Gradients}, 16782 journal = {Computer Journal}, 16783 volume = {7}, 16784 pages = {149–-154}, 16785 year = {1964} 16786} 16787 16788@InBook{ mcinnesallanetal06, 16789 author = {Lois Curfman McInnes and Benjamin Allan and Robert Armstrong and Steven Benson 16790 and David Bernholdt and Tamara Dahlgren and Lori Diachin and Manojkumar Krishnan 16791 and James Kohl and Jay Larson and Sophia Lefantzi and Jarek Nieplocha and Boyana 16792 Norris and Steven Parker and Jaideep Ray and Shujia Zhou}, 16793 editor = {A.~M.~Bruaset and A.~Tveito}, 16794 title = {Numerical Solution of Partial Differential Equations on Parallel Computers}, 16795 chapter = {Parallel {PDE}-Based Simulations Using the {Common Component Architecture}}, 16796 publisher = {Springer}, 16797 year = {2006}, 16798 number = {51}, 16799 series = {Lecture Notes in Computational Science and Engineering}, 16800 pages = {327--381}, 16801 doi = {10.1016/S0167-8191(02)00191-6} 16802} 16803 16804@Article{ cyrshadidtuminaro12, 16805 title = {Stabilization and scalable block preconditioning for the {Navier–Stokes} 16806 equations}, 16807 journal = {Journal of Computational Physics}, 16808 volume = {231}, 16809 number = {2}, 16810 pages = {345 - 363}, 16811 year = {2012}, 16812 issn = {0021-9991}, 16813 doi = {10.1016/j.jcp.2011.09.001}, 16814 author = {Eric C. Cyr and John N. Shadid and Raymond S. Tuminaro} 16815} 16816 16817@Article{ keyesmcinneswoodwardetal13, 16818 title = {Multiphysics Simulations: Challenges and Opportunities}, 16819 author = {David E. Keyes and Lois Curfman McInnes and Carol Woodward and William Gropp and 16820 Eric Myra and Michael Pernice and John Bell and Jed Brown and Alain Clo and 16821 Jeffrey Connors and Emil Constantinescu and Don Estep and Kate Evans and Charbel 16822 Farhat and Ammar Hakim and Glenn Hammond and Glen Hansen and Judith Hill and Tobin 16823 Isaac and Xiangmin Jiao and Kirk Jordan and Dinesh Kaushik and Efthimios Kaxiras 16824 and Alice Koniges and Kihwan Lee and Aaron Lott and Qiming Lu and John Magerlein 16825 and Reed Maxwell and Michael McCourt and Miriam Mehl and Roger Pawlowski and 16826 Amanda Peters Randles and Daniel Reynolds and B\'{e}atrice Rivi\`{e}re and Ulrich 16827 R\"{u}de and Tim Scheibe and John Shadid and Brendan Sheehan and Mark Shephard and 16828 Andrew Siegel and Barry Smith and Xianzhu Tang and Cian Wilson and Barbara Wohlmuth}, 16829 journal = {International Journal of High Performance Computing Applications}, 16830 month = feb, 16831 year = {2013}, 16832 volume = {27}, 16833 number = {1}, 16834 pages = {4--83}, 16835 doi = {10.1177/1094342012468181}, 16836 note = {Special issue}, 16837 abstract = {We consider multiphysics applications from algorithmic and architectural 16838 perspectives, where ``algorithmic'' includes both mathematical analysis and 16839 computational complexity and ``architectural'' includes both software and hardware 16840 environments. Many diverse multiphysics applications can be reduced, en route to 16841 their computational simulation, to a common algebraic coupling paradigm. 16842 Mathematical analysis of multiphysics coupling in this form is not always 16843 practical for realistic applications, but model problems representative of 16844 applications discussed herein can provide insight. A variety of software 16845 frameworks for multiphysics applications have been constructed and refined within 16846 disciplinary communities and executed on leading-edge computer systems. We examine 16847 several of these, expose some commonalities among them, and attempt to extrapolate 16848 best practices to future systems. From our study, we summarize challenges and 16849 forecast opportunities.} 16850} 16851 16852@Misc{ rosner10, 16853 author = {Robert {Rosner (Chair)}}, 16854 title = {{The Opportunities and Challenges of Exascale Computing}}, 16855 year = {2010}, 16856 howpublished = {Office of Science, U.S. Department of Energy}, 16857 url = {http://science.energy.gov/~/media/ascr/ascac/pdf/reports/Exascale_subcommittee_report.pdf} 16858} 16859 16860@Misc{ kogge2008exascale, 16861 title = {ExaScale Computing Study: {T}echnology Challenges in achieving exascale systems}, 16862 author = {Peter Kogge and Keren Bergman and Shekhar Borkar and Dan Campbell and Willian 16863 Carlson and William Dally and Monty Denneau and Paul Franzon and William Harrod 16864 and Kerry Hill and Jon Hiller and Sherman Karp and Stephen Keckler and Dean Klein 16865 and Robert Lucas and Mark Richards and Al Scarpelly and Steven Scott and Allan 16866 Snavely and Themas Sterling and R. Stanley Williams and Katherine Yelick}, 16867 howpublished = {DARPA}, 16868 year = {2008}, 16869 url = {http://www.cse.nd.edu/Reports/2008/TR-2008-13.pdf} 16870} 16871 16872@Misc{ doegrandchallengeworkshops, 16873 key = {Office of Science, U.S. Department of Energy}, 16874 title = {{Scientific Grand Challenges Workshop Series}}, 16875 howpublished = {Office of Science, U.S. Department of Energy, see 16876 \url{http://extremecomputing.labworks.org/workshops.stm}} 16877} 16878 16879@Misc{ lawrence2011, 16880 key = {Lawrence}, 16881 title = {{Ernest Orlando Lawrence Award Winners}}, 16882 howpublished = {U.S. Department of Energy, {\footnotesize 16883 \url{http://energy.gov/articles/secretary-chu-announces-2011-ernest-orlando-lawrence-award-winners}}}, 16884 year = {2011} 16885} 16886 16887@Article{ murphy2000npi, 16888 title = {{A note on preconditioning for indefinite linear systems}}, 16889 author = {Murphy, M.F. and Golub, G.H. and Wathen, A.J.}, 16890 journal = {SIAM Journal on Scientific Computing}, 16891 volume = {21}, 16892 number = {6}, 16893 pages = {1969--1972}, 16894 year = {2000}, 16895 publisher = {Philadelphia, PA: SIAM, c1993-} 16896} 16897 16898@Article{ elman2011bouyancy, 16899 title = {Fast iterative solvers for buoyancy driven flow problems}, 16900 journal = {Journal of Computational Physics}, 16901 volume = {230}, 16902 number = {10}, 16903 pages = {3900 - 3914}, 16904 year = {2011}, 16905 note = {}, 16906 issn = {0021-9991}, 16907 doi = {10.1016/j.jcp.2011.02.014}, 16908 author = {Howard Elman and Milan Mihajlovic and David Silvester}, 16909 keywords = {Navier-Stokes, Boussinesq, Finite element approximation, Time stepping, 16910 Adaptivity, Preconditioning, Algebraic multigrid} 16911} 16912 16913@Article{ dongarrabeckman11, 16914 author = {J. Dongarra and P. Beckman and et al.}, 16915 title = {The {I}nternational {E}xascale {S}oftware {P}roject {R}oadmap}, 16916 journal = {Int. J. High Perf. Comput. Applics.}, 16917 volume = {25}, 16918 year = {2011}, 16919 pages = {3--60} 16920} 16921 16922@Article{ mandel1999energy, 16923 title = {Energy optimization of algebraic multigrid bases}, 16924 author = {Mandel, J. and Brezina, M. and Van{\v{e}}k, P.}, 16925 journal = {Computing}, 16926 volume = {62}, 16927 number = {3}, 16928 pages = {205--228}, 16929 year = {1999}, 16930 publisher = {Springer} 16931} 16932 16933@Article{ vanek1996algebraic, 16934 title = {Algebraic multigrid by smoothed aggregation for second and fourth order elliptic 16935 problems}, 16936 author = {Van{\v{e}}k, P. and Mandel, J. and Brezina, M.}, 16937 journal = {Computing}, 16938 volume = {56}, 16939 number = {3}, 16940 pages = {179--196}, 16941 year = {1996}, 16942 publisher = {Springer} 16943} 16944 16945@Article{ vanek2001convergence, 16946 title = {Convergence of algebraic multigrid based on smoothed aggregation}, 16947 author = {Van{\v{e}}ek, P. and Brezina, M. and Mandel, J.}, 16948 journal = {Numerische Mathematik}, 16949 volume = {88}, 16950 number = {3}, 16951 pages = {559--579}, 16952 year = {2001}, 16953 publisher = {Springer} 16954} 16955 16956@Article{ brannick2007algebraic, 16957 title = {Algebraic multigrid methods based on compatible relaxation and energy 16958 minimization}, 16959 author = {Brannick, J. and Zikatanov, L.}, 16960 journal = {Domain decomposition methods in science and engineering XVI}, 16961 pages = {15--26}, 16962 year = {2007}, 16963 publisher = {Springer} 16964} 16965 16966@Article{ brannickfalgout2010, 16967 title = {{Compatible Relaxation and Coarsening in Algebraic Multigrid}}, 16968 author = {James J. Brannick and Robert D. Falgout}, 16969 journal = {SIAM Journal on Scientific Computing}, 16970 volume = {32}, 16971 number = {3}, 16972 pages = {1393--1416}, 16973 url = {http://epubs.siam.org/doi/10.1137/090772216}, 16974 doi = {10.1137/090772216}, 16975 issn = {1064-8275}, 16976 year = {2010} 16977} 16978 16979@Article{ xu2004energy, 16980 title = {On an energy minimizing basis for algebraic multigrid methods}, 16981 author = {Xu, J. and Zikatanov, L.}, 16982 journal = {Computing and Visualization in Science}, 16983 volume = {7}, 16984 number = {3}, 16985 pages = {121--127}, 16986 year = {2004}, 16987 publisher = {Springer} 16988} 16989 16990@Article{ dblp:journals/toms/bakerhlt09, 16991 author = {C. G. Baker and Ulrich Hetmaniuk and Richard B. Lehoucq and Heidi Thornquist}, 16992 title = {Anasazi software for the numerical solution of large-scale eigenvalue problems}, 16993 journal = {ACM Trans. Math. Softw.}, 16994 volume = {36}, 16995 number = {3}, 16996 year = {2009}, 16997 doi = {10.1145/1527286.1527287}, 16998 bibsource = {DBLP, http://dblp.uni-trier.de} 16999} 17000 17001@Article{ dblp:journals/siamsc/yanggbllhn05, 17002 author = {Chao Yang and Weiguo Gao and Zhaojun Bai and Xiaoye S. Li and Lie-Quan Lee and 17003 Parry Husbands and Esmond G. Ng}, 17004 title = {An Algebraic Substructuring Method for Large-Scale Eigenvalue Calculation}, 17005 journal = {SIAM J. Scientific Computing}, 17006 volume = {27}, 17007 number = {3}, 17008 year = {2005}, 17009 pages = {873-892}, 17010 doi = {10.1137/040613767}, 17011 bibsource = {DBLP, http://dblp.uni-trier.de} 17012} 17013 17014@TechReport{ ml-guide, 17015 author = {M.W. Gee and C.M. Siefert and J.J. Hu and R.S. Tuminaro and M.G. Sala}, 17016 title = {{ML} 5.0 Smoothed Aggregation User's Guide}, 17017 institution = {Sandia National Laboratories}, 17018 year = {2006}, 17019 number = {SAND2006-2649} 17020} 17021 17022@Article{ brannick06, 17023 title = {An energy-based AMG coarsening strategy}, 17024 volume = {13}, 17025 doi = {10.1002/nla.480}, 17026 number = {2-3}, 17027 journal = {Numerical Linear Algebra with Applications}, 17028 author = {Brannick, J and Brezina, M and MacLachlan, S and Manteuffel, T and McCormick, S 17029 and Ruge, J}, 17030 year = {2006}, 17031 pages = {133--148} 17032} 17033 17034@Article{ olson10, 17035 author = {Olson, Luke N. and Schroder, Jacob and Tuminaro, Raymond S.}, 17036 title = {A new perspective on strength measures in algebraic multigrid}, 17037 journal = {Numerical Linear Algebra with Applications}, 17038 volume = {17}, 17039 number = {4}, 17040 pages = {713--733}, 17041 year = {2010}, 17042 publisher = {John Wiley \& Sons, Ltd.}, 17043 issn = {1099-1506}, 17044 doi = {10.1002/nla.669} 17045} 17046 17047@Article{ olson11, 17048 author = {Olson, Luke N. and Schroder, Jacob B. and Tuminaro, Raymond S.}, 17049 title = {A General Interpolation Strategy for Algebraic Multigrid Using Energy 17050 Minimization}, 17051 journal = {SIAM J. Sci. Comput.}, 17052 issue_date = {April 2011}, 17053 volume = {33}, 17054 issue = {2}, 17055 month = apr, 17056 year = {2011}, 17057 issn = {1064-8275}, 17058 pages = {966--991}, 17059 numpages = {26}, 17060 doi = {10.1137/100803031}, 17061 acmid = {2078825}, 17062 publisher = {Society for Industrial and Applied Mathematics}, 17063 address = {Philadelphia, PA}, 17064 keywords = {algebraic multigrid, interpolation, non-Hermitian, nonsymmetric, smoothed 17065 aggregation} 17066} 17067 17068@Article{ dorit2011, 17069 author = {Dorit Ron and Ilya Safro and Achi Brandt}, 17070 title = {Relaxation-Based Coarsening and Multiscale Graph Organization}, 17071 journal = {Multiscale Modeling {\&} Simulation}, 17072 volume = {9}, 17073 number = {1}, 17074 year = {2011}, 17075 pages = {407-423}, 17076 doi = {10.1137/100791142} 17077} 17078 17079@Article{ chen2011algebraic, 17080 title = {Algebraic distance on graphs}, 17081 author = {Chen, Jie and Safro, Ilya}, 17082 journal = {SIAM Journal on Scientific Computing}, 17083 volume = {33}, 17084 number = {6}, 17085 pages = {3468--3490}, 17086 year = {2011}, 17087 publisher = {SIAM} 17088} 17089 17090@InProceedings{ adams04, 17091 author = {Adams, M.~F. and Bayraktar, H.~H. and Keaveny, T.~M. and Papadopoulos, P.}, 17092 booktitle = {ACM/IEEE Proceedings of SC2004: High Performance Networking and Computing}, 17093 title = {Ultrascalable implicit finite element analyses in solid mechanics with over a 17094 half a billion degrees of freedom}, 17095 note = {Gordon Bell Award}, 17096 year = {2004} 17097} 17098 17099@Article{ adams03a, 17100 author = {Adams, M.~F.}, 17101 journal = {Numerical Linear Algebra with Applications}, 17102 number = {2-3}, 17103 pages = {141-153}, 17104 title = {Algebraic multigrid methods for constrained linear systems with applications to 17105 contact problems in solid mechanics}, 17106 volume = {11}, 17107 year = {2004} 17108} 17109 17110@Article{ adams-10a, 17111 author = {M. ~F. Adams and Ravi Samtaney and Achi Brandt}, 17112 doi = {10.1016/j.jcp.2010.04.024}, 17113 issn = {0021-9991}, 17114 journal = {Journal of Computational Physics}, 17115 keywords = {Implicit magnetohydrodynamics}, 17116 number = {18}, 17117 pages = {6208 - 6219}, 17118 title = {Toward textbook multigrid efficiency for fully implicit resistive 17119 magnetohydrodynamics}, 17120 volume = {229}, 17121 year = {2010} 17122} 17123 17124@InProceedings{ adams98, 17125 address = {Copper Mountain, CO}, 17126 author = {Adams, M.~F.}, 17127 booktitle = {Proceedings 5th Copper Mountain Conference on Iterative Methods}, 17128 title = {A Parallel Maximal Independent Set Algorithm}, 17129 year = {1998} 17130} 17131 17132@InProceedings{ madaypatera89, 17133 author = {Y. Maday and A. T. Patera}, 17134 title = {Spectral element methods for the {Navier-Stokes} equations}, 17135 editor = {A. K. Noor and J. T. Oden}, 17136 booktitle = {State-of-the-Art Surveys in Computational Mechanics}, 17137 pages = {71-–143}, 17138 publisher = {ASME}, 17139 address = {New York, NY}, 17140 year = {1989} 17141} 17142 17143@Article{ mishra2012mlmcfvm, 17144 title = {Multi-level {M}onte {C}arlo finite volume methods for nonlinear systems of 17145 conservation laws in multi-dimensions}, 17146 journal = {Journal of Computational Physics}, 17147 volume = {231}, 17148 number = {8}, 17149 pages = {3365--3388}, 17150 year = {2012}, 17151 issn = {0021-9991}, 17152 doi = {10.1016/j.jcp.2012.01.011}, 17153 author = {S. Mishra and Ch. Schwab and J. {\v S}ukys}, 17154 keywords = {Conservation laws, Euler, MHD, Uncertainty quantification, Multi-level Monte 17155 Carlo, Parallelization} 17156} 17157 17158@Article{ barth2011mlmcfe, 17159 author = {Barth, Andrea and Schwab, Christoph and Zollinger, Nathaniel}, 17160 affiliation = {ETH Zentrum, Seminar für Angewandte Mathematik, Rämistrasse 101, 8092 Zurich, 17161 Switzerland}, 17162 title = {Multi-Level {M}onte {C}arlo Finite Element method for elliptic {PDE}s with 17163 stochastic coefficients}, 17164 journal = {Numerische Mathematik}, 17165 publisher = {Springer Berlin / Heidelberg}, 17166 issn = {0029-599X}, 17167 keyword = {Mathematics and Statistics}, 17168 pages = {123-161}, 17169 volume = {119}, 17170 issue = {1}, 17171 doi = {10.1007/s00211-011-0377-0}, 17172 year = {2011} 17173} 17174 17175@Article{ nguyen2011hybridizable, 17176 title = {Hybridizable discontinuous {G}alerkin methods}, 17177 author = {Nguyen, N.C. and Peraire, J. and Cockburn, B.}, 17178 journal = {Spectral and High Order Methods for Partial Differential Equations}, 17179 pages = {63--84}, 17180 year = {2011}, 17181 publisher = {Springer} 17182} 17183 17184@Misc{ snyder-scidac3:proposal, 17185 author = {Philip {Snyder (PI)}}, 17186 title = {{Plasma Edge Advanced Computation (PEAC) Center}}, 17187 note = {proposal to DOE SciDAC3}, 17188 month = oct, 17189 year = {2011} 17190} 17191 17192@Misc{ wirth-scidac3:proposal, 17193 author = {Brian {Wirth (PI)}}, 17194 title = {{Plasma Surface Interactions: Bridging from the Surface to the Micron Frontier 17195 through Leadership Class Computing}}, 17196 note = {proposal to DOE SciDAC3}, 17197 month = oct, 17198 year = {2011} 17199} 17200 17201@Misc{ cary-scidac3:proposal, 17202 author = {John {Cary (PI)}}, 17203 title = {{Integrated Multiscale Modeling for Plasma Analysis and Control of Tokamak 17204 Stability (IMMPACTS)}}, 17205 note = {proposal to DOE SciDAC3}, 17206 month = oct, 17207 year = {2011} 17208} 17209 17210@Misc{ vashista-scidac3:proposal, 17211 author = {Priya {Vashista (PI)}}, 17212 title = {{Design of Damage-Tolerance Material Interfaces for Extreme 17213 Stress-Temperature-Corrosion Environments: Algorithms and Methods for 17214 Multi-Petaflops Simulations}}, 17215 note = {proposal to DOE SciDAC3}, 17216 month = mar, 17217 year = {2012} 17218} 17219 17220@Article{ elemental2012, 17221 author = {Jack Poulson and Bryan Marker and Jeff R. Hammond and Nichols A. Romero and 17222 Robert {v}an~{d}e~{G}eijn}, 17223 title = {Elemental: A New Framework for Distributed Memory Dense Matrix Computations}, 17224 journal = {{ACM} Transactions on Mathematical Software}, 17225 volume = {39}, 17226 number = {2}, 17227 year = {2013} 17228} 17229 17230@Misc{ elemental-web-page, 17231 author = {Jack Poulson}, 17232 title = {Elemental: Distributed memory dense linear algebra}, 17233 howpublished = {\url{http://libelemental.org}}, 17234 url = {http://libelemental.org/}, 17235 year = {2015} 17236} 17237 17238@Book{ scalesreport, 17239 title = {A Science-based Case for Large-scale Simulation}, 17240 editor = {D. E. Keyes}, 17241 publisher = {U.S. Department of Energy}, 17242 year = {2004}, 17243 url = {http://www.pnl.gov/scales} 17244} 17245 17246@InProceedings{ cilk95, 17247 address = {Santa Barbara, California}, 17248 author = {Robert D. Blumofe and Christopher F. Joerg and Bradley C. Kuszmaul and Charles E. 17249 Leiserson and Keith H. Randall and Yuli Zhou}, 17250 booktitle = {Proceedings of the Fifth ACM SIGPLAN Symposium on Principles and Practice of 17251 Parallel Programming (PPoPP)}, 17252 day = {19--21}, 17253 month = jul, 17254 pages = {207--216}, 17255 title = {{Cilk}: An Efficient Multithreaded Runtime System}, 17256 year = {1995} 17257} 17258 17259@Misc{ valgrind-web-page, 17260 author = {Julian Seward}, 17261 title = {Valgrind}, 17262 url = {http://valgrind.org/}, 17263 howpublished = {\url{http://valgrind.org/}}, 17264 year = {2012} 17265} 17266 17267@Article{ blas79, 17268 author = {C.~L. Lawson and R.~J. Hanson and D. Kincaid and F.~T. Krogh}, 17269 title = {Basic linear algebra subprograms for Fortran usage}, 17270 journal = {ACM Transactions on Mathematical Software}, 17271 volume = {5}, 17272 pages = {308--323}, 17273 year = {1979} 17274} 17275 17276@TechReport{ lapack90, 17277 author = {E. Anderson and Z. Bai and C. Bischof and J. Demmel and J. Dongarra and J. 17278 Du~Croz and A. Greenbaum and S. Hammarling and A. McKenney and D. Sorensen}, 17279 title = {{LAPACK}: A portable linear algebra library for high-performance computers}, 17280 institution = {Computer Science Dept., University of Tennessee}, 17281 number = {CS-90-105}, 17282 month = may, 17283 year = {1990} 17284} 17285 17286@TechReport{ nvidiafermi, 17287 author = {NVIDIA}, 17288 title = {{NVIDIA}'s Next Generation {CUDA} Compute Architecture: {F}ermi}, 17289 institution = {NVIDIA}, 17290 year = {2009} 17291} 17292 17293@Misc{ intelmic, 17294 author = {Many Core Group, Cambridge University}, 17295 title = {Intel Many Integrated Core Architecture}, 17296 howpublished = {\url{http://www.many-core.group.cam.ac.uk/ukgpucc2/talks/Elgar.pdf}}, 17297 month = dec, 17298 year = {2010} 17299} 17300 17301@Article{ abusufahkucklawrie81, 17302 author = {W. Abu-Sufah and D.~J. Kuck and D.~H. Lawrie}, 17303 title = {On the Performance Enhancement of Paging Systems Through Program Analysis and 17304 Transformations}, 17305 journal = {IEEE Trans. Comput.}, 17306 volume = {30}, 17307 number = {5}, 17308 pages = {341--356}, 17309 year = {1981} 17310} 17311 17312@InProceedings{ guobikshandifraguelagarzaranpadua08, 17313 author = {Guo, Jia and Bikshandi, Ganesh and Fraguela, Basilio B. and Garzaran, Maria J. 17314 and Padua, David}, 17315 title = {Programming with tiles}, 17316 booktitle = {Proceedings of the 13th ACM SIGPLAN Symposium on Principles and practice of 17317 parallel programming}, 17318 series = {PPoPP '08}, 17319 year = {2008}, 17320 isbn = {978-1-59593-795-7}, 17321 location = {Salt Lake City, UT}, 17322 pages = {111--122}, 17323 numpages = {12}, 17324 doi = {10.1145/1345206.1345225}, 17325 acmid = {1345225}, 17326 publisher = {ACM}, 17327 address = {New York, NY} 17328} 17329 17330@Article{ strout04, 17331 journal = {International Journal of High Performance Computing Applications}, 17332 year = {2004}, 17333 title = {Sparse Tiling for Stationary Iterative Methods}, 17334 month = feb, 17335 publisher = {Sage Publications}, 17336 pages = {95-114}, 17337 volume = {18}, 17338 number = {1}, 17339 author = {Michelle Mills Strout and Larry Carter and Jeanne Ferrante and Barbara Kreaseck} 17340} 17341 17342@Misc{ openclstandard, 17343 author = {Khronos Group}, 17344 title = {{OpenCL} 1.2 Specification}, 17345 howpublished = {\url{http://www.khronos.org/registry/cl/specs/opencl-1.2.pdf}}, 17346 url = {http://www.khronos.org/registry/cl/specs/opencl-1.2.pdf}, 17347 year = {2011} 17348} 17349 17350@Misc{ stlguide, 17351 author = {SGI}, 17352 title = {Standard Template Library Programmer's Guide}, 17353 howpublished = {\url{http://www.sgi.com/tech/stl/}}, 17354 url = {http://www.sgi.com/tech/stl/}, 17355 year = {2011} 17356} 17357 17358@Book{ stepanov09, 17359 author = {Alexander Stepanov and Paul McJones}, 17360 title = {Elements of Programming}, 17361 publisher = {Addison-Wesley}, 17362 isbn = {978-0-321-63537-2}, 17363 year = {2009} 17364} 17365 17366@Article{ bangerthhartmannkanschat2007, 17367 author = {W. Bangerth and R. Hartmann and G. Kanschat}, 17368 title = {{deal.II} -- a General Purpose Object Oriented Finite Element Library}, 17369 journal = {ACM Trans. Math. Softw.}, 17370 year = {2007}, 17371 volume = {33}, 17372 number = {4}, 17373 pages = {24/1--24/27} 17374} 17375 17376@Misc{ dealii-web-page, 17377 author = {W. Bangerth and R. Hartmann and G. Kanschat}, 17378 title = {{deal.II}}, 17379 howpublished = {\url{http://www.dealii.org/}}, 17380 url = {http://www.dealii.org/}, 17381 year = {2012} 17382} 17383 17384@InBook{ siek2012, 17385 title = {The C++0x ``Concepts'' Effort}, 17386 author = {Jeremy G. Siek}, 17387 editor = {Jeremy Gibbons}, 17388 booktitle = {Generic and Indexed Programming: International Spring School, SSGIP 2010, Oxford, 17389 UK, March 22-26, 2010, Revised Lectures}, 17390 pages = {175--216}, 17391 isbn = {978-3-642-32202-0}, 17392 doi = {10.1007/978-3-642-32202-0_4}, 17393 url = {http://arxiv.org/abs/1201.0027}, 17394 note = {\url{http://arxiv.org/abs/1201.0027}}, 17395 publisher = {Springer Berlin Heidelberg}, 17396 year = {2012} 17397} 17398 17399@Misc{ sharpclaw, 17400 note = {\url{http://numerics.kaust.edu.sa/sharpclaw}}, 17401 author = {Ketcheson, D. I. and Parsani, M.}, 17402 keywords = {clawpack,finite volumes,godunov type methods,high order methods,hyperbolic 17403 PDEs,sharpclaw,software}, 17404 mendeley-tags = {clawpack,finite volumes,godunov type methods,high order methods,hyperbolic 17405 PDEs,sharpclaw,software}, 17406 title = {{SharpClaw software}}, 17407 year = {2011} 17408} 17409 17410@Book{ leveque2002, 17411 title = {Finite volume methods for hyperbolic problems}, 17412 author = {Randall J LeVeque}, 17413 volume = {31}, 17414 year = {2002} 17415} 17416 17417@Misc{ clawpack45, 17418 note = {\url{http://www.clawpack.org}}, 17419 author = {LeVeque, R. J. and Berger, M. J.}, 17420 keywords = {clawpack,finite volumes,hyperbolic PDEs,software}, 17421 mendeley-tags = {clawpack,finite volumes,hyperbolic PDEs,software}, 17422 title = {{Clawpack Software version 4.5}}, 17423 url = {www.clawpack.org}, 17424 year = {2011} 17425} 17426 17427@Article{ nilsen2010, 17428 archiveprefix = {arXiv}, 17429 arxivid = {arXiv:1002.0705v1}, 17430 author = {Nilsen, J.K. and Cai, X. and H{\o}yland, Bj{\o} rn and Langtangen, H. P.}, 17431 eprint = {arXiv:1002.0705v1}, 17432 file = {:Users/ketch/Documents/Mendeley Desktop/Nilsen et al/2010 - Simplifying the 17433 parallelization of scientific codes by a function-centric approach in 17434 Python.pdf:pdf}, 17435 journal = {Computational Science \& Discovery}, 17436 keywords = {parallel,programming,python,software}, 17437 mendeley-tags = {parallel,programming,python,software}, 17438 pages = {015003}, 17439 publisher = {IOP Publishing}, 17440 title = {{Simplifying the parallelization of scientific codes by a function-centric 17441 approach in Python}}, 17442 url = {http://iopscience.iop.org/1749-4699/3/1/015003}, 17443 volume = {3}, 17444 year = {2010} 17445} 17446 17447@Book{ langtangen09, 17448 author = {Hans Petter Langtangen}, 17449 title = {Python Scripting for Computational Science}, 17450 publisher = {Springer}, 17451 series = {Texts in Computational Science and Engineering}, 17452 pages = {784}, 17453 isbn = {3540739157}, 17454 year = {2009} 17455} 17456 17457@Book{ numpyguide, 17458 author = {Travis E. Oliphant}, 17459 title = {Guide to Numpy}, 17460 publisher = {Trelgol}, 17461 year = {2008} 17462} 17463 17464@Misc{ pycuda, 17465 author = {Andreas Kl\"ockner}, 17466 title = {{PyCUDA}}, 17467 howpublished = {\url{http://mathema.tician.de/software/pycuda}}, 17468 year = {2011} 17469} 17470 17471@Misc{ pyopencl, 17472 author = {Andreas Kl\"ockner}, 17473 title = {{PyOpenCL}}, 17474 howpublished = {\url{http://mathema.tician.de/software/pyopencl}}, 17475 year = {2011} 17476} 17477 17478@Article{ klockner2012, 17479 author = {Andreas Kl\"{o}ckner and Nicolas Pinto and Yunsup Lee and Bryan Catanzaro and 17480 Paul Ivanov and Ahmed Fasih}, 17481 title = {{PyCUDA} and {PyOpenCL}: A scripting-based approach to {GPU} run-time code 17482 generation}, 17483 journal = {Parallel Computing}, 17484 volume = {38}, 17485 number = {3}, 17486 pages = {157--174}, 17487 year = {2012}, 17488 issn = {0167-8191}, 17489 doi = {10.1016/j.parco.2011.09.001} 17490} 17491 17492%%%%%% Matt Stuff %%%%%% 17493@Article{ morrabozdagknepleyrassvesselinov, 17494 title = {A Tectonic Shift in Analytics and Computing Is Coming}, 17495 author = {Gabriele Morra and Ebru Bozdag and Matthew G. Knepley and Ludovic R\"ass and 17496 Velimir Vesselinov}, 17497 journal = {Eos}, 17498 volume = {102}, 17499 doi = {10.1029/2021EO159258}, 17500 month = {Jun}, 17501 year = {2021} 17502} 17503 17504@Misc{ knepley:icerm-workshop:2012, 17505 author = {David Keyes and Matthew Knepley and Katherine Yelick}, 17506 title = {Synchronization-reducing and Communication-reducing Algorithms and Programming 17507 Models for Large-scale Simulations}, 17508 note = {Workshop sponsored by the Institute for Computational and Experimental Research 17509 in Mathematics (ICERM), Jan. 9-13, 2012, Providence, RI, 17510 \url{http://icerm.brown.edu/tw12-1-exascale}}, 17511 year = {2012} 17512} 17513 17514@TechReport{ kirbyknepleyscott04, 17515 author = {Robert C. Kirby and Matthew G. Knepley and L. Ridgway Scott}, 17516 title = {Optimal Evaluation of Finite Element Matrices}, 17517 type = {Technical Report}, 17518 number = {TR-2004-04}, 17519 institution = {University of Chicago}, 17520 url = {http://www.cs.uchicago.edu/research/publications/techreports/TR-2004-04}, 17521 note = {\url{http://www.cs.uchicago.edu/research/publications/techreports/TR-2004-04}}, 17522 pages = {14}, 17523 month = may, 17524 year = {2004} 17525} 17526 17527@TechReport{ kirbyknepleyscott10, 17528 author = {Robert C. Kirby and Matthew G. Knepley and L. Ridgway Scott}, 17529 title = {Languages and Compilers for Variational Forms}, 17530 type = {Technical Report}, 17531 number = {TR-2010-09}, 17532 institution = {University of Chicago}, 17533 url = {http://www.cs.uchicago.edu/research/publications/techreports/TR-2010-09}, 17534 note = {\url{http://www.cs.uchicago.edu/research/publications/techreports/TR-2010-09}}, 17535 month = oct, 17536 year = {2010} 17537} 17538 17539@TechReport{ kirbyknepleyscott10b, 17540 author = {Robert C. Kirby and Matthew G. Knepley and L. Ridgway Scott}, 17541 title = {Evaluation of the Action of Finite Element Operators}, 17542 type = {Technical Report}, 17543 number = {TR-2010-08}, 17544 institution = {University of Chicago}, 17545 url = {http://www.cs.uchicago.edu/research/publications/techreports/TR-2010-08}, 17546 note = {\url{http://www.cs.uchicago.edu/research/publications/techreports/TR-2010-08}}, 17547 month = oct, 17548 year = {2010} 17549} 17550 17551@TechReport{ bruneknepleyscott11, 17552 author = {Peter R. Brune and Matthew G. Knepley and L. Ridgway Scott}, 17553 title = {Exponential grids in high-dimensional space}, 17554 type = {Technical Report}, 17555 number = {TR-2011-07}, 17556 institution = {University of Chicago}, 17557 url = {http://www.cs.uchicago.edu/research/publications/techreports/TR-2011-07}, 17558 note = {\url{http://www.cs.uchicago.edu/research/publications/techreports/TR-2011-07}}, 17559 month = dec, 17560 year = {2011} 17561} 17562 17563@TechReport{ zheng11, 17564 author = {Liang Zheng and Taras Gerya and Matthew G. Knepley and David A. Yuen and Huai 17565 Zhang and Yaolin Shi}, 17566 title = {Implementation of a multigrid solver on {GPU} for {Stokes} equations with 17567 strongly variable viscosity based on {Matlab} and {CUDA}}, 17568 type = {Research Report}, 17569 number = {UMSI 2011/33}, 17570 institution = {University of Minnesota Supercomputing Institute}, 17571 url = {http://static.msi.umn.edu/rreports/2011/33.pdf}, 17572 note = {\url{http://static.msi.umn.edu/rreports/2011/33.pdf}}, 17573 month = mar, 17574 year = {2011} 17575} 17576 17577@InProceedings{ zheng2010, 17578 author = {Liang Zheng and Taras Gerya and David A. Yuen and Matthew G. Knepley and Huai 17579 Zhang and Yaolin Shi}, 17580 title = {{GPU} Implementation of {Stokes} Equation with Strongly Variable Coefficients}, 17581 booktitle = {Eos Transactions of the AGU}, 17582 organization = {American Geophysical Union}, 17583 note = {Fall Meeting Supplemental, Abstract IN41A-1350}, 17584 year = {2010} 17585} 17586 17587@InCollection{ terrelkirbyknepleyscott12, 17588 author = {Andy R. Terrel and Robert C. Kirby and Matthew G. Knepley and L. Ridgway Scott 17589 and Garth N. Wells}, 17590 title = {Finite elements for incompressible fluids}, 17591 editors = {A. Logg and K.A. Mardal and G. N. Wells}, 17592 booktitle = {Automated solutions of differential equations by the finite element method}, 17593 series = {Lecture Notes in Computational Science and Engineering}, 17594 volume = {84}, 17595 pages = {163--169}, 17596 publisher = {Springer-Verlag}, 17597 year = {2012} 17598} 17599 17600@InCollection{ mardalhaga12, 17601 author = {Kent-Andre Mardal and Joachim Berdal Haga}, 17602 title = {Block preconditioning of systems of PDEs}, 17603 editors = {A. Logg and K.A. Mardal and G. N. Wells}, 17604 booktitle = {Automated solutions of differential equations by the finite element method}, 17605 series = {Lecture Notes in Computational Science and Engineering}, 17606 volume = {84}, 17607 pages = {643--655}, 17608 publisher = {Springer-Verlag}, 17609 year = {2012} 17610} 17611 17612@InCollection{ kirbyknepleyloggscottterrel12, 17613 author = {Robert C. Kirby and Matthew G. Knepley and Anders Logg and L. Ridgway Scott and 17614 Andy R. Terrel}, 17615 title = {Discrete optimization of finite element matrix evaluation}, 17616 editors = {A. Logg and K.A. Mardal and G. N. Wells}, 17617 booktitle = {Automated solutions of differential equations by the finite element method}, 17618 series = {Lecture Notes in Computational Science and Engineering}, 17619 volume = {84}, 17620 pages = {385--397}, 17621 publisher = {Springer-Verlag}, 17622 year = {2012} 17623} 17624 17625@InCollection{ kirby12, 17626 author = {Robert C. Kirby}, 17627 title = {{FIAT}: Numerical Construction of Finite Element Basis Functions}, 17628 editors = {A. Logg and K.A. Mardal and G. N. Wells}, 17629 booktitle = {Automated solutions of differential equations by the finite element method}, 17630 series = {Lecture Notes in Computational Science and Engineering}, 17631 volume = {84}, 17632 publisher = {Springer-Verlag}, 17633 year = {2012} 17634} 17635 17636@Article{ brownconveryhotesknepleypetropolous1993, 17637 author = {Robert W. Brown and Mary Convery and Scott Hotes and Matthew G. Knepley and 17638 Labros Petropolous}, 17639 title = {Closed strings with low harmonics and kinks}, 17640 journal = {Physical Review D}, 17641 volume = {48}, 17642 number = {6}, 17643 year = {1993} 17644} 17645 17646@Article{ minimax1996, 17647 title = {MiniMax: What has been learned thus far}, 17648 author = {Mary E. Convery and W.~L. Davis and Ken W. Del Signore and Tom L. Jenkins and 17649 Erik Kangas and Matthew G. Knepley and Ken L. Kowalski and Cyrus C. Taylor and 17650 C.~H. Wang and S.~H. Oh and W.~D. Walker and P.~L. Colestock and B. Hanna and M. 17651 Martens and J. Streets and R.~C. Ball and H.~R. Gustafson and L.~W. Jones and 17652 M.~J. Longo and J.~D. Bjorken and N. Morgan and C.~A. Pruneau}, 17653 journal = {Nuovo Cimento}, 17654 volume = {19}, 17655 number = {1}, 17656 pages = {1045--1049}, 17657 year = {1996} 17658} 17659 17660@Article{ minimax1997, 17661 author = {Minimax Collaboration}, 17662 title = {Analysis of Charged Particle/Photon Correlations in Hadronic Multiparticle 17663 Production}, 17664 journal = {Physical Review D}, 17665 volume = {55}, 17666 number = {9}, 17667 year = {1997} 17668} 17669 17670@Article{ minimax2000, 17671 author = {Minimax Collaboration}, 17672 title = {Search for disoriented chiral condensate at the {Fermilab} {Tevatron}}, 17673 journal = {Physical Review D}, 17674 volume = {61}, 17675 number = {3}, 17676 year = {2000} 17677} 17678 17679@Article{ kirbyknepleyloggscott05, 17680 author = {Robert C. Kirby and Matthew G. Knepley and Anders Logg and L. Ridgway Scott}, 17681 title = {Optimizing the evaluation of finite element matrices}, 17682 journal = {SIAM Journal on Scientific Computing}, 17683 volume = {27}, 17684 number = {3}, 17685 pages = {741--758}, 17686 year = {2005} 17687} 17688 17689@Article{ bardhanknepleyanitescu2008, 17690 author = {Jaydeep P. Bardhan and Matthew G. Knepley and Mihai Anitescu}, 17691 title = {Bounding the Electrostatic Free Energies Associated with Linear Continuum Models 17692 of Molecular Solvation}, 17693 journal = {Journal of Chemical Physics}, 17694 volume = {130}, 17695 number = {10}, 17696 pages = {104108}, 17697 note = {Selected for the March 15, 2009 issue of Virtual Journal of Biological Physics 17698 Research}, 17699 doi = {10.1063/1.3081148}, 17700 year = {2008} 17701} 17702 17703%Poster at Biophysical Society Fall Meeting 17704@Article{ bardhanknepley2017, 17705 author = {Jaydeep P. Bardhan and Matthew G. Knepley}, 17706 title = {Accurate Atom-by-Atom Predictions of Solvation Electrostatics Using a 17707 Hydration-Shell {Poisson}-{Boltzmann} Model}, 17708 journal = {Biophysical Journal}, 17709 volume = {110}, 17710 number = {3}, 17711 note = {Fall Meeting Supplemental, Abstract DI14A-08}, 17712 doi = {10.1016/j.bpj.2015.11.1766}, 17713 year = {2017} 17714} 17715 17716@Article{ tabrizirahimigoossensknepleybardhan2018, 17717 title = {Solvation Thermodynamics of Neutral and Charged Solutes Using the Solvation-Layer 17718 Interface Condition (SLIC) Continuum Dielectric Model}, 17719 author = {Amirhossein Molavi Tabrizi and Ali Mehdizadeh Rahimi and Spencer Goossens and 17720 Matthew G. Knepley and Jaydeep P. Bardhan}, 17721 journal = {International Journal of Quantum Chemistry}, 17722 note = {Accepted}, 17723 year = {2018} 17724} 17725 17726@Article{ knepley2010, 17727 author = {Stodden, V. and Knepley, M. G. and Wiggins, C. and LeVeque, R. J. and Donoho, D. 17728 and Fomel, S. and Friedlander, M. P. and Gerstein, M. and Mitchell, I. and 17729 Ouellette, L. L. and Bramble, N. W. and Brown, P. O. and Carey, V. and DeNardis, 17730 L. and Gentleman, R. and {Gezelter, J}, D. and Goodman, A. and Moore, J. E. and 17731 Pasquale, F. A. and Rolnick, J. and Seringhaus, M. and Subramanian, R.}, 17732 title = {{Reproducible Research: addressing the need for data and code sharing in 17733 computational science}}, 17734 journal = {Computing in Science and Engineering}, 17735 volume = {12}, 17736 number = {5}, 17737 pages = {8--13}, 17738 url = {http://www.bepress.com/cgi/viewcontent.cgi?article=1034\&amp;context=sagmb}, 17739 year = {2010} 17740} 17741 17742@Article{ ketchesonahmadiaknepley2011, 17743 title = {Conference Review: High Performance Computing and Hybrid Programming Concepts for 17744 Hyperbolic PDE Codes}, 17745 author = {David I. Ketcheson and Aron Ahmadia and Matthew G. Knepley}, 17746 journal = {SIAM News}, 17747 volume = {44}, 17748 number = {7}, 17749 month = sep, 17750 note = {\url{http://www.siam.org/pdf/news/1912.pdf}}, 17751 year = {2011} 17752} 17753 17754@Article{ yokotabardhanknepleybarbahamada2011, 17755 author = {Rio Yokota and Jaydeep P. Bardhan and Matthew G. Knepley and L.A. Barba and 17756 Tsuyoshi Hamada}, 17757 title = {Biomolecular electrostatics using a fast multipole {BEM} on up to 512 {GPU}s and 17758 a billion unknowns}, 17759 journal = {Computer Physics Communications}, 17760 volume = {182}, 17761 number = {6}, 17762 pages = {1272--1283}, 17763 year = {2011}, 17764 issn = {0010-4655}, 17765 doi = {10.1016/j.cpc.2011.02.013}, 17766 url = {http://arxiv.org/abs/1007.4591} 17767} 17768 17769@Article{ bardhanknepley2011, 17770 author = {Jaydeep P. Bardhan and Matthew G. Knepley}, 17771 title = {Mathematical Analysis of the {BIBEE} Approximation for Molecular Solvation: Exact 17772 Results for Spherical Inclusions}, 17773 journal = {Journal of Chemical Physics}, 17774 volume = {135}, 17775 number = {12}, 17776 pages = {124107--124117}, 17777 url = {http://arxiv.org/abs/1109.0651}, 17778 note = {\url{http://arxiv.org/abs/1109.0651}}, 17779 year = {2011} 17780} 17781 17782@Article{ bruneknepleyscott2013, 17783 author = {Peter R. Brune and Matthew G. Knepley and L. Ridgway Scott}, 17784 title = {Unstructured Geometric Multigrid in Two and Three Dimensions on Complex and 17785 Graded Meshes}, 17786 journal = {SIAM Journal on Scientific Computing}, 17787 url = {http://arxiv.org/abs/1104.0261}, 17788 note = {\url{http://arxiv.org/abs/1104.0261}}, 17789 volume = {35}, 17790 number = {1}, 17791 pages = {A173--A191}, 17792 year = {2013} 17793} 17794 17795@Article{ bardhanknepley2012a, 17796 author = {Jaydeep P. Bardhan and Matthew G. Knepley}, 17797 title = {Computational science and re-discovery: open-source implementations of 17798 ellipsoidal harmonics for problems in potential theory}, 17799 journal = {Computational Science \& Discovery}, 17800 volume = {5}, 17801 pages = {014006}, 17802 note = {\url{http://arxiv.org/abs/1204.0267}}, 17803 doi = {10.1088/1749-4699/5/1/014006}, 17804 year = {2012} 17805} 17806 17807@Article{ kreienkampetal2013, 17808 author = {Amy Kreienkamp and Lucy Y. Liu and Mona S. Minkara and Matthew G. Knepley and 17809 Jaydeep P. Bardhan and Mala L. Radhakrishnan}, 17810 title = {Analysis of fast boundary-integral approximations for modeling electrostatic 17811 contributions of molecular binding}, 17812 journal = {Molecular Based Mathematical Biology}, 17813 volume = {1}, 17814 pages = {124--150}, 17815 doi = {10.2478/mlbmb-2013-0007}, 17816 issn = {2299-3266}, 17817 month = jun, 17818 note = {\url{http://www.degruyter.com/view/j/mlbmb.2012.1.issue/mlbmb-2013-0007/mlbmb-2013-0007.xml}}, 17819 year = {2013} 17820} 17821 17822@Article{ bardhanknepleybrune2015, 17823 author = {Jaydeep P. Bardhan and Matthew G. Knepley and Peter R. Brune}, 17824 title = {Analytical Nonlocal Electrostatics Using Eigenfunction Expansions of 17825 Boundary-Integral Operators}, 17826 journal = {Molecular Based Mathematical Biology}, 17827 volume = {3}, 17828 number = {1}, 17829 pages = {1--22}, 17830 doi = {10.1515/mlbmb-2015-0001}, 17831 year = {2015} 17832} 17833 17834@Article{ bardhanknepley14, 17835 author = {Jaydeep P. Bardhan and Matthew G. Knepley}, 17836 title = {Modeling Charge-Sign Asymmetric Solvation Free Energies With Nonlinear Boundary 17837 Conditions}, 17838 journal = {Journal of Chemical Physics}, 17839 volume = {141}, 17840 number = {13}, 17841 pages = {131103}, 17842 doi = {10.1063/1.4897324}, 17843 year = {2014} 17844} 17845 17846@InProceedings{ bardhantejaniwieckowskiramaswamyknepley2015, 17847 title = {A Nonlinear Boundary Condition for Continuum Models of Biomolecular 17848 Electrostatics}, 17849 author = {Jaydeep P. Bardhan and D. A. Tejani and N. S. Wieckowski and A. Ramaswamy and 17850 Matthew G. Knepley}, 17851 booktitle = {Proceedings of PIERS}, 17852 pages = {1215--1221}, 17853 month = jul, 17854 url = {http://piers.org/piersproceedings/piers2015PragueProc.php?start=250}, 17855 year = {2015} 17856} 17857 17858@Article{ tabriziknepleybardhan2016, 17859 title = {Generalising the mean spherical approximation as a multiscale, nonlinear boundary 17860 condition at the solute-solvent interface}, 17861 author = {Amirhossein Molavi Tabrizi and Matthew G. Knepley and Jaydeep P. Bardhan}, 17862 journal = {Molecular Physics}, 17863 volume = {114}, 17864 number = {16-17}, 17865 pages = {2558--2567}, 17866 doi = {10.1080/00268976.2016.1198503}, 17867 year = {2016} 17868} 17869 17870% http://tex.stackexchange.com/questions/155532/biblatex-and-pubmed-pubmed-central-ids 17871@Article{ tabrizigoossensrahimiknepleybardhan2017, 17872 title = {Predicting Solvation Free Energies and Thermodynamics in Polar Solvents and 17873 Mixtures Using a Solvation-Layer Interface Condition}, 17874 author = {Amirhossein Molavi Tabrizi and Spencer Goossens and Ali Mehdizadeh Rahimi and 17875 Matthew G. Knepley and Jaydeep P. Bardhan}, 17876 journal = {Journal of Chemical Physics}, 17877 volume = {146}, 17878 number = {9}, 17879 pages = {094103}, 17880 url = {http://scitation.aip.org/content/aip/journal/jcp/146/9/10.1063/1.4977037}, 17881 eprint = {https://arxiv.org/abs/1611.02150}, 17882 doi = {10.1063/1.4977037}, 17883 note = {PMCID: PMC5336475}, 17884 year = {2017} 17885} 17886 17887@Article{ tabrizigoossenscooperknepleybardhan2017, 17888 title = {Extending the Solvation-Layer Interface Condition {(SLIC)} Continum Electrostatic 17889 Model to Linearized {Poisson}-{Boltzmann} Solvent}, 17890 author = {Amirhossein Molavi Tabrizi and Spencer Goossens and Christopher D. Cooper and 17891 Matthew G. Knepley and Jaydeep P. Bardhan}, 17892 number = {6}, 17893 pages = {2897--2914}, 17894 journal = {Journal of Chemical Theory and Computation}, 17895 year = {2017} 17896} 17897 17898@InProceedings{ mcclanahan2011, 17899 author = {McClanahan, C and Czechowski, Kent and Battaglino, Casey and Iyer, K and Yeung, P 17900 K and Vuduc, Richard}, 17901 booktitle = {Proc. ACM/IEEE Conf. Supercomputing (SC)}, 17902 title = {{Prospects for scalable 3D FFTs on heterogeneous exascale systems}}, 17903 url = {http://mcclanahoochie.com/blog/wp-content/uploads/2011/01/fft-sc11.pdf}, 17904 year = {2011} 17905} 17906 17907@TechReport{ ghysels_ashby_meerbergen_vanroose_2012, 17908 author = {Ghysels, P. and Ashby, T.J. and Meerbergen, K. and Vanroose, W.}, 17909 institution = {Intel Exascience Lab}, 17910 address = {Leuven, Belgium}, 17911 number = {04.2012.1}, 17912 type = {Tech. report}, 17913 title = {Hiding global communication latency in the {GMRES} algorithm on massively 17914 parallel machines}, 17915 url = {http://twna.ua.ac.be/sites/twna.ua.ac.be/files/latency_gmres.pdf}, 17916 year = {2012} 17917} 17918 17919@Article{ ghyselsashbymeerbergenvanroose2013, 17920 author = {Ghysels, P. and Ashby, T.J. and Meerbergen, K. and Vanroose, W.}, 17921 title = {Hiding global communication latency in the {GMRES} algorithm on massively 17922 parallel machines}, 17923 journal = {SIAM Journal on Scientific Computing}, 17924 volume = {35}, 17925 number = {1}, 17926 pages = {C48--C71}, 17927 year = {2013} 17928} 17929 17930@Article{ ghyselsvanroose2014, 17931 author = {P. Ghysels and W. Vanroose}, 17932 title = {Hiding Global Synchronization Latency in the Preconditioned Conjugate Gradient 17933 Algorithm}, 17934 journal = {Parallel Computing}, 17935 volume = {40}, 17936 number = {7}, 17937 pages = {224--238}, 17938 note = {7th Workshop on Parallel Matrix Algorithms and Applications}, 17939 doi = {10.1016/j.parco.2013.06.001}, 17940 year = {2014} 17941} 17942 17943@InProceedings{ strzodkagoddeke06, 17944 author = {R. Strzodka and D. G\"oddeke}, 17945 title = {Pipelined Mixed Precision Algorithms on {FPGA}s for Fast and Accurate PDE Solvers 17946 from Low Precision Components}, 17947 booktitle = {Proceedings of the 14th Annual IEEE Symposium on Field-Programmable Custom 17948 Computing Machines}, 17949 note = {FCCM ’06}, 17950 pages = {259--270}, 17951 year = {2006}, 17952 organization = {IEEE Computer Society} 17953} 17954 17955@InCollection{ jacquesnicolasvollaire12, 17956 author = {T. Jacques and L. Nicolas and C. Vollaire}, 17957 title = {Electromagnetic Scattering with the Boundary Integral Method on {MIMD} Systems}, 17958 editors = {P. Sloot, M. Bubak, A. Hoekstra, and B. Hertzberger}, 17959 booktitle = {High-Performance Computing and Networking}, 17960 series = {Lecture Notes in Computer Science}, 17961 volume = {1593}, 17962 pages = {1025--1031}, 17963 publisher = {Springer}, 17964 year = {1999} 17965} 17966 17967@InProceedings{ hoeflerlumsdainerehm07, 17968 author = {T. Hoefler and A. Lumsdaine and W. Rehm}, 17969 title = {{Implementation and Performance Analysis of Non-Blocking Collective Operations 17970 for MPI}}, 17971 booktitle = {Proceedings of the 2007 International Conference on High Performance Computing, 17972 Networking, Storage and Analysis, SC07}, 17973 location = {Reno, NV}, 17974 publisher = {IEEE Computer Society/ACM}, 17975 source = {http://www.unixer.de/~htor/publications/}, 17976 month = nov, 17977 year = {2007} 17978} 17979 17980@InProceedings{ hoeflersiebretlumsdaine10, 17981 author = {T. Hoefler and C. Siebert and A. Lumsdaine}, 17982 title = {{Scalable Communication Protocols for Dynamic Sparse Data Exchange}}, 17983 booktitle = {Proceedings of the 2010 ACM SIGPLAN Symposium on Principles and Practice of 17984 Parallel Programming (PPoPP'10)}, 17985 month = jan, 17986 location = {Bangalore, India}, 17987 publisher = {ACM}, 17988 isbn = {978-1-60558-708-0}, 17989 source = {http://www.unixer.de/~htor/publications/}, 17990 pages = {159--168}, 17991 year = {2010} 17992} 17993 17994@Article{ ruppweinbubjungelgrasser15, 17995 title = {Pipelined iterative solvers with kernel fusion for graphics processing units}, 17996 author = {Rupp, Karl and Weinbub, Josef and J{\"u}ngel, Ansgar and Grasser, Tibor}, 17997 journal = {ACM Transactions on Mathematical Software (TOMS)}, 17998 volume = {43}, 17999 number = {2}, 18000 pages = {11}, 18001 year = {2016}, 18002 publisher = {ACM} 18003} 18004 18005@Article{ bai_hu_reichel_1994, 18006 title = {A {Newton} basis {GMRES} implementation}, 18007 volume = {14}, 18008 url = {}, 18009 number = {}, 18010 journal = {IMA Journal of Numerical Analysis}, 18011 author = {Z. Bai and D. Hu and L. Reichel}, 18012 year = {1994}, 18013 pages = {563--581} 18014} 18015 18016@Article{ chronopoulos_gear_1989, 18017 title = {{S-step} iterative methods for symmetric linear systems}, 18018 volume = {25}, 18019 url = {}, 18020 number = {}, 18021 journal = {Journal of Computational and Applied Mathematics}, 18022 author = {A. T. Chronopoulos and C. W. Gear}, 18023 year = {1989}, 18024 pages = {153--168} 18025} 18026 18027@Article{ chronopoulos_1996, 18028 title = {Parallel Iterative {S-step} Methods for Unsymmetric Linear Systems}, 18029 author = {A. T. Chronopoulos and C. D. Swanson}, 18030 journal = {Parallel Computing}, 18031 volume = {22}, 18032 number = {5}, 18033 year = {1996}, 18034 pages = {623--641} 18035} 18036 18037@Article{ chronopoulos_2010, 18038 author = {A. T. Chronopoulos and A. Kucherov}, 18039 title = {Block {S-step} {Krylov} Iterative Methods}, 18040 journal = {Numerical Linear Algebra with Applications}, 18041 volume = {17}, 18042 number = {1}, 18043 pages = {3--15}, 18044 year = {2010} 18045} 18046 18047@Article{ sturler_vorst_1995, 18048 title = {Reducing the effect of global communication in {GMRES(m)} and {CG} on parallel 18049 distributed memory computers}, 18050 volume = {18}, 18051 url = {}, 18052 number = {}, 18053 journal = {Applied Numerical Mathematics}, 18054 author = {E. De Sturler and H. A. van der Vorst}, 18055 year = {1995}, 18056 pages = {441--459} 18057} 18058 18059@Article{ joubert_carey_1992, 18060 title = {Parallelizable restarted iterative methods for nonsymmetric linear systems. part 18061 I: Theory}, 18062 volume = {44}, 18063 url = {}, 18064 number = {}, 18065 journal = {International journal of computer mathematics}, 18066 author = {W. D. Joubert and G. F. Carey}, 18067 year = {1992}, 18068 pages = {243--267} 18069} 18070 18071@Article{ elman_saadsaylor_1986, 18072 title = {A hybrid {Chebyshev} {Krylov}-subspace algorithm for solving nonsymmetric systems 18073 of linear equations}, 18074 volume = {7}, 18075 url = {}, 18076 number = {3}, 18077 journal = {SIAM Journal on Scientific and Statistical Computing}, 18078 author = {Howard Elman and Y. Saad and P. E. Saylor}, 18079 year = {1986}, 18080 pages = {840--855} 18081} 18082 18083@Article{ golub95innerand, 18084 author = {Eldar Giladi and Gene H. Golub and Joseph B. Keller}, 18085 title = {Inner and outer iterations for the {Chebyshev} algorithm}, 18086 journal = {SIAM J. Numer. Anal}, 18087 year = {1995}, 18088 volume = {35}, 18089 pages = {300--319} 18090} 18091 18092@Article{ golub_varga_1961, 18093 title = {{Chebyshev} semi-iterative methods, successive overrelaxation iterative methods, 18094 and second-order {Richardson} iterative methods, parts {I} and {II}}, 18095 volume = {3}, 18096 url = {}, 18097 number = {}, 18098 journal = {Numer. Math.}, 18099 author = {Gene Golub and R.S. Varga}, 18100 year = {1961}, 18101 pages = {147--168} 18102} 18103 18104@Article{ el_maliki_guenette_fortin_2011, 18105 title = {An efficient hierarchical preconditioner for quadratic discretizations of finite 18106 element problems}, 18107 volume = {18}, 18108 doi = {10.1002/nla.757}, 18109 number = {5}, 18110 journal = {Numerical Linear Algebra with Applications}, 18111 author = {A. {El maliki} and R. Guenette and M. Fortin}, 18112 year = {2011}, 18113 pages = {789-803} 18114} 18115 18116@Article{ adavani2008multigrid, 18117 title = {Multigrid Algorithms for Inverse Problems with Linear Parabolic {PDE} 18118 Constraints}, 18119 author = {Adavani, S.S. and Biros, G.}, 18120 journal = {SIAM Journal on Scientific Computing}, 18121 volume = {31}, 18122 number = {1}, 18123 pages = {369--397}, 18124 year = {2008}, 18125 publisher = {Society for Industrial and Applied Mathematics} 18126} 18127 18128@Article{ horton1995space, 18129 title = {A space-time multigrid method for parabolic {PDE}s}, 18130 author = {Horton, G. and Vandewalle, S.}, 18131 journal = {SIAM Journal on Scientific Computing}, 18132 volume = {16}, 18133 number = {4}, 18134 pages = {848--864}, 18135 year = {1995} 18136} 18137 18138@Article{ lewis2005model, 18139 title = {Model problems for the multigrid optimization of systems governed by differential 18140 equations}, 18141 author = {Lewis, R.M. and Nash, S.G.}, 18142 journal = {SIAM Journal on Scientific Computing}, 18143 volume = {26}, 18144 number = {6}, 18145 pages = {1811--1837}, 18146 year = {2005}, 18147 publisher = {Philadelphia, PA: SIAM, c1993-} 18148} 18149 18150@Article{ nash2000mgopt, 18151 title = {A multigrid approach to discretized optimization problems}, 18152 author = {Nash, S.G.}, 18153 journal = {Optimization Methods and Software}, 18154 volume = {14}, 18155 number = {1-2}, 18156 pages = {99--116}, 18157 year = {2000}, 18158 publisher = {Taylor \& Francis} 18159} 18160 18161@Article{ borzi2009multigrid, 18162 title = {Multigrid Methods for {PDE} Optimization}, 18163 author = {Borz{\`i}, A. and Schulz, V.}, 18164 journal = {SIAM Review}, 18165 volume = {51}, 18166 pages = {361}, 18167 year = {2009} 18168} 18169 18170@Article{ borzi2005multigrid, 18171 title = {A multigrid scheme for elliptic constrained optimal control problems}, 18172 author = {Borz{\`i}, A. and Kunisch, K.}, 18173 journal = {Computational Optimization and Applications}, 18174 volume = {31}, 18175 number = {3}, 18176 pages = {309--333}, 18177 year = {2005}, 18178 publisher = {Springer} 18179} 18180 18181@Article{ borzi2003multigrid, 18182 title = {Multigrid methods for parabolic distributed optimal control problems}, 18183 author = {Borz{\`i}, A.}, 18184 journal = {Journal of Computational and Applied Mathematics}, 18185 volume = {157}, 18186 number = {2}, 18187 pages = {365--382}, 18188 year = {2003}, 18189 publisher = {Elsevier} 18190} 18191 18192@Article{ ito2002receding, 18193 title = {Receding horizon optimal control for infinite dimensional systems}, 18194 author = {Ito, K. and Kunisch, K.}, 18195 journal = {ESAIM: Control, Optimisation and Calculus of Variations}, 18196 volume = {8}, 18197 number = {1}, 18198 pages = {741--760}, 18199 year = {2002}, 18200 publisher = {Cambridge University Press} 18201} 18202 18203@Article{ schulz1998solving, 18204 title = {Solving discretized optimization problems by partially reduced {SQP} methods}, 18205 author = {Schulz, V.H.}, 18206 journal = {Computing and Visualization in Science}, 18207 volume = {1}, 18208 number = {2}, 18209 pages = {83--96}, 18210 year = {1998}, 18211 publisher = {Springer} 18212} 18213 18214@Article{ hazra2005aerodynamic, 18215 title = {Aerodynamic shape optimization using simultaneous pseudo-timestepping}, 18216 author = {Hazra, S.B. and Schulz, V. and Brezillon, J. and Gauger, N.R.}, 18217 journal = {Journal of Computational Physics}, 18218 volume = {204}, 18219 number = {1}, 18220 pages = {46--64}, 18221 year = {2005}, 18222 publisher = {Elsevier} 18223} 18224 18225@Article{ mandel1985multilevel, 18226 title = {On multilevel iterative methods for integral equations of the second kind and 18227 related problems}, 18228 author = {Mandel, J.}, 18229 journal = {Numerische Mathematik}, 18230 volume = {46}, 18231 number = {1}, 18232 pages = {147--157}, 18233 year = {1985}, 18234 publisher = {Springer} 18235} 18236 18237@Article{ king1992multilevel, 18238 title = {Multilevel algorithms for ill-posed problems}, 18239 author = {King, J.T.}, 18240 journal = {Numerische Mathematik}, 18241 volume = {61}, 18242 number = {1}, 18243 pages = {311--334}, 18244 year = {1992}, 18245 publisher = {Springer} 18246} 18247 18248@Article{ kaltenbacher2001regularizing, 18249 title = {On the regularizing properties of a full multigrid method for ill-posed 18250 problems}, 18251 author = {Kaltenbacher, B.}, 18252 journal = {Inverse Problems}, 18253 volume = {17}, 18254 pages = {767}, 18255 year = {2001}, 18256 publisher = {IOP Publishing} 18257} 18258 18259@Article{ kaltenbacher2002multi, 18260 title = {A multi-grid method with a priori and a posteriori level choice for the 18261 regularization of nonlinear ill-posed problems}, 18262 author = {Kaltenbacher, B. and Schicho, J.}, 18263 journal = {Numerische Mathematik}, 18264 volume = {93}, 18265 number = {1}, 18266 pages = {77--107}, 18267 year = {2002}, 18268 publisher = {Springer} 18269} 18270 18271@Article{ burger2006regularizing, 18272 title = {Regularizing {N}ewton-{K}aczmarz Methods for Nonlinear Ill-Posed Problems}, 18273 author = {Burger, M. and Kaltenbacher, B.}, 18274 journal = {SIAM Journal on Numerical Analysis}, 18275 volume = {44}, 18276 pages = {153}, 18277 year = {2006} 18278} 18279 18280@Article{ draganescu2008optimal, 18281 title = {Optimal order multilevel preconditioners for regularized ill-posed problems}, 18282 author = {Andrei Dr{\u{a}}g{\u{a}}nescu and Todd F. Dupont}, 18283 journal = {Mathematics of Computation}, 18284 volume = {77}, 18285 number = {264}, 18286 pages = {2001--2038}, 18287 year = {2008} 18288} 18289 18290@Article{ bastian1998additive, 18291 title = {Additive and multiplicative multi-grid---a comparison}, 18292 author = {Bastian, P. and Wittum, G. and Hackbusch, W.}, 18293 journal = {Computing}, 18294 volume = {60}, 18295 number = {4}, 18296 pages = {345--364}, 18297 year = {1998}, 18298 publisher = {Springer} 18299} 18300 18301@Article{ fournier2001multiplicative, 18302 title = {Multiplicative and additive parallel multigrid algorithms for the acceleration of 18303 compressible flow computations on unstructured meshes}, 18304 author = {Fournier, L. and Lanteri, S.}, 18305 journal = {Applied Numerical Mathematics}, 18306 volume = {36}, 18307 number = {4}, 18308 pages = {401--426}, 18309 year = {2001}, 18310 publisher = {Elsevier} 18311} 18312 18313@Article{ chow2006survey, 18314 title = {A survey of parallelization techniques for multigrid solvers}, 18315 author = {Chow, E. and Falgout, R.D. and Hu, J.J. and Tuminaro, R.S. and Yang, U.M.}, 18316 journal = {Parallel Processing for Scientific Computing, MA Heroux, P. Raghavan, and HD 18317 Simon, eds}, 18318 volume = {20}, 18319 pages = {179--201}, 18320 year = {2006} 18321} 18322 18323@InBook{ brandt2001multiscale, 18324 title = {Multiscale scientific computation: {R}eview 2001}, 18325 author = {Brandt, A.}, 18326 booktitle = {Multiscale and Multiresolution Methods: Theory and Applications}, 18327 editors = {Barth, T.J. and Chan, T.F. and Haimes, R.}, 18328 series = {Lecture Notes in Computational Science and Engineering}, 18329 year = {2001}, 18330 volume = {20}, 18331 pages = {3--96}, 18332 publisher = {Springer Verlag} 18333} 18334 18335@InCollection{ brandt2003multigrid, 18336 title = {Multigrid solvers and multilevel optimization strategies}, 18337 author = {Brandt, A. and Ron, D.}, 18338 booktitle = {Multilevel Optimization and VLSICAD}, 18339 editors = {J. Cong and J.R. Shinnerl}, 18340 pages = {1--69}, 18341 publisher = {Kluwer Academic Publishers}, 18342 year = {2003} 18343} 18344 18345@InBook{ brandt2009principles, 18346 title = {Principles of systematic upscaling}, 18347 author = {Brandt, A.}, 18348 booktitle = {Bridging the Scales in Science and Engineering}, 18349 editors = {J. Fish}, 18350 publisher = {Oxford University Press}, 18351 pages = {193--215}, 18352 year = {2009} 18353} 18354 18355@Article{ livne2004coarsening, 18356 title = {Coarsening by compatible relaxation}, 18357 author = {Livne, O.E.}, 18358 journal = {Numerical Linear Algebra with Applications}, 18359 volume = {11}, 18360 number = {2-3}, 18361 pages = {205--227}, 18362 year = {2004}, 18363 publisher = {Wiley Online Library} 18364} 18365 18366@InProceedings{ brandt1986stochastic, 18367 title = {Multi-Level Approaches to Discrete-State and Stochastic Problems}, 18368 author = {Brandt, A. and Ron, D. and Amit, D.J.}, 18369 booktitle = {Multigrid methods II: proceedings of the 2nd European Conference on Multigrid 18370 Methods, held at Cologne, October 1-4, 1985}, 18371 volume = {1228}, 18372 pages = {65--98}, 18373 year = {1986}, 18374 organization = {Springer} 18375} 18376 18377@Article{ halko2011finding, 18378 author = {Nathan Halko and Per-Gunnar Martinsson and Joel A. Tropp}, 18379 title = {Finding Structure with Randomness: Probabilistic Algorithms for Constructing 18380 Approximate Matrix Decompositions}, 18381 journal = {SIAM Review}, 18382 volume = {53}, 18383 number = {2}, 18384 year = {2011}, 18385 pages = {217-288}, 18386 doi = {10.1137/090771806} 18387} 18388 18389@InProceedings{ mhdy09, 18390 author = {Mohiyuddin, M. and Hoemmen, M. and Demmel, J. and Yelick, K.}, 18391 booktitle = {Proceedings of SC09}, 18392 organization = {ACM}, 18393 title = {Minimizing communication in sparse matrix solvers}, 18394 doi = {10.1145/1654059.1654096}, 18395 year = {2009} 18396} 18397 18398@InProceedings{ vanrosendale83, 18399 title = {Minimizing inner product data dependencies in conjugate gradient iteration}, 18400 booktitle = {Proceedings of the IEEE International Conference on Parallel Processing}, 18401 author = {J. van Rosendale}, 18402 year = {1983}, 18403 publisher = {IEEE Computer Society} 18404} 18405 18406@PhDThesis{ vuduc95, 18407 title = {Quantitative performance modeling of scientific computations and creating 18408 locality in numerical algorithms}, 18409 author = {R. Vuduc}, 18410 journal = {Massachusetts Institute of Technology}, 18411 school = {Massachusetts Institute of Technology}, 18412 year = {1995} 18413} 18414 18415@Article{ simoncini2003flexible, 18416 title = {Flexible inner-outer {Krylov} subspace methods}, 18417 author = {Simoncini, V. and Szyld, D.B.}, 18418 journal = {SIAM Journal on Numerical Analysis}, 18419 pages = {2219--2239}, 18420 year = {2003}, 18421 publisher = {JSTOR} 18422} 18423 18424@Article{ parks2006recycling, 18425 title = {Recycling {K}rylov Subspaces for Sequences of Linear Systems}, 18426 author = {Parks, M.L. and de Sturler, E. and Mackey, G. and Johnson, D.D. and Maiti, S.}, 18427 journal = {SIAM Journal on Scientific Computing}, 18428 volume = {28}, 18429 number = {5}, 18430 pages = {1651--1674}, 18431 year = {2006}, 18432 publisher = {Society for Industrial and Applied Mathematics} 18433} 18434 18435@Article{ freund2003model, 18436 title = {Model reduction methods based on Krylov subspaces}, 18437 author = {Freund, R.W.}, 18438 journal = {Acta Numerica}, 18439 volume = {12}, 18440 number = {1}, 18441 pages = {267--319}, 18442 year = {2003}, 18443 publisher = {Cambridge Univ Press} 18444} 18445 18446@InBook{ gutknecht2006block, 18447 title = {Block {K}rylov space methods for linear systems with multiple right-hand sides: 18448 an introduction}, 18449 booktitle = {Modern Mathematical Models, Methods and Algorithms for Real World Systems}, 18450 author = {Gutknecht, M.H.}, 18451 editors = {Siddiqi A.H. and Duff I.S. and Christensen O.}, 18452 publisher = {Anamaya Publishers}, 18453 location = {New Delhi}, 18454 pages = {420-447}, 18455 year = {2006} 18456} 18457 18458@Article{ moulton1998black, 18459 title = {The black box multigrid numerical homogenization algorithm}, 18460 author = {Moulton, J.D. and Dendy, J.E. and Hyman, J.M. and others}, 18461 journal = {Journal of Computational Physics}, 18462 volume = {142}, 18463 number = {1}, 18464 pages = {80--108}, 18465 year = {1998}, 18466 publisher = {Elsevier} 18467} 18468 18469@Article{ neuss2001homogenization, 18470 title = {Homogenization and multigrid}, 18471 author = {Neuss, N. and J{\"a}ger, W. and Wittum, G.}, 18472 journal = {Computing}, 18473 volume = {66}, 18474 number = {1}, 18475 pages = {1--26}, 18476 year = {2001}, 18477 publisher = {Springer} 18478} 18479 18480@Article{ bai2002krylov, 18481 title = {Krylov subspace techniques for reduced-order modeling of large-scale dynamical 18482 systems}, 18483 author = {Bai, Z.}, 18484 journal = {Applied Numerical Mathematics}, 18485 volume = {43}, 18486 number = {1}, 18487 pages = {9--44}, 18488 year = {2002}, 18489 publisher = {Elsevier} 18490} 18491 18492@InProceedings{ dong2003piecewise, 18493 title = {Piecewise polynomial nonlinear model reduction}, 18494 author = {Dong, N. and Roychowdhury, J.}, 18495 booktitle = {Design Automation Conference, 2003. Proceedings}, 18496 pages = {484--489}, 18497 year = {2003}, 18498 organization = {IEEE} 18499} 18500 18501@Article{ bond2009stable, 18502 title = {Stable reduced models for nonlinear descriptor systems through piecewise-linear 18503 approximation and projection}, 18504 author = {Bond, B.N. and Daniel, L.}, 18505 journal = {IEEE Transactions on Computer-Aided Design of Integrated Circuits and Systems}, 18506 volume = {28}, 18507 number = {10}, 18508 pages = {1467--1480}, 18509 year = {2009}, 18510 publisher = {IEEE} 18511} 18512 18513@Article{ xin2000front, 18514 title = {Front Propagation in Heterogeneous Media}, 18515 author = {Xin, J.}, 18516 journal = {SIAM Review}, 18517 volume = {42}, 18518 number = {2}, 18519 pages = {161--230}, 18520 year = {2000}, 18521 publisher = {Society for Industrial and Applied Mathematics} 18522} 18523 18524@Article{ owhadi2011localized, 18525 title = {Localized Bases for Finite-Dimensional Homogenization Approximations with 18526 Nonseparated Scales and High Contrast}, 18527 author = {Owhadi, H. and Zhang, L.}, 18528 journal = {Multiscale Modeling and Simulation}, 18529 volume = {9}, 18530 pages = {1373}, 18531 year = {2011} 18532} 18533 18534@Article{ berlyand2010flux, 18535 title = {Flux norm approach to finite dimensional homogenization approximations with 18536 non-separated scales and high contrast}, 18537 author = {Berlyand, L. and Owhadi, H.}, 18538 journal = {Archive for rational mechanics and analysis}, 18539 volume = {198}, 18540 number = {2}, 18541 pages = {677--721}, 18542 year = {2010}, 18543 publisher = {Springer} 18544} 18545 18546@Article{ babuska2011optimal, 18547 title = {Optimal Local Approximation Spaces for Generalized Finite Element Methods with 18548 Application to Multiscale Problems}, 18549 author = {Babuska, I. and Lipton, R.}, 18550 journal = {Multiscale Modeling \& Simulation}, 18551 volume = {9}, 18552 pages = {373}, 18553 year = {2011} 18554} 18555 18556@Article{ boettinger2002phase, 18557 title = {Phase-Field Simulation of Solidification}, 18558 author = {Boettinger, W.J. and Warren, J.A. and Beckermann, C. and Karma, A.}, 18559 journal = {Annual review of materials research}, 18560 volume = {32}, 18561 number = {1}, 18562 pages = {163--194}, 18563 year = {2002}, 18564 publisher = {Annual Reviews} 18565} 18566 18567@Article{ karma1998quantitative, 18568 title = {Quantitative phase-field modeling of dendritic growth in two and three 18569 dimensions}, 18570 author = {Karma, A. and Rappel, W.J.}, 18571 journal = {Physical Review E}, 18572 volume = {57}, 18573 number = {4}, 18574 pages = {4323}, 18575 year = {1998}, 18576 publisher = {APS} 18577} 18578 18579@Article{ chen2002phase, 18580 title = {Phase-field models for microstructure evolution}, 18581 author = {Chen, L.Q.}, 18582 journal = {Annual review of materials research}, 18583 volume = {32}, 18584 number = {1}, 18585 pages = {113--140}, 18586 year = {2002}, 18587 publisher = {Annual Reviews} 18588} 18589 18590@Article{ galbally2010reductionuq, 18591 title = {Non-linear model reduction for uncertainty quantification in large-scale inverse 18592 problems}, 18593 author = {Galbally, D. and Fidkowski, K. and Willcox, K. and Ghattas, O.}, 18594 journal = {International journal for numerical methods in engineering}, 18595 volume = {81}, 18596 number = {12}, 18597 pages = {1581--1608}, 18598 year = {2010}, 18599 publisher = {Wiley Online Library} 18600} 18601 18602@Article{ griebel1995abstract, 18603 title = {On the abstract theory of additive and multiplicative {Schwarz} algorithms}, 18604 author = {Griebel, M. and Oswald, P.}, 18605 journal = {Numerische Mathematik}, 18606 volume = {70}, 18607 number = {2}, 18608 pages = {163--180}, 18609 year = {1995}, 18610 publisher = {Springer} 18611} 18612 18613@InProceedings{ voutchkov2006multiobjective, 18614 title = {Multiobjective optimization using surrogates}, 18615 author = {Voutchkov, I. and Keane, A.J.}, 18616 booktitle = {Adaptive Computing in Design and Manufacture}, 18617 pages = {167--175}, 18618 year = {2006}, 18619 publisher = {The MC Escher Company} 18620} 18621 18622@Article{ leary2001constraint, 18623 title = {A constraint mapping approach to the structural optimization of an expensive 18624 model using surrogates}, 18625 author = {Leary, S.J. and Bhaskar, A. and Keane, A.J.}, 18626 journal = {Optimization and Engineering}, 18627 volume = {2}, 18628 number = {4}, 18629 pages = {385--398}, 18630 year = {2001}, 18631 publisher = {Springer} 18632} 18633 18634@InProceedings{ legresley2000airfoil, 18635 title = {Airfoil design optimization using reduced order models based on proper orthogonal 18636 decomposition}, 18637 author = {LeGresley, P.A. and Alonso, J.J.}, 18638 booktitle = {Fluids 2000 Conference and Exhibit, Denver, CO}, 18639 year = {2000} 18640} 18641 18642@Book{ myers2009response, 18643 title = {Response surface methodology: process and product optimization using designed 18644 experiments}, 18645 author = {Myers, R.H. and Montgomery, D.C. and Anderson-Cook, C.M.}, 18646 volume = {705}, 18647 year = {2009}, 18648 publisher = {John Wiley \& Sons} 18649} 18650 18651@Article{ carlberg2012gnat, 18652 title = {The {GNAT} method for nonlinear model reduction: effective implementation and 18653 application to computational fluid dynamics and turbulent flows}, 18654 author = {Kevin Carlberg and Charbel Farhat and Julien Cortial and David Amsallem}, 18655 journal = {arXiv}, 18656 volume = {1207.1349}, 18657 year = {2012} 18658} 18659 18660@Article{ biros2008multilevel, 18661 title = {A multilevel algorithm for inverse problems with elliptic {PDE} constraints}, 18662 author = {Biros, G. and Dogan, G.}, 18663 journal = {Inverse Problems}, 18664 volume = {24}, 18665 pages = {034010}, 18666 year = {2008}, 18667 publisher = {IOP Publishing} 18668} 18669 18670@Article{ rees2010optimal, 18671 title = {Optimal Solvers for {PDE}-Constrained Optimization}, 18672 author = {Rees, T. and Dollar, H.S. and Wathen, A.J.}, 18673 journal = {SIAM Journal on Scientific Computing}, 18674 volume = {32}, 18675 pages = {271}, 18676 year = {2010} 18677} 18678 18679@Article{ rees2010block, 18680 title = {Block-triangular preconditioners for {PDE}-constrained optimization}, 18681 author = {Rees, T. and Stoll, M.}, 18682 journal = {Numerical Linear Algebra with Applications}, 18683 volume = {17}, 18684 number = {6}, 18685 pages = {977--996}, 18686 year = {2010}, 18687 publisher = {Wiley Online Library} 18688} 18689 18690@Article{ rees2011preconditioning, 18691 title = {Preconditioning Iterative Methods for the Optimal Control of the {S}tokes 18692 Equations}, 18693 author = {Rees, T. and Wathen, A.J.}, 18694 journal = {SIAM Journal on Scientific Computing}, 18695 volume = {33}, 18696 number = {5}, 18697 pages = {2903--2926}, 18698 year = {2011}, 18699 publisher = {Society for Industrial and Applied Mathematics} 18700} 18701 18702@Article{ vogel2007fbicg, 18703 title = {Flexible {BiCG} and flexible {Bi-CGSTAB} for nonsymmetric linear systems}, 18704 author = {Vogel,J.A.}, 18705 journal = {Applied Mathematics and Computation}, 18706 volume = {188}, 18707 number = {1}, 18708 pages = {226–-233}, 18709 year = {2007}, 18710 publisher = {Elsevier} 18711} 18712 18713@Unpublished{ leehammond2010, 18714 author = {B. Lee and G.E. Hammond}, 18715 title = {Parallel Performance of Preconditioned {Krylov} Solvers for the {Richards} 18716 Equation}, 18717 key = {multigrid}, 18718 note = {manuscript, 2010} 18719} 18720 18721@Article{ vandeneshop2004inexact, 18722 title = {Inexact {Krylov} Subspace Methods for Linear Systems}, 18723 author = {Jasper {van den} Eshof and Gerard L. G. Sleijpen}, 18724 journal = {SIAM Journal on Matrix Analysis and Applications}, 18725 volume = {26}, 18726 number = {1}, 18727 pages = {125--153}, 18728 year = {2004} 18729} 18730 18731@Article{ fbicg.fbcgs, 18732 title = {Flexible {BiCG} and flexible {Bi-CGSTAB} for nonsymmetric linear systems}, 18733 author = {Judith A. Vogel}, 18734 journal = {Applied Mathematics and Computation}, 18735 volume = {188}, 18736 number = {1}, 18737 pages = {226--233}, 18738 year = {2007} 18739} 18740 18741@Article{ simoncini2003inexact, 18742 title = {Theory of Inexact {Krylov} Subspace Methods and Applications to Scientific 18743 Computing}, 18744 author = {Valeria Simoncini and Daniel B. Szyld}, 18745 journal = {SIAM Journal on Scientific Computing}, 18746 volume = {25}, 18747 number = {2}, 18748 pages = {454--477}, 18749 year = {2003} 18750} 18751 18752@Article{ fqmr, 18753 title = {{FQMR}: A Flexible {Quasi-Minimal Residual} Method with Inexact Preconditioning}, 18754 author = {Daniel B. Szyld and Judith A. Vogel}, 18755 journal = {SIAM Journal on Scientific Computing}, 18756 volume = {23}, 18757 number = {2}, 18758 pages = {363--380}, 18759 year = {2001} 18760} 18761 18762@Article{ ipcg, 18763 title = {Inexact Preconditioned {Conjugate Gradient} Method with Inner-Outer Iteration}, 18764 author = {Gene H. Golub and Qiang Ye}, 18765 journal = {SIAM Journal on Scientific Computing}, 18766 volume = {21}, 18767 number = {4}, 18768 pages = {1305--1320}, 18769 year = {1999} 18770} 18771 18772@Article{ idr.sonneveld, 18773 title = {{IDR}(s): A Family of Simple and Fast Algorithms for Solving Large Nonsymmetric 18774 Systems of Linear Equations}, 18775 author = {Peter Sonneveld and Martin B. van Gijzen}, 18776 journal = {SIAM Journal on Scientific Computing}, 18777 volume = {31}, 18778 number = {2}, 18779 pages = {1035--1062}, 18780 year = {2008} 18781} 18782 18783@Article{ flexiblecg, 18784 title = {Flexible {Conjugate Gradients}}, 18785 author = {Yvan Notay}, 18786 journal = {SIAM Journal on Scientific Computing}, 18787 volume = {22}, 18788 number = {4}, 18789 pages = {1444--1460}, 18790 year = {2000} 18791} 18792 18793@Article{ generalizedcg, 18794 title = {A Black Box Generalized {Conjugate Gradient} Solver with Inner Iterations and 18795 Variable-Step Preconditioning}, 18796 author = {O. Axelsson and P. S. Vassilevski}, 18797 journal = {SIAM Journal on Matrix Analysis and Applications}, 18798 volume = {12}, 18799 number = {4}, 18800 pages = {625--644}, 18801 year = {1991} 18802} 18803 18804@Article{ bicg, 18805 title = {{Conjugate Gradient} methods for indefinite systems}, 18806 author = {R. Fletcher}, 18807 journal = {Lecture Notes in Mathematics}, 18808 volume = {506}, 18809 pages = {73--89}, 18810 year = {1976} 18811} 18812 18813@Article{ idr.bcgs, 18814 title = {{Bi-CGSTAB} as an induced dimension reduction method}, 18815 author = {Gerard L.G. Sleijpen and Peter Sonneveld and Martin B. van Gijzen}, 18816 journal = {Applied Numerical Mathematics}, 18817 volume = {60}, 18818 pages = {1100--1114}, 18819 year = {2010} 18820} 18821 18822@Article{ idr.bcgsl, 18823 title = {Exploiting {BiCGstab($\ell$)} strategies to induce dimension reduction}, 18824 author = {Gerard L.G. Sleijpen and Martin B. van Gijzen}, 18825 journal = {SIAM J. Sci. Comput.}, 18826 volume = {32}, 18827 number = {5}, 18828 pages = {2687--2709}, 18829 year = {2010} 18830} 18831 18832@Article{ idr.min.sync, 18833 title = {Minimizing synchronization in {IDR(s)}}, 18834 author = {T.P. Collignon and M.B. van Gijzen}, 18835 journal = {Numerical Linear Algebra with Applications}, 18836 volume = {18}, 18837 number = {5}, 18838 pages = {805--825}, 18839 year = {2011} 18840} 18841 18842@TechReport{ flexible.idr, 18843 title = {Flexible and Multi-Shift Induced Dimension Reduction Algorithms for solving Large 18844 Sparse Linear Systems}, 18845 author = {Martin B. van Gijzen and Gerard L.G. Sleijpen and Jens-Peter M. Zemke}, 18846 institution = {Delft University of Technology}, 18847 number = {11-06}, 18848 year = {2011} 18849} 18850 18851@Article{ vangenuchten1980, 18852 title = {A Closed-form Equation for Predicting the Hydraulic Conductivity of Unsaturated 18853 Soils}, 18854 author = {M. Th. van Genuchten}, 18855 journal = {Soil Science Society of America Journal}, 18856 volume = {44}, 18857 pages = {892--898}, 18858 year = {1980} 18859} 18860 18861@Article{ gmresr94, 18862 title = {{GMRESR}: a family of nested {GMRES} methods}, 18863 author = {H. A. Van der Vorst and C. Vuik}, 18864 journal = {Numerical Linear Algebra with Applications}, 18865 volume = {1}, 18866 number = {4}, 18867 pages = {369--386}, 18868 year = {1994} 18869} 18870 18871@Article{ knepley10, 18872 author = {Matthew G. Knepley}, 18873 title = {Removing the Barrier to Scalability in Parallel FMM}, 18874 journal = {CoRR}, 18875 volume = {abs/1008.2410}, 18876 note = {\url{http://arxiv.org/abs/1008.2410}}, 18877 year = {2010} 18878} 18879 18880@Article{ teng1998, 18881 author = {Shang-Hua Teng}, 18882 title = {Provably Good Partitioning and Load Balancing Algorithms for Parallel Adaptive 18883 N-Body Simulation}, 18884 journal = {SIAM J. Sci. Comput.}, 18885 volume = {19}, 18886 number = {2}, 18887 month = mar, 18888 pages = {635--656}, 18889 year = {1998}, 18890 issn = {1064-8275}, 18891 numpages = {22}, 18892 doi = {10.1137/S1064827595288942}, 18893 acmid = {289842}, 18894 issue_date = {March 1998}, 18895 publisher = {Society for Industrial and Applied Mathematics}, 18896 address = {Philadelphia, PA}, 18897 keywords = {N-body simulation, adaptive computing, hierarchical methods, load balancing, 18898 parallel processing, partitioning, scientific computing, the fast multipole 18899 method, tree-codes} 18900} 18901 18902@InProceedings{ skinnerkramer05, 18903 author = {David Skinner and William Kramer}, 18904 title = {Understanding the causes of performance variability in HPC workloads}, 18905 booktitle = {Workload Characterization Symposium, 2005. Proceedings of the IEEE 18906 International}, 18907 organization = {IEEE}, 18908 pages = {137--149}, 18909 year = {2005} 18910} 18911 18912@Article{ notay_2000, 18913 author = {Yvan Notay}, 18914 title = {Flexible {Conjugate Gradients}}, 18915 journal = {SIAM Journal on Scientific Computing}, 18916 volume = {22}, 18917 number = {4}, 18918 year = {2000}, 18919 pages = {1444--1460} 18920} 18921 18922@Article{ bereux1996, 18923 title = {Zero-relaxation limit versus operator splitting for two-phase fluid flow 18924 computations}, 18925 author = {Fran{\c{c}}ois B{\'e}reux}, 18926 journal = {Computer Methods in Applied Mechanics and Engineering}, 18927 volume = {133}, 18928 number = {1-2}, 18929 pages = {93--124}, 18930 year = {1996} 18931} 18932 18933@Article{ pawlowski2006globalization, 18934 title = {Globalization techniques for {N}ewton-{K}rylov methods and applications to the 18935 fully coupled solution of the {N}avier-{S}tokes equations}, 18936 author = {Pawlowski, Roger P and Shadid, John N and Simonis, Joseph P and Walker, Homer F}, 18937 journal = {SIAM Review}, 18938 volume = {48}, 18939 number = {4}, 18940 pages = {700--721}, 18941 year = {2006}, 18942 publisher = {SIAM} 18943} 18944 18945@Article{ roppshadid2009, 18946 title = {Stability of operator splitting methods for systems with indefinite operators: 18947 Advection--diffusion--reaction systems}, 18948 author = {David L Ropp and John N Shadid}, 18949 journal = {Journal of Computational Physics}, 18950 volume = {228}, 18951 number = {9}, 18952 pages = {3508--3516}, 18953 year = {2009} 18954} 18955 18956@Article{ brown1985experiments, 18957 title = {Experiments with quasi-{N}ewton methods in solving stiff {ODE} systems}, 18958 author = {Brown, P.N. and Hindmarsh, A.C. and Walker, H.F.}, 18959 journal = {SIAM Journal on Scientific and Statistical Computing}, 18960 volume = {6}, 18961 number = {2}, 18962 pages = {297--313}, 18963 year = {1985}, 18964 publisher = {SIAM} 18965} 18966 18967@Article{ bicgsl_1993, 18968 author = {GERARD L.G. SLEIJPEN and DIEDERIK R. FOKKEMA}, 18969 title = {{BiCGSTAB(l)} for Linear Equations involving Unsymmetric Matrices with Complex 18970 Spectrum}, 18971 journal = {Electronic Transactions on Numerical Analysis}, 18972 volume = {1}, 18973 year = {1993}, 18974 pages = {11--32} 18975} 18976 18977@Book{ brandt2011revised, 18978 title = {Multigrid Techniques: 1984 Guide with Applications to Fluid Dynamics, Revised 18979 Edition}, 18980 author = {Achi Brandt and Oren Livne}, 18981 year = {2011}, 18982 publisher = {SIAM} 18983} 18984 18985@Article{ axelsson1990algebraic, 18986 title = {Algebraic multilevel preconditioning methods, {II}}, 18987 author = {Axelsson, O. and Vassilevski, P.S.}, 18988 journal = {SIAM Journal on Numerical Analysis}, 18989 volume = {27}, 18990 number = {6}, 18991 pages = {1569--1590}, 18992 year = {1990}, 18993 publisher = {SIAM} 18994} 18995 18996@Article{ zulehner2002analysis, 18997 title = {Analysis of iterative methods for saddle point problems: a unified approach}, 18998 author = {Zulehner, W.}, 18999 journal = {Mathematics of computation}, 19000 volume = {71}, 19001 number = {238}, 19002 pages = {479--506}, 19003 year = {2002} 19004} 19005 19006@Article{ pralet2010, 19007 author = {L. Giraud and A. Haidar and S. Pralet}, 19008 title = {Using multiple levels of parallelism to enhance the performance of domain 19009 decomposition solvers}, 19010 journal = {Parallel Computing}, 19011 volume = {36}, 19012 number = {5-6}, 19013 pages = {285--296}, 19014 year = {2010} 19015} 19016 19017@Book{ brennerscottfem, 19018 title = {The Mathematical Theory of Finite Element Methods}, 19019 author = {Susanne C. Brenner and L. Ridgway Scott}, 19020 edition = {3rd Edition}, 19021 series = {Texts in Applied Mathematics}, 19022 year = {2008}, 19023 publisher = {Springer-Verlag} 19024} 19025 19026@Book{ ortega1987iterative, 19027 title = {Iterative solution of nonlinear equations in several variables}, 19028 author = {Ortega, James M and Rheinboldt, Werner C}, 19029 volume = {30}, 19030 publisher = {Society for Industrial and Applied Mathematics}, 19031 year = {1987} 19032} 19033 19034@InBook{ rheinboldtch6, 19035 author = {Werner C. Rheinboldt}, 19036 title = {6. Combinations of Processes}, 19037 booktitle = {Methods for Solving Systems of Nonlinear Equations}, 19038 chapter = {6}, 19039 pages = {59--74}, 19040 doi = {10.1137/1.9781611970012.ch6}, 19041 year = {1998} 19042} 19043 19044@Article{ allgowerbohmerpotrarheinboldt86, 19045 author = {E. Allgower and K. B\"ohmer and F. Potra and W.~C. Rheinboldt}, 19046 title = {A Mesh-Independence Principle for Operator Equations and Their Discretizations}, 19047 journal = {SIAM Journal on Numerical Analysis}, 19048 volume = {23}, 19049 number = {1}, 19050 pages = {160-169}, 19051 year = {1986}, 19052 doi = {10.1137/0723011} 19053} 19054 19055@Article{ rheinboldt76, 19056 author = {Werner C. Rheinboldt}, 19057 title = {On measures of ill-conditioning for nonlinear equations}, 19058 journal = {Mathematics of Computation}, 19059 volume = {30}, 19060 number = {133}, 19061 pages = {104--111}, 19062 year = {1976} 19063} 19064 19065@Article{ little61, 19066 author = {John D. C. Little}, 19067 title = {A Proof for the Queuing Formula: {$L = \lambda W$}}, 19068 journal = {Operations Research}, 19069 volume = {9}, 19070 number = {3}, 19071 pages = {383--387}, 19072 note = {\url{http://www.jstor.org/stable/167570}}, 19073 year = {1961} 19074} 19075 19076@Misc{ top500, 19077 author = {{TOP500 Supercomputer Sites}}, 19078 url = {http://www.top500.org}, 19079 year = {2013} 19080} 19081 19082@Misc{ hassediagram, 19083 author = {Wikipedia}, 19084 title = {Hasse Diagram}, 19085 url = {http://en.wikipedia.org/wiki/Hasse_diagram}, 19086 note = {\url{http://en.wikipedia.org/wiki/Hasse_diagram}}, 19087 year = {2015} 19088} 19089 19090@Misc{ groupoid, 19091 author = {Wikipedia}, 19092 title = {Groupoid}, 19093 url = {https://en.wikipedia.org/wiki/Groupoid}, 19094 note = {\url{http://en.wikipedia.org/wiki/Groupoid}}, 19095 year = {2015} 19096} 19097 19098@Misc{ cwcomplex, 19099 author = {Wikipedia}, 19100 title = {{CW} complex}, 19101 url = {http://en.wikipedia.org/wiki/CW_complex}, 19102 note = {\url{http://en.wikipedia.org/wiki/CW_complex}}, 19103 year = {2015} 19104} 19105 19106@Misc{ linearalgebra, 19107 author = {Wikipedia}, 19108 title = {Linear Algebra}, 19109 url = {https://en.wikipedia.org/wiki/Linear_algebra}, 19110 note = {\url{https://en.wikipedia.org/wiki/Linear_algebra}}, 19111 year = {2015} 19112} 19113 19114@Misc{ amdahlslaw, 19115 author = {Wikipedia}, 19116 title = {Amdahl's Law}, 19117 url = {https://en.wikipedia.org/wiki/Amdahl's_law}, 19118 note = {\url{https://en.wikipedia.org/wiki/Amdahl's_law}}, 19119 year = {2015} 19120} 19121 19122@Misc{ gustafsonslaw, 19123 author = {Wikipedia}, 19124 title = {Gustafson's Law}, 19125 url = {https://en.wikipedia.org/wiki/Gustafson's_law}, 19126 note = {\url{https://en.wikipedia.org/wiki/Gustafson's_law}}, 19127 year = {2015} 19128} 19129 19130@InProceedings{ amdahl1967, 19131 title = {Validity of the Single Processor Approach to Achieving Large Scale Computing 19132 Capabilities}, 19133 author = {Gene M. Amdahl}, 19134 booktitle = {Proceedings of the April 18-20, 1967, Spring Joint Computer Conference}, 19135 series = {AFIPS '67 (Spring)}, 19136 location = {Atlantic City, New Jersey}, 19137 pages = {483--485}, 19138 numpages = {3}, 19139 doi = {10.1145/1465482.1465560}, 19140 acmid = {1465560}, 19141 publisher = {ACM}, 19142 address = {New York, NY, USA}, 19143 year = {1967} 19144} 19145 19146@Article{ gustafson1988, 19147 title = {Reevaluating {Amdahl}'s Law}, 19148 author = {Gustafson, John L.}, 19149 journal = {Communications of the ACM}, 19150 volume = {31}, 19151 number = {5}, 19152 month = may, 19153 issn = {0001-0782}, 19154 pages = {532--533}, 19155 doi = {10.1145/42411.42415}, 19156 acmid = {42415}, 19157 year = {1988} 19158} 19159 19160@Book{ eijkhout2014, 19161 title = {Introduction to High Performance Scientific Computing}, 19162 author = {Victor Eijkhout}, 19163 url = {http://pages.tacc.utexas.edu/~eijkhout/Articles/EijkhoutIntroToHPC.pdf}, 19164 publisher = {TACC}, 19165 year = {2014} 19166} 19167 19168@Article{ korelc2002multilanguage, 19169 title = {Multi-language and multi-environment generation of nonlinear finite element 19170 codes}, 19171 author = {Korelc, J.}, 19172 journal = {Engineering with Computers}, 19173 volume = {18}, 19174 number = {4}, 19175 pages = {312--327}, 19176 year = {2002}, 19177 publisher = {Springer} 19178} 19179 19180@TechReport{ taylor2011feap, 19181 title = {{FEAP}: A Finite Element Analysis Program}, 19182 subtitle = {Version 8.3 User Manual}, 19183 author = {R. L. Taylor}, 19184 year = {2011}, 19185 institution = {University of California, Berkeley} 19186} 19187 19188@Article{ bergeraftosmismurman2005, 19189 title = {Analysis of slope limiters on irregular grids}, 19190 author = {Berger, Marsha and Aftosmis, Michael J and Murman, Scott M}, 19191 journal = {AIAA paper}, 19192 volume = {490}, 19193 pages = {2005}, 19194 year = {2005} 19195} 19196 19197@InProceedings{ ferreirabridgesbrightwell08, 19198 author = {Kurt B. Ferreira and Patrick Bridges and Ron Brightwell}, 19199 title = {Characterizing Application Sensitivity to OS Interference Using Kernel-level 19200 Noise Injection}, 19201 booktitle = {Proceedings of the 2008 ACM/IEEE Conference on Supercomputing}, 19202 series = {SC '08}, 19203 year = {2008}, 19204 isbn = {978-1-4244-2835-9}, 19205 location = {Austin, Texas}, 19206 pages = {19:1--19:12}, 19207 articleno = {19}, 19208 numpages = {12}, 19209 url = {http://dl.acm.org/citation.cfm?id=1413370.1413390}, 19210 acmid = {1413390}, 19211 publisher = {IEEE Press}, 19212 address = {Piscataway, NJ} 19213} 19214 19215@Article{ banach22, 19216 author = {Stefan Banach}, 19217 title = {Sur les op\'erations dans les ensembles abstraits et leur application aux 19218 \'equations int\'egrales}, 19219 journal = {Fund. Math.}, 19220 volume = {3}, 19221 pages = {133--181}, 19222 year = {1922} 19223} 19224 19225@Article{ bangerthbursteddeheisterkronbichler2012, 19226 author = {Wolfgang Bangerth and Carsten Burstedde and Timo Heister and Martin Kronbichler}, 19227 title = {Algorithms and Data Structures for Massively Parallel Generic Adaptive Finite 19228 Element Codes}, 19229 journal = {ACM Trans. Math. Softw.}, 19230 issue_date = {December 2011}, 19231 volume = {38}, 19232 number = {2}, 19233 month = jan, 19234 year = {2012}, 19235 issn = {0098-3500}, 19236 pages = {14:1--14:28}, 19237 articleno = {14}, 19238 numpages = {28}, 19239 doi = {10.1145/2049673.2049678}, 19240 acmid = {2049678}, 19241 publisher = {ACM}, 19242 address = {New York, NY, USA}, 19243 keywords = {Adaptive mesh refinement, object-orientation, parallel algorithms, software 19244 design} 19245} 19246 19247@Article{ eisenstatwalker1994, 19248 author = {Stanley Eisenstat and Homer Walker}, 19249 title = {Globally Convergent Inexact {N}ewton Methods}, 19250 journal = {SIAM Journal on Optimization}, 19251 volume = {4}, 19252 number = {2}, 19253 pages = {393--422}, 19254 year = {1994}, 19255 doi = {10.1137/0804022} 19256} 19257 19258@Book{ blumcuckershubsmale98, 19259 title = {Complexity and Real Computation}, 19260 author = {Lenore Blum and Felipe Cucker and Michael Shub and Steve Smale}, 19261 year = {1998}, 19262 publisher = {Springer} 19263} 19264 19265@Article{ caili2011, 19266 author = {Cai, X.-C. and Li, X.}, 19267 title = {Inexact {N}ewton Methods with Restricted Additive {S}chwarz Based Nonlinear 19268 Elimination for Problems with High Local Nonlinearity}, 19269 journal = {SIAM Journal on Scientific Computing}, 19270 volume = {33}, 19271 number = {2}, 19272 pages = {746-762}, 19273 year = {2011}, 19274 doi = {10.1137/080736272} 19275} 19276 19277@Article{ cai2009, 19278 author = {X.-C. Cai}, 19279 title = { Nonlinear overlapping domain decomposition methods}, 19280 journal = {Lecture Notes in Computational Science}, 19281 volume = {70}, 19282 pages = {217-224}, 19283 year = {2009} 19284} 19285 19286@Article{ lanzkronrosewilkes1996, 19287 title = {An analysis of approximate nonlinear elimination}, 19288 author = {Lanzkron, Paul J and Rose, Donald J and Wilkes, James T}, 19289 journal = {SIAM Journal on Scientific Computing}, 19290 volume = {17}, 19291 number = {2}, 19292 pages = {538--559}, 19293 year = {1996}, 19294 publisher = {SIAM} 19295} 19296 19297@TechReport{ gropp1993sowing, 19298 title = {Users manual for bfort: Producing {F}ortran interfaces to {C} source code}, 19299 author = {Gropp, W}, 19300 year = {1995}, 19301 number = {ANL/MCS-TM-208}, 19302 institution = {Argonne National Laboratory} 19303} 19304 19305@TechReport{ gropp1993sowing2, 19306 title = {Users Manual for doctext: Producing Documentation from Source Code}, 19307 author = {Gropp, W}, 19308 year = {1995}, 19309 number = {ANL/MCS-TM-206}, 19310 institution = {Argonne National Laboratory} 19311} 19312 19313@TechReport{ gropp1993simplified, 19314 title = {Simplified Linear Equation Solvers users manual}, 19315 author = {Gropp, W and Smith, B}, 19316 year = {1993}, 19317 number = {ANL--93/8}, 19318 institution = {Argonne National Laboratory} 19319} 19320 19321@Misc{ simplifiedbsd, 19322 author = {{University of California, Berkeley}}, 19323 title = {Simplified {Berkeley} Software Distribution License}, 19324 note = {see 19325 \url{http://en.wikipedia.org/wiki/BSD_licenses#2-clause_license_.28.22Simplified_BSD_License.22_or_.22FreeBSD_License.22.29}} 19326} 19327 19328@Book{ chaconstraub14, 19329 author = {Scott Chacon and Ben Straub}, 19330 title = {Pro Git}, 19331 publisher = {Apress}, 19332 year = {2014}, 19333 pages = {456}, 19334 note = {Available online at \url{http://git-scm.com/book/}} 19335} 19336 19337@Misc{ bitbucket, 19338 author = {Atlassian}, 19339 title = {Bitbucket}, 19340 note = {Platform available from \url{http://bitbucket.org}} 19341} 19342 19343@Misc{ gitworkflows, 19344 author = {GitWorkflows}, 19345 note = {Available at 19346 \url{https://www.kernel.org/pub/software/scm/git/docs/gitworkflows.html}} 19347} 19348 19349@Misc{ figshare, 19350 author = {FigShare}, 19351 note = {Available at \url{http://palgrave.figshare.com/}} 19352} 19353 19354@InProceedings{ beazley1996swig, 19355 title = {{SWIG}: An easy to use tool for integrating scripting languages with {C} and 19356 {C++}}, 19357 author = {Beazley, David M}, 19358 booktitle = {Proceedings of the 4th USENIX Tcl/Tk workshop}, 19359 pages = {129--139}, 19360 year = {1996} 19361} 19362 19363@Misc{ softwareproductivityworkshopreport14, 19364 author = {H. Johansen and L. C. McInnes and D. Bernholdt and J. Carver and M. Heroux and R. 19365 Hornung and P. Jones and B. Lucas and A. Siegel and T. Ndousse-Fetter}, 19366 title = {Software Productivity for Extreme-Scale Science}, 19367 note = {Report on DOE Workshop, January 13-14, 2014}, 19368 url = {http://www.orau.gov/swproductivity2014/SoftwareProductivityWorkshopReport2014.pdf}, 19369 year = {2014} 19370} 19371 19372@Misc{ softwareproductivitywhitepaper13, 19373 author = {H. Johansen and D. Bernholdt and B. Collins and M. Heroux and R. Jacob and P. 19374 Jones and L. C. McInnes and J. D. Moulton and T. Ndousse-Fetter and D. Post and W. 19375 Tang}, 19376 title = {Extreme-Scale Scientific Application Software Productivity: Harnessing the Full 19377 Capability of Extreme-Scale Computing}, 19378 note = {whitepaper submitted to DOE, available via 19379 \url{http://www.orau.gov/swproductivity2014/reference.htm}}, 19380 year = {2013} 19381} 19382 19383@Misc{ ideas:project, 19384 author = {Michael Heroux and Lois Curfman McInnes and J. David {Moulton (PIs)}}, 19385 title = {{Interoperable Design of Extreme-Scale Application Software (IDEAS)}}, 19386 howpublished = {\url{http://ideas-productivity.org}}, 19387 year = {2015} 19388} 19389 19390@TechReport{ keyesmcinneswoodwardetal2012, 19391 author = {D. E. Keyes and L. C. McInnes and C. Woodward and E. Constantinescu and D. Estep 19392 and B. Sheehan}, 19393 title = {First Steps Toward a Multiphysics Exemplars and Benchmarks Suite}, 19394 institution = {Argonne National Laboratory}, 19395 number = {ANL/MCS-TM-330}, 19396 month = oct, 19397 year = {2012} 19398} 19399 19400@Misc{ sawsfs-web-page, 19401 author = {Surtai Han and Barry Smith and Hong Zhang}, 19402 title = {{{SAWs Tutorial: Fieldsplit Preconditioner}}}, 19403 note = {\url{https://www.youtube.com/watch?v=-w0fPhmZT3c}}, 19404 year = {2015} 19405} 19406 19407@Misc{ sawshk-web-page, 19408 author = {Surtai Han and Barry Smith and Hong Zhang}, 19409 title = {{{SAWs Tutorial: Hierarchical Krylov Method}}}, 19410 note = {\url{https://www.youtube.com/watch?v=hWbqppTrcOw}}, 19411 year = {2015} 19412} 19413 19414@Misc{ sawsnestk-web-page, 19415 author = {Surtai Han and Barry Smith and Hong Zhang}, 19416 title = {{{SAWs Tutorial: Nested Krylov Method}}}, 19417 note = {\url{https://www.youtube.com/watch?v=kqPXZxMOJmA}}, 19418 year = {2015} 19419} 19420 19421@Misc{ m2acs:project, 19422 author = {M. {Anitescu et al.}}, 19423 title = {{Multifaceted Mathematics for Complex Energy Systems (M2ACS) {W}eb page}}, 19424 howpublished = {\url{http://www.mcs.anl.gov/MACS}}, 19425 year = {2015} 19426} 19427 19428@Misc{ hssmn13, 19429 author = {P. Hovland and B. Smith and M. Snir and L. C. McInnes and B. Norris}, 19430 title = {Exposing and Expanding Compiler Technologies to Improve Software Productivity in 19431 Developing Mathematical Libraries and Simulation Codes}, 19432 note = {whitepaper submitted to DOE Workshop on Software Productivity for Extreme-Scale 19433 Science, available via \url{http://www.orau.gov/swproductivity2014/papers.htm}}, 19434 year = {2013} 19435} 19436 19437@Misc{ atpesc:website, 19438 key = {{Argonne Training Program for Extreme-Scale Computing}}, 19439 title = {{Argonne Training Program for Extreme-Scale Computing (ATPESC)}}, 19440 howpublished = {\url{http://extremecomputingtraining.anl.gov}}, 19441 year = {2018} 19442} 19443 19444@Article{ barraultmadaynguyenpatera2004, 19445 author = {Maxime Barrault and Yvon Maday and Ngoc Cuong Nguyen and Anthony T. Patera}, 19446 title = {An empirical interpolation method: application to efficient reduced-basis 19447 discretization of partial differential equations}, 19448 journal = {Comptes Rendus Mathematique}, 19449 volume = {339}, 19450 number = {9}, 19451 pages = {667--672}, 19452 year = {2004}, 19453 issn = {1631-073X}, 19454 doi = {10.1016/j.crma.2004.08.006} 19455} 19456 19457@Article{ simongogotsi08, 19458 title = {Materials for electrochemical capacitors}, 19459 author = {Patrice Simon and Yury Gogotsi}, 19460 journal = {Nature Materials}, 19461 volume = {7}, 19462 number = {11}, 19463 pages = {845--854}, 19464 year = {2008}, 19465 doi = {10.1038/nmat2297} 19466} 19467 19468@Article{ vladsinghrollandmelinteajayangohy14, 19469 title = {Hybrid supercapacitor-battery materials for fast electrochemical charge storage}, 19470 author = {A. Vlad and N. Singh and J. Rolland and S. Melinte and P. M. Ajayan and J.-F. 19471 Gohy}, 19472 journal = {Scientific Reports}, 19473 volume = {4}, 19474 year = {2014}, 19475 doi = {10.1038/srep04315} 19476} 19477 19478@Article{ lichengshashurinkeidar12, 19479 title = {Review of Electrochemical Capacitors Based on Carbon Nanotubes and Graphene}, 19480 author = {J. Li and X. Cheng and A. Shashurin and M. Keidar}, 19481 journal = {Graphene}, 19482 volume = {1}, 19483 number = {1}, 19484 pages = {1--13}, 19485 year = {2012}, 19486 doi = {10.4236/graphene.2012.11001} 19487} 19488 19489@Article{ miller07, 19490 title = {A Brief History of Supercapacitors}, 19491 author = {John R. Miller}, 19492 journal = {Battery and Energy Storage Technology}, 19493 pages = {61--78}, 19494 year = {2007} 19495} 19496 19497@Book{ deshpande14, 19498 title = {Ultracapacitors: Future of Energy Storage}, 19499 author = {R. P. Deshpande}, 19500 publisher = {McGraw Hill Education}, 19501 isbn = {978-9339214050}, 19502 pages = {452}, 19503 year = {2014} 19504} 19505 19506@Article{ hojowboggs10, 19507 title = {Historical introduction to capacitor technology}, 19508 author = {J. Ho and T.R. Jow and S. Boggs}, 19509 journal = {IEEE Electrical Insulation Magazine}, 19510 month = jan, 19511 volume = {26}, 19512 number = {1}, 19513 pages = {20--25}, 19514 year = {2010}, 19515 doi = {10.1109/MEI.2010.5383924}, 19516 issn = {0883-7554} 19517} 19518 19519@Article{ gillespie14, 19520 title = {A review of steric interactions of ions: Why some theories succeed and others 19521 fail to acount for ion size}, 19522 author = {Dirk Gillespie}, 19523 journal = {Microfluidics and Nanofluidics}, 19524 volume = {18}, 19525 number = {5-6}, 19526 pages = {717--738}, 19527 year = {2015} 19528} 19529 19530@Article{ gillespievaliskoboda05, 19531 author = {Dirk Gillespie and Monica Valisk\'{o} and Dezs\H{o} Boda}, 19532 title = {Density functional theory of the electrical double layer: the RFD functional}, 19533 journal = {J. Phys.: Condens. Matter}, 19534 volume = {17}, 19535 pages = {6609--6626}, 19536 year = {2005} 19537} 19538 19539@Article{ valiskobodagillespie07, 19540 author = {Monica Valisk\'{o} and Dezs\H{o} Boda and Dirk Gillespie}, 19541 title = {Selective adsorption of ions with different diameter and valence at 19542 highly-charged interfaces}, 19543 journal = {J. Phys. Chem. C}, 19544 volume = {111}, 19545 pages = {15575--15585}, 19546 year = {2007} 19547} 19548 19549@Article{ gillespie08, 19550 author = {Dirk Gillespie}, 19551 title = {Energetics of divalent selectivity in a calcium channel: the ryanodine receptor 19552 case study}, 19553 journal = {Biophys. J.}, 19554 volume = {94}, 19555 pages = {1169--1184}, 19556 year = {2008} 19557} 19558 19559@Article{ liwuwang15, 19560 title = {Osmotic Pressure and Packaging Structure of Caged DNA}, 19561 author = {Zhidong Li and Jianzhong Wu and Zhen-Gang Wang}, 19562 journal = {Biophysical Journal}, 19563 volume = {94}, 19564 number = {3}, 19565 pages = {737--746}, 19566 doi = {10.1529/biophysj.107.112508}, 19567 url = {http://www.cell.com/biophysj/abstract/S0006-3495(08)70675-1}, 19568 year = {2015} 19569} 19570 19571@Article{ gillespie12, 19572 title = {High energy conversion efficiency in nanofluidic channels}, 19573 author = {Dirk Gillespie}, 19574 journal = {Nano Letters}, 19575 volume = {12}, 19576 pages = {1410--1416}, 19577 year = {2012} 19578} 19579 19580@Article{ dieterich79, 19581 title = {Modeling of rock friction: 1. Experimental results and constitutive equations}, 19582 author = {James H. Dieterich}, 19583 journal = {Journal of Geophysical Research: Solid Earth}, 19584 volume = {84}, 19585 number = {B5}, 19586 pages = {2161--2168}, 19587 year = {1979}, 19588 publisher = {Wiley Online Library} 19589} 19590 19591@Article{ bodakovacsgillespiekristof14, 19592 title = {Selective transport through a model calcium channel studied by Local Equilibrium 19593 Monte Carlo simulations coupled to the Nernst--Planck equation}, 19594 author = {Dezs{\H{o}} Boda and R{\'o}bert Kov{\'a}cs and Dirk Gillespie and Tam{\'a}s 19595 Krist{\'o}f}, 19596 journal = {Journal of Molecular Liquids}, 19597 volume = {189}, 19598 pages = {100--112}, 19599 year = {2014}, 19600 publisher = {Elsevier} 19601} 19602 19603@Article{ brandt05, 19604 title = {Multiscale solvers and systematic upscaling in computational physics}, 19605 author = {Brandt, A}, 19606 journal = {Computer Physics Communications}, 19607 volume = {169}, 19608 number = {1}, 19609 pages = {438--441}, 19610 year = {2005}, 19611 publisher = {Elsevier} 19612} 19613 19614@Article{ rosenfeld89, 19615 title = {Free-energy model for the inhomogeneous hard-sphere fluid mixture and 19616 density-functional theory of freezing}, 19617 author = {Yaakov Rosenfeld}, 19618 journal = {Physical review letters}, 19619 volume = {63}, 19620 number = {9}, 19621 pages = {980}, 19622 year = {1989}, 19623 publisher = {APS} 19624} 19625 19626@Article{ schindlermitchellmccabecummingslevan13, 19627 title = {Adsorption of Chain Molecules in Slit-Shaped Pores: Development of a SAFT-FMT-DFT 19628 Approach}, 19629 author = {Bryan J Schindler and Lucas A Mitchell and Clare McCabe and Peter T Cummings and 19630 M Douglas LeVan}, 19631 journal = {The Journal of Physical Chemistry C}, 19632 volume = {117}, 19633 number = {41}, 19634 pages = {21337--21350}, 19635 year = {2013}, 19636 publisher = {ACS Publications} 19637} 19638 19639@Misc{ tramonto, 19640 author = {Laura Frink and et. al.}, 19641 title = {TRAMONTO 3.0 web site}, 19642 url = {https://software.sandia.gov/DFTfluids/tramonto3_0.html}, 19643 year = {2014} 19644} 19645 19646@InCollection{ zhongyuenmoresiknepley15, 19647 author = {Shijie Zhong and David A. Yuen and Louis N. Moresi and Matthew G. Knepley}, 19648 title = {Numerical Methods for Mantle Convection}, 19649 booktitle = {Treatise on Geophysics}, 19650 publisher = {Elsevier}, 19651 volume = {7}, 19652 editor = {Gerald Schubert}, 19653 edition = {Second Edition}, 19654 year = {2015} 19655} 19656 19657@Article{ richarson1911, 19658 author = {Lewis Fry Richardson}, 19659 title = {The approximate arithmetical solution by finite differences of physical problems 19660 including differential equations, with an application to the stresses in a masonry 19661 dam}, 19662 journal = {Philosophical Transactions of the Royal Society A}, 19663 volume = {210}, 19664 number = {459--470}, 19665 pages = {307--357}, 19666 doi = {10.1098/rsta.1911.0009}, 19667 year = {1911} 19668} 19669 19670@Article{ kirkwood34, 19671 author = {John G. Kirkwood}, 19672 title = {Theory of Solutions of Molecules Containing Widely Separated Charges with Special 19673 Application to Zwitterions}, 19674 journal = {The Journal of Chemical Physics}, 19675 volume = {2}, 19676 number = {7}, 19677 year = {1934} 19678} 19679 19680@TechReport{ schoof1994exodus, 19681 title = {{EXODUS II}: a finite element data model}, 19682 author = {Larry A Schoof and Victor R Yarberry}, 19683 institution = {Sandia National Laboratories}, 19684 number = {SAND92-2137}, 19685 address = {Albuquerque, NM}, 19686 year = {1994} 19687} 19688 19689@Misc{ poirier1998cgns, 19690 author = {Diane Poirier and Steven R Allmaras and Douglas R McCarthy and Matthew F Smith 19691 and Fancis Y Enomoto}, 19692 title = {The CGNS system}, 19693 note = {AIAA Paper 98-3007}, 19694 year = {1998} 19695} 19696 19697@Article{ geuzaine2009gmsh, 19698 title = {Gmsh: A 3-D finite element mesh generator with built-in pre-and post-processing 19699 facilities}, 19700 author = {Christophe Geuzaine and Jean-Fran{\c{c}}ois Remacle}, 19701 journal = {International Journal for Numerical Methods in Engineering}, 19702 volume = {79}, 19703 number = {11}, 19704 pages = {1309--1331}, 19705 year = {2009}, 19706 publisher = {Wiley Online Library} 19707} 19708 19709@Article{ si2015, 19710 title = {{TetGen}, a {Delaunay}-Based Quality Tetrahedral Mesh Generator}, 19711 author = {Hang Si}, 19712 journal = {ACM Trans. on Mathematical Software}, 19713 volume = {41}, 19714 number = {2}, 19715 month = feb, 19716 doi = {10.1145/2629697}, 19717 year = {2015} 19718} 19719 19720@TechReport{ blackerbohnhoffedwards1994, 19721 title = {CUBIT mesh generation environment. Volume 1: Users manual}, 19722 author = {Ted D Blacker and William J Bohnhoff and Tony L Edwards}, 19723 institution = {Sandia National Labs., Albuquerque, NM (United States)}, 19724 year = {1994} 19725} 19726 19727@Article{ bjorck1994, 19728 title = {Numerics of Gram-Schmidt orthogonalization}, 19729 author = {{\AA}ke Bj{\"o}rck}, 19730 journal = {Linear Algebra and Its Applications}, 19731 volume = {197}, 19732 pages = {297--316}, 19733 year = {1994}, 19734 publisher = {Elsevier} 19735} 19736 19737@PhDThesis{ yood05, 19738 author = {Charles Nelson Yood}, 19739 title = {Argonne National Laboratory and the Emergence of Computer and Computational 19740 Science, 1946--1992}, 19741 school = {The Pennsylvania State University}, 19742 month = aug, 19743 year = {2005} 19744} 19745 19746@Article{ fearnleysander79, 19747 title = {Hermann Grassmann and the Creation of Linear Algebra}, 19748 author = {Desmond Fearnley-Sander}, 19749 journal = {The American Mathematical Monthly}, 19750 volume = {86}, 19751 pages = {809--817}, 19752 url = {http://www.maa.org/sites/default/files/pdf/upload_library/22/Ford/DesmondFearnleySander.pdf}, 19753 year = {1979} 19754} 19755 19756@InCollection{ knepley2012, 19757 author = {Matthew G. Knepley}, 19758 title = {Programming Languages for Scientific Computing}, 19759 booktitle = {Encyclopedia of Applied and Computational Mathematics}, 19760 publisher = {Springer}, 19761 year = {2012}, 19762 editor = {Bj\"orn Engquist}, 19763 doi = {10.1007/978-3-540-70529-1}, 19764 url = {http://arxiv.org/abs/1209.1711} 19765} 19766 19767@InBook{ knepley2015, 19768 title = {Programming Languages for Scientific Computing}, 19769 author = {Matthew G. Knepley}, 19770 booktitle = {Encyclopedia of Applied and Computational Mathematics}, 19771 editor = {Bj{\"o}rn Engquist}, 19772 publisher = {Springer Berlin Heidelberg}, 19773 address = {Berlin, Heidelberg}, 19774 pages = {1173--1181}, 19775 isbn = {978-3-540-70529-1}, 19776 doi = {10.1007/978-3-540-70529-1_250}, 19777 year = {2015} 19778} 19779 19780@Book{ hughes2000, 19781 author = {Thomas J. R. Hughes}, 19782 title = {The Finite Element Method: Linear Static and Dynamic Finite Element Analysis}, 19783 series = {Dover Civil and Mechanical Engineering}, 19784 pages = {704}, 19785 year = {2000}, 19786 isbn = {978-0486411811}, 19787 publisher = {Dover} 19788} 19789 19790@Article{ roache2002, 19791 title = {Code verification by the method of manufactured solutions}, 19792 author = {Patrick J. Roache}, 19793 journal = {Journal of Fluids Engineering}, 19794 volume = {124}, 19795 number = {1}, 19796 pages = {4--10}, 19797 year = {2002}, 19798 publisher = {American Society of Mechanical Engineers} 19799} 19800 19801@InCollection{ rokosgorman13, 19802 title = {PRAgMaTIc - Parallel Anisotropic Adaptive Mesh Toolkit}, 19803 author = {Georgios Rokos and Gerard Gorman}, 19804 booktitle = {Facing the Multicore-Challenge III}, 19805 series = {Lecture Notes in Computer Science}, 19806 editor = {Keller, Rainer and Kramer, David and Weiss, Jan-Philipp}, 19807 publisher = {Springer Berlin Heidelberg}, 19808 volume = {7686}, 19809 pages = {143-144}, 19810 doi = {10.1007/978-3-642-35893-7_22}, 19811 isbn = {978-3-642-35892-0}, 19812 year = {2013} 19813} 19814 19815@Misc{ hdf5:homepage, 19816 author = {{The HDF Group}}, 19817 title = {The {HDF5} Homepage}, 19818 howpublished = {\url{https://www.hdfgroup.org/HDF5/}}, 19819 year = {2015} 19820} 19821 19822@Misc{ paraview:homepage, 19823 author = {Kitware}, 19824 title = {The {ParaView} Homepage}, 19825 howpublished = {\url{http://www.paraview.org/}}, 19826 year = {2015} 19827} 19828 19829@Misc{ xdmf:homepage, 19830 author = {Kitware}, 19831 title = {The Extensible Data Model and Format ({XDMF})}, 19832 howpublished = {\url{http://www.xdmf.org/}}, 19833 year = {2015} 19834} 19835 19836@Article{ cullerkarp1993, 19837 title = {LogP: Towards a realistic model of parallel computation}, 19838 author = {David Culler and Richard Karp and David Patterson and Abhijit Sahay and Klaus 19839 Erik Schauser and Eunice Santos and Ramesh Subramonian and Thorsten Von Eicken}, 19840 journal = {SIGPLAN Notices}, 19841 volume = {28}, 19842 number = {7}, 19843 pages = {1--12}, 19844 year = {1993}, 19845 publisher = {ACM} 19846} 19847 19848@Article{ aggarwalvitter1988, 19849 title = {The input/output complexity of sorting and related problems}, 19850 author = {Alok Aggarwal and Jeffrey Vitter}, 19851 journal = {Communications of the ACM}, 19852 volume = {31}, 19853 number = {9}, 19854 pages = {1116--1127}, 19855 year = {1988}, 19856 publisher = {ACM} 19857} 19858 19859@InProceedings{ czechowskibattaglinomcclanahanchandramowlishwaranvuduc2011, 19860 author = {Kenneth Czechowski and Casey Battaglino and Chris McClanahan and Aparna 19861 Chandramowlishwaran and Richard Vuduc}, 19862 title = {Balance principles for algorithm-architecture co-design}, 19863 booktitle = {Proc.~USENIX Wkshp. Hot Topics in Parallelism (HotPar)}, 19864 month = may, 19865 address = {Berkeley, CA, USA}, 19866 url = {http://www.usenix.org/events/hotpar11/tech/final_files/Czechowski.pdf}, 19867 year = {2011} 19868} 19869 19870@Article{ williamswatermanpatterson2009, 19871 title = {Roofline: an insightful visual performance model for multicore architectures}, 19872 author = {Samuel Williams and Andrew Waterman and David Patterson}, 19873 journal = {Communications of the ACM}, 19874 volume = {52}, 19875 number = {4}, 19876 pages = {65--76}, 19877 year = {2009}, 19878 publisher = {ACM} 19879} 19880 19881@Misc{ roofline-web-page, 19882 author = {Samuel Williams and {et. al.}}, 19883 title = {{R}oofline {P}erformance {M}odel}, 19884 key = {Roofline}, 19885 url = {http://crd.lbl.gov/departments/computer-science/performance-and-algorithms-research/research/roofline/}, 19886 howpublished = {\url{http://crd.lbl.gov/departments/computer-science/performance-and-algorithms-research/research/roofline/}} 19887} 19888 19889@Misc{ roofline-talk2008, 19890 author = {Samuel Williams and David Patterson}, 19891 title = {{R}oofline {P}erformance {M}odel}, 19892 key = {Roofline}, 19893 year = {2008}, 19894 note = {ParLab Summer Retreat}, 19895 url = {http://crd.lbl.gov/assets/pubs_presos/parlab08-roofline-talk.pdf}, 19896 howpublished = {\url{http://crd.lbl.gov/assets/pubs_presos/parlab08-roofline-talk.pdf}} 19897} 19898 19899@Article{ lee2006, 19900 title = {The problem with threads}, 19901 author = {Edward A Lee}, 19902 journal = {Computer}, 19903 volume = {39}, 19904 number = {5}, 19905 pages = {33--42}, 19906 year = {2006}, 19907 url = {http://ptolemy.eecs.berkeley.edu/publications/papers/06/problemwithThreads/}, 19908 publisher = {IEEE Computer Society Press} 19909} 19910 19911@Article{ hoefler2012, 19912 title = {{Optimization principles for collective neighborhood communications}}, 19913 author = {Torsten Hoefler and Timo Schneider}, 19914 journal = {International Conference for High Performance Computing, Networking, Storage and 19915 Analysis, SC}, 19916 doi = {10.1109/SC.2012.86}, 19917 isbn = {9781467308069}, 19918 issn = {21674329}, 19919 year = {2012} 19920} 19921 19922@Book{ grahamknuthpatashnik1989, 19923 title = {Concrete Mathematics}, 19924 author = {Ronald L Graham and Donald E Knuth and Oren Patashnik}, 19925 publisher = {Addison-Wesley}, 19926 year = {1989} 19927} 19928 19929@Book{ jackson1962, 19930 title = {Classical Electrodynamics}, 19931 author = {John David Jackson}, 19932 publisher = {John Wiley \& Sons}, 19933 year = {1962} 19934} 19935 19936@Article{ leveque2013, 19937 title = {Top Ten Reasons to Not Share Your Code (and why you should anyway)}, 19938 author = {Randall J. LeVeque}, 19939 journal = {SIAM News}, 19940 volume = {46}, 19941 number = {3}, 19942 month = apr, 19943 url = {http://faculty.washington.edu/rjl/pubs/topten/}, 19944 year = {2013} 19945} 19946 19947@InProceedings{ wang2014, 19948 title = {Fjos: Practical, predictable, and efficient system support for fork/join 19949 parallelism}, 19950 author = {Qi Wang and Gabriel Parmer}, 19951 booktitle = {Real-Time and Embedded Technology and Applications Symposium (RTAS), 2014 IEEE 19952 20th}, 19953 pages = {25--36}, 19954 year = {2014}, 19955 organization = {IEEE} 19956} 19957 19958@Article{ fangsaad2009, 19959 author = {Haw-ren Fang and Yousef Saad}, 19960 title = {Two classes of multisecant methods for nonlinear acceleration}, 19961 journal = {Numerical Linear Algebra with Applications}, 19962 volume = {16}, 19963 number = {3}, 19964 pages = {197--221}, 19965 year = {2009}, 19966 doi = {10.1002/nla.617} 19967} 19968 19969@Misc{ hpcchallenge, 19970 title = {HPC Challenge}, 19971 author = {Jack Dongarra and Piotr Luszczek and others}, 19972 url = {http://icl.cs.utk.edu/hpcc/hpcc_results_lat_band.cgi?display=opt}, 19973 year = {2015} 19974} 19975 19976@InProceedings{ hoeflerschneiderlumsdaine2008, 19977 title = {Accurately measuring collective operations at massive scale}, 19978 author = {Torsten Hoefler and Timo Schneider and Andrew Lumsdaine}, 19979 booktitle = {Proceedings of the 22nd IEEE International Symposium on Parallel and Distributed 19980 Processing (IPDPS)}, 19981 pages = {1--8}, 19982 year = {2008}, 19983 doi = {10.1109/IPDPS.2008.4536494}, 19984 organization = {IEEE} 19985} 19986 19987@Book{ potraptak1984, 19988 title = {Nondiscrete Induction and Iterative Processes}, 19989 author = {Florian A. Potra and Vlastimil Pt{\'a}k}, 19990 series = {Research Notes in Mathematics}, 19991 year = {1984}, 19992 publisher = {Pitman} 19993} 19994 19995@Book{ pilz1977, 19996 title = {Near-rings: the theory and its applications}, 19997 author = {G{\"u}nter Pilz}, 19998 year = {1977}, 19999 publisher = {New York} 20000} 20001 20002@Article{ birkenjameson2009, 20003 title = {{On nonlinear preconditioners in {N}ewton-{K}rylov methods for unsteady flows}}, 20004 author = {Philipp Birken and Antony Jameson}, 20005 journal = {International Journal for Numerical Methods in Fluids}, 20006 volume = {62}, 20007 number = {5}, 20008 pages = {565--573}, 20009 publisher = {John Wiley \& Sons, Ltd.}, 20010 doi = {10.1002/fld.2030}, 20011 issn = {1097-0363}, 20012 year = {2010} 20013} 20014 20015@Article{ anderson1965, 20016 title = {Iterative procedures for nonlinear integral equations}, 20017 author = {Donald G Anderson}, 20018 journal = {Journal of the ACM (JACM)}, 20019 volume = {12}, 20020 number = {4}, 20021 pages = {547--560}, 20022 year = {1965}, 20023 publisher = {ACM} 20024} 20025 20026@Article{ ptak1966, 20027 title = {Some metric aspects of the open mapping and closed graph theorems}, 20028 author = {Vlastimil Pt{\'a}k}, 20029 journal = {Mathematische Annalen}, 20030 volume = {163}, 20031 number = {2}, 20032 pages = {95--104}, 20033 year = {1966}, 20034 publisher = {Springer} 20035} 20036 20037@Article{ ptak1974, 20038 title = {A quantitative refinement of the closed graph theorem}, 20039 author = {Vlastimil Pt{\'a}k}, 20040 journal = {Czechoslovak Mathematical Journal}, 20041 volume = {24}, 20042 number = {3}, 20043 pages = {503--506}, 20044 year = {1974}, 20045 publisher = {Institute of Mathematics, Academy of Sciences of the Czech Republic} 20046} 20047 20048@Article{ ptak1975, 20049 title = {The rate of convergence of {Newton's} process}, 20050 author = {Vlastimil Pt{\'a}k}, 20051 journal = {Numerische Mathematik}, 20052 volume = {25}, 20053 number = {3}, 20054 pages = {279--285}, 20055 year = {1975}, 20056 publisher = {Springer} 20057} 20058 20059@Article{ ptak1976, 20060 title = {Nondiscrete mathematical induction and iterative existence proofs}, 20061 author = {Vlastimil Pt{\'a}k}, 20062 journal = {Linear algebra and its applications}, 20063 volume = {13}, 20064 number = {3}, 20065 pages = {223--238}, 20066 year = {1976}, 20067 publisher = {Elsevier} 20068} 20069 20070@Article{ ptak1977, 20071 title = {What should be a rate of convergence?}, 20072 author = {Vlastimil Pt{\'a}k}, 20073 journal = {RAIRO-Analyse num{\'e}rique}, 20074 volume = {11}, 20075 number = {3}, 20076 pages = {279--286}, 20077 year = {1977} 20078} 20079 20080@Article{ potraptak1980, 20081 title = {Sharp error bounds for {Newton's} process}, 20082 author = {Florian A Potra and Vlastimil Pt{\'a}k}, 20083 journal = {Numerische Mathematik}, 20084 volume = {34}, 20085 number = {1}, 20086 pages = {63--72}, 20087 year = {1980}, 20088 publisher = {Springer} 20089} 20090 20091@Article{ liesen2014, 20092 title = {Pt\'ak's nondiscrete induction and its application to matrix iterations}, 20093 author = {J{\"o}rg Liesen}, 20094 journal = {IMA Journal of Numerical Analysis}, 20095 doi = {10.1093/imanum/drv037}, 20096 archiveprefix = {arXiv}, 20097 eprint = {1405.2683}, 20098 primaryclass = {math-na}, 20099 year = {2015} 20100} 20101 20102@Book{ traub1964, 20103 title = {Iterative Methods for the Solution of Equations}, 20104 author = {Joseph F Traub}, 20105 year = {1964}, 20106 publisher = {Prentice-Hall, Englewood Cliffs, NJ} 20107} 20108 20109@InProceedings{ shalfvecpar2010, 20110 title = {Exascale Computing Technology Challenges}, 20111 author = {John Shalf and Sudip Dosanjh and John Morrison}, 20112 booktitle = {J.M.L.M. Palma et al. (Eds.): VECPAR 2010, LNCS 6449}, 20113 pages = {1–-25}, 20114 year = {2010} 20115} 20116 20117@Article{ frechet1907, 20118 title = {Sur les ensembles de fonctions et les op\'erations lin\'eaires}, 20119 author = {Maurice Ren\'e Fr\'echet}, 20120 journal = {C. R. Acad. Sci. Paris}, 20121 volume = {144}, 20122 pages = {1414--1416}, 20123 year = {1907} 20124} 20125 20126@Article{ riesz1907, 20127 title = {Sur une esp\'ece de g\'eom\'etrie analytique des syst\'emes de fonctions sommables}, 20128 author = {Frigyes Riesz}, 20129 journal = {C. R. Acad. Sci. Paris}, 20130 volume = {144}, 20131 pages = {1409--1411}, 20132 year = {1907} 20133} 20134 20135@Article{ riesz1909, 20136 title = {Sur les op\'erations fonctionnelles lin\'eaires}, 20137 author = {Frigyes Riesz}, 20138 journal = {C. R. Acad. Sci. Paris}, 20139 volume = {149}, 20140 pages = {974--977}, 20141 year = {1909} 20142} 20143 20144@Misc{ rieszmarkovkakutanirepresentationtheorem, 20145 author = {Wikipedia}, 20146 title = {Riesz-Markov-Kakutani Representation Theorem}, 20147 url = {http://en.wikipedia.org/wiki/Riesz-Markov-Kakutani_representation_theorem}, 20148 note = {\url{http://en.wikipedia.org/wiki/Riesz-Markov-Kakutani_representation_theorem}}, 20149 year = {2015} 20150} 20151 20152@Article{ markov1938, 20153 title = {On mean values and exterior densities}, 20154 author = {Andrey Markov}, 20155 journal = {Rec. Math. Moscou}, 20156 volume = {4}, 20157 pages = {165--190}, 20158 year = {1938} 20159} 20160 20161@Article{ kakutani1941, 20162 title = {Concrete representation of abstract {(M)}-spaces. (A characterization of the 20163 space of continuous functions.)}, 20164 author = {Shizuo Kakutani}, 20165 journal = {Ann. of Math.}, 20166 volume = {2}, 20167 number = {42}, 20168 pages = {994--1024}, 20169 doi = {10.2307/1968778}, 20170 year = {1941} 20171} 20172 20173@Article{ michoskimeyersonisaacwaelbroeck2014, 20174 title = {Discontinuous Galerkin methods for plasma physics in the scrape-off layer of 20175 tokamaks}, 20176 author = {Craig Michoski and D. Meyerson and Tobin Isaac and F. Waelbroeck}, 20177 journal = {Journal of Computational Physics}, 20178 volume = {274}, 20179 pages = {898--919}, 20180 year = {2014}, 20181 publisher = {Elsevier} 20182} 20183 20184@InProceedings{ bursteddeghattasgurnisisaacstadlerwarburtonwilcox2010, 20185 title = {Extreme-scale AMR}, 20186 author = {Carsten Burstedde and Omar Ghattas and Michael Gurnis and Tobin Isaac and Georg 20187 Stadler and Tim Warburton and Lucas Wilcox}, 20188 booktitle = {Proceedings of the 2010 ACM/IEEE International Conference for High Performance 20189 Computing, Networking, Storage and Analysis}, 20190 pages = {1--12}, 20191 year = {2010}, 20192 organization = {IEEE Computer Society}, 20193 doi = {10.1109/SC.2010.25} 20194} 20195 20196@InProceedings{ isaacbursteddeghattas2012, 20197 title = {Low-cost parallel algorithms for 2: 1 octree balance}, 20198 author = {Tobin Isaac and Carsten Burstedde and Omar Ghattas}, 20199 booktitle = {Parallel \& Distributed Processing Symposium (IPDPS), 2012 IEEE 26th 20200 International}, 20201 pages = {426--437}, 20202 year = {2012}, 20203 organization = {IEEE}, 20204 doi = {10.1109/IPDPS.2012.47} 20205} 20206 20207@Article{ isaacpetrastadlerghattas2015, 20208 title = {Scalable and efficient algorithms for the propagation of uncertainty from data 20209 through inference to prediction for large-scale problems, with application to flow 20210 of the {Antarctic} ice sheet}, 20211 author = {Tobin Isaac and Noemi Petra and Georg Stadler and Omar Ghattas}, 20212 journal = {Journal of Computational Physics}, 20213 volume = {296}, 20214 pages = {348--368}, 20215 year = {2015}, 20216 publisher = {Elsevier}, 20217 doi = {10.1016/j.jcp.2015.04.047} 20218} 20219 20220@Article{ isaacbursteddewilcoxghattas2015, 20221 title = {Recursive Algorithms for Distributed Forests of Octrees}, 20222 author = {Tobin Isaac and Carsten Burstedde and Lucas C Wilcox and Omar Ghattas}, 20223 journal = {SIAM Journal on Scientific Computing}, 20224 volume = {37}, 20225 number = {5}, 20226 pages = {C497-C531}, 20227 eprint = {1406.0089}, 20228 eprinttype = {arXiv}, 20229 year = {2015}, 20230 doi = {10.1137/140970963} 20231} 20232 20233@Article{ isaacstadlerghattas2015, 20234 title = {Solution of nonlinear {S}tokes equations discretized by high-order finite 20235 elements on nonconforming and anisotropic meshes, with application to ice sheet 20236 dynamics}, 20237 author = {Isaac, Tobin and Stadler, Georg and Ghattas, Omar}, 20238 journal = {SIAM Journal on Scientific Computing}, 20239 number = {6}, 20240 pages = {804--833}, 20241 volume = {37}, 20242 year = {2015}, 20243 doi = {10.1137/140974407} 20244} 20245 20246@InProceedings{ rudimalossiisaacstadlergurnisstaarineichenbekascurionighattas2015, 20247 title = {An extreme-scale implicit solver for complex {PDEs}: highly heterogeneous flow in 20248 earth's mantle}, 20249 author = {Johann Rudi and A Cristiano I Malossi and Tobin Isaac and Georg Stadler and 20250 Michael Gurnis and Peter WJ Staar and Yves Ineichen and Costas Bekas and 20251 Alessandro Curioni and Omar Ghattas}, 20252 booktitle = {Proceedings of the International Conference for High Performance Computing, 20253 Networking, Storage and Analysis}, 20254 pages = {5}, 20255 year = {2015}, 20256 organization = {ACM}, 20257 doi = {10.1145/2807591.2807675} 20258} 20259 20260@Article{ bunchhopcroft1974, 20261 title = {Triangular factorization and inversion by fast matrix multiplication}, 20262 author = {James R Bunch and John E Hopcroft}, 20263 journal = {Mathematics of Computation}, 20264 volume = {28}, 20265 number = {125}, 20266 pages = {231--236}, 20267 doi = {10.2307/2005828}, 20268 year = {1974} 20269} 20270 20271@Article{ nemirovsky1991, 20272 title = {On optimality of Krylov's information when solving linear operator equations}, 20273 author = {A.S Nemirovsky}, 20274 journal = {Journal of Complexity}, 20275 volume = {7}, 20276 number = {2}, 20277 pages = {121--130}, 20278 doi = {10.1016/0885-064X(91)90001-E}, 20279 year = {1991} 20280} 20281 20282@Misc{siamcseprize, 20283 author = {{PETSc Team}}, 20284 title = {{SIAM/ACM} {P}rize in {C}omputational {S}cience and {E}ngineering}, 20285 key = {{SIAM/ACM} {P}rize in {C}omputational {S}cience and {E}ngineering}, 20286 url = {https://www.siam.org/prizes/sponsored/cse.php}, 20287 year = {2015} 20288} 20289 20290@Article{ rathgeber2017, 20291 title = {Firedrake: automating the finite element method by composing abstractions}, 20292 author = {Rathgeber, Florian and Ham, David A and Mitchell, Lawrence and Lange, Michael and 20293 Luporini, Fabio and McRae, Andrew TT and Bercea, Gheorghe-Teodor and Markall, 20294 Graham R and Kelly, Paul HJ}, 20295 archiveprefix = {arXiv}, 20296 journal = {ACM Transaction on Mathematical Software}, 20297 eprint = {1501.01809}, 20298 volume = {43}, 20299 issue = {3}, 20300 number = {24}, 20301 year = {2017}, 20302 url = {http://arxiv.org/abs/1501.01809} 20303} 20304 20305@Article{ kirby2006b, 20306 title = {Topological optimization of the evaluation of finite element matrices}, 20307 author = {Robert C Kirby and Anders Logg and L Ridgway Scott and Andy R. Terrel}, 20308 journal = {SIAM Journal on Scientific Computing}, 20309 volume = {28}, 20310 number = {1}, 20311 pages = {224--240}, 20312 year = {2006}, 20313 publisher = {SIAM} 20314} 20315 20316@Article{ luporini2015, 20317 author = {Luporini, Fabio and Varbanescu, Ana Lucia and Rathgeber, Florian and Bercea, 20318 Gheorghe-Teodor and Ramanujam, J. and Ham, David A. and Kelly, Paul H. J.}, 20319 title = {Cross-Loop Optimization of Arithmetic Intensity for Finite Element Local 20320 Assembly}, 20321 journal = {ACM Trans. Archit. Code Optim.}, 20322 issue_date = {January 2015}, 20323 volume = {11}, 20324 number = {4}, 20325 month = jan, 20326 year = {2015}, 20327 issn = {1544-3566}, 20328 pages = {57:1--57:25}, 20329 articleno = {57}, 20330 numpages = {25}, 20331 doi = {10.1145/2687415}, 20332 acmid = {2687415}, 20333 publisher = {ACM}, 20334 address = {New York, NY, USA}, 20335 keywords = {Finite element integration, SIMD vectorization, compilers, local assembly, 20336 optimizations} 20337} 20338 20339@Article{ markall2012, 20340 title = {Finite element assembly strategies on multi- and many-core architectures}, 20341 author = {Markall, G. R. and Slemmer, A. and Ham, D. A. and Kelly, P. H. J. and Cantwell, 20342 C. D. and Sherwin, S. J.}, 20343 journal = {International Journal for Numerical Methods in Fluids}, 20344 year = {2013}, 20345 volume = {71}, 20346 pages = {80--97}, 20347 doi = {10.1002/fld.3648} 20348} 20349 20350@Article{ markall2010, 20351 title = {Towards generating optimised finite element solvers for GPUs from high-level 20352 specifications}, 20353 author = {Graham R. Markall and David A. Ham and Paul H. J. Kelly}, 20354 journal = {Procedia Computer Science}, 20355 volume = {1}, 20356 number = {1}, 20357 pages = {1815--1823}, 20358 year = {2010}, 20359 note = {{ICCS} 2010}, 20360 doi = {10.1016/j.procs.2010.04.203} 20361} 20362 20363@Article{ longkirbywaanders2010, 20364 title = {Unified embedded parallel finite element computations via software-based 20365 Fr{\'e}chet differentiation}, 20366 author = {Kevin Long and Robert Kirby and Bart van Bloemen Waanders}, 20367 journal = {SIAM Journal on Scientific Computing}, 20368 volume = {32}, 20369 number = {6}, 20370 pages = {3323--3351}, 20371 year = {2010}, 20372 publisher = {SIAM} 20373} 20374 20375@Article{ kirby2010, 20376 title = {From functional analysis to iterative methods}, 20377 author = {Robert C Kirby}, 20378 journal = {SIAM review}, 20379 volume = {52}, 20380 number = {2}, 20381 pages = {269--293}, 20382 year = {2010}, 20383 publisher = {SIAM} 20384} 20385 20386@Article{ kirby2014, 20387 title = {Low-Complexity Finite Element Algorithms for the de Rham Complex on Simplices}, 20388 author = {Robert C Kirby}, 20389 journal = {SIAM Journal on Scientific Computing}, 20390 volume = {36}, 20391 number = {2}, 20392 pages = {A846--A868}, 20393 year = {2014}, 20394 publisher = {SIAM} 20395} 20396 20397@Article{ kirby2011, 20398 title = {Fast simplicial finite element algorithms using Bernstein polynomials}, 20399 author = {Robert C Kirby}, 20400 journal = {Numerische Mathematik}, 20401 volume = {117}, 20402 number = {4}, 20403 pages = {631--652}, 20404 year = {2011}, 20405 publisher = {Springer} 20406} 20407 20408@Article{ arnoldfalkwinther2006, 20409 title = {Finite element exterior calculus, homological techniques, and applications}, 20410 author = {Arnold, Douglas N and Falk, Richard S and Winther, Ragnar}, 20411 journal = {Acta numerica}, 20412 volume = {15}, 20413 pages = {1--155}, 20414 year = {2006}, 20415 publisher = {Cambridge Univ Press} 20416} 20417 20418@Article{ arnoldlogg2014, 20419 title = {Periodic table of the finite elements}, 20420 author = {Douglas Arnold and Anders Logg}, 20421 month = nov, 20422 journal = {SIAM News}, 20423 year = {2014} 20424} 20425 20426@Article{ janssonhoffmanjansson2012, 20427 title = {Framework for massively parallel adaptive finite element computational fluid 20428 dynamics on tetrahedral meshes}, 20429 author = {Jansson, Niclas and Hoffman, Johan and Jansson, Johan}, 20430 journal = {SIAM Journal on Scientific Computing}, 20431 volume = {34}, 20432 number = {1}, 20433 pages = {C24--C41}, 20434 year = {2012}, 20435 publisher = {SIAM} 20436} 20437 20438@Article{ rogneshamcottermcrae2013, 20439 title = {Automating the solution of PDEs on the sphere and other manifolds in FEniCS 1.2}, 20440 author = {Rognes, Marie E and Ham, David A and Cotter, Colin J and McRae, Andrew TT}, 20441 journal = {Geoscientific Model Development}, 20442 volume = {6}, 20443 number = {6}, 20444 pages = {2099--2119}, 20445 year = {2013}, 20446 publisher = {Copernicus GmbH} 20447} 20448 20449@Book{ loggmardalwells2012, 20450 title = {Automated solution of differential equations by the finite element method: The 20451 FEniCS book}, 20452 author = {Logg, Anders and Mardal, Kent-Andre and Wells, Garth}, 20453 volume = {84}, 20454 year = {2012}, 20455 publisher = {Springer Science \& Business Media} 20456} 20457 20458@Article{ cotterkirby2014, 20459 title = {Mixed finite elements for global tide models}, 20460 author = {Colin J Cotter and Robert C Kirby}, 20461 archiveprefix = {arXiv}, 20462 journal = {Submitted}, 20463 eprint = {1410.0045}, 20464 year = {2014}, 20465 url = {http://arxiv.org/abs/1410.0045} 20466} 20467 20468@Article{ kirbykieu2015, 20469 title = {Symplectic-mixed finite element approximation of linear acoustic wave equations}, 20470 author = {Robert C Kirby and Thinh Tri Kieu}, 20471 journal = {Numerische Mathematik}, 20472 volume = {130}, 20473 number = {2}, 20474 pages = {257--291}, 20475 year = {2015}, 20476 publisher = {Springer} 20477} 20478 20479@Article{ brennankirby2015, 20480 title = {Finite element approximation and preconditioners for a coupled thermo-acoustic 20481 model}, 20482 author = {Brian Brennan and Robert C Kirby}, 20483 journal = {Submitted to Computers and Mathematics with Applications}, 20484 year = {2015} 20485} 20486 20487@Article{ howlekirbydillon2013, 20488 title = {Block preconditioners for coupled physics problems}, 20489 author = {Victoria E Howle and Robert C Kirby and Geoffrey Dillon}, 20490 journal = {SIAM Journal on Scientific Computing}, 20491 volume = {35}, 20492 number = {5}, 20493 pages = {S368--S385}, 20494 year = {2013}, 20495 publisher = {SIAM} 20496} 20497 20498@Book{ malekstrakos2014, 20499 title = {Preconditioning and the conjugate gradient method in the context of solving 20500 PDEs}, 20501 author = {Josef M{\'a}lek and Zden\u{e}k Strako\u{s}}, 20502 volume = {1}, 20503 year = {2014}, 20504 publisher = {SIAM} 20505} 20506 20507@Article{ desturler1995, 20508 title = {Reducing the effect of global communication in GMRES(m) and \{CG\} on parallel 20509 distributed memory computers}, 20510 author = {E. de Sturler and H.A. van der Vorst}, 20511 journal = {Applied Numerical Mathematics}, 20512 volume = {18}, 20513 number = {4}, 20514 pages = {441--459}, 20515 year = {1995}, 20516 doi = {10.1016/0168-9274(95)00079-A} 20517} 20518 20519@Article{ velicmaymoresi2009, 20520 title = {A fast robust algorithm for computing discrete voronoi diagrams}, 20521 author = {Velic, Mirko and May, Dave and Moresi, Louis}, 20522 journal = {Journal of Mathematical Modelling and Algorithms}, 20523 volume = {8}, 20524 number = {3}, 20525 pages = {343--355}, 20526 year = {2009}, 20527 publisher = {Springer} 20528} 20529 20530@Article{ may2012, 20531 title = {Volume reconstruction of point cloud data sets derived from computational 20532 geodynamic simulations}, 20533 author = {May, DA}, 20534 journal = {Geochemistry, Geophysics, Geosystems}, 20535 volume = {13}, 20536 number = {5}, 20537 year = {2012}, 20538 publisher = {Wiley Online Library} 20539} 20540 20541@Article{ quenettehodkinson2010, 20542 title = {StgDomain--scalable parallel domain software components for particle-in-cell 20543 finite element methods}, 20544 author = {Quenette, Steve and Hodkinson, Luke}, 20545 journal = {Concurrency and Computation: Practice and Experience}, 20546 volume = {22}, 20547 number = {12}, 20548 pages = {1593--1603}, 20549 year = {2010}, 20550 publisher = {Wiley Online Library} 20551} 20552 20553@Book{ velic2005, 20554 title = {Gauge Invariant Integration and Perturbation of Petrov Type D Spacetimes}, 20555 author = {Velic, Mirko}, 20556 year = {2005}, 20557 publisher = {Monash University} 20558} 20559 20560@Article{ velicknepleymay2016, 20561 title = {Numerically Stable Exact Solutions for Variable-Viscosity Stokes Equations}, 20562 author = {Mirko Velic and Louis Moresi and Dave May and Matthew Knepley}, 20563 note = {in preparation}, 20564 year = {2016} 20565} 20566 20567@Article{ traubwozniakowski1979, 20568 title = {Convergence and complexity of Newton iteration for operator equations}, 20569 author = {Joseph Frederick Traub and H. Wo{\'z}niakowski}, 20570 journal = {Journal of the ACM (JACM)}, 20571 volume = {26}, 20572 number = {2}, 20573 pages = {250--258}, 20574 year = {1979}, 20575 publisher = {ACM} 20576} 20577 20578@Article{ sterck2013, 20579 title = {Steepest descent preconditioning for nonlinear {GMRES} optimization}, 20580 author = {Hans De Sterck}, 20581 journal = {Numerical Linear Algebra with Applications}, 20582 volume = {20}, 20583 number = {3}, 20584 pages = {453--471}, 20585 year = {2013} 20586} 20587 20588@Article{ sterckwinlaw2015, 20589 title = {A nonlinearly preconditioned conjugate gradient algorithm for {rank-R} canonical 20590 tensor approximation}, 20591 author = {Hans De Sterck and Manda Winlaw}, 20592 journal = {Numerical Linear Algebra with Applications}, 20593 volume = {22}, 20594 number = {3}, 20595 pages = {410--432}, 20596 year = {2015} 20597} 20598 20599@Article{ sterckhowse2015, 20600 title = {Nonlinearly preconditioned optimization on {Grassman} manifolds for computing 20601 approximate {Tucker} tensor decompositions}, 20602 author = {Hans De Sterck and Alexander Howse}, 20603 journal = {SIAM Journal on Scientific Computing}, 20604 note = {submitted}, 20605 year = {2015} 20606} 20607 20608@Book{ ladevezesimmonds1999, 20609 title = {Nonlinear computational structural mechanics: {N}ew approaches and 20610 non-incremental methods of calculation}, 20611 author = {P. Ladev{\`e}ze and J.G. Simmonds}, 20612 series = {{M}echanical {E}ngineering {S}eries}, 20613 url = {http://books.google.com/books?id=McZRAAAAMAAJ}, 20614 isbn = {9780387985947}, 20615 lccn = {98029990}, 20616 year = {1999}, 20617 publisher = {Springer} 20618} 20619 20620@InProceedings{ walkerwoodwardyang2010, 20621 title = {An accelerated fixed-point iteration for solution of variably saturated flow}, 20622 author = {Homer F Walker and Carol S Woodward and Ulrike M Yang}, 20623 booktitle = {Proc. XVIII International Conference on Water Resources, Barcelona}, 20624 year = {2010} 20625} 20626 20627@Article{ lottwalkerwoodwardyang2012, 20628 title = {An accelerated {P}icard method for nonlinear systems related to variably 20629 saturated flow}, 20630 author = {P. A. Lott and H. F. Walker and C. S. Woodward and U. M. Yang}, 20631 journal = {Advances in Water Resources}, 20632 volume = {38}, 20633 number = {0}, 20634 pages = {92--101}, 20635 doi = {10.1016/j.advwatres.2011.12.013}, 20636 year = {2012} 20637} 20638 20639@TechReport{ mohrrude1998, 20640 title = {Communication Reduced Parallel Multigrid: Analysis and Experiments}, 20641 author = {Marcus Mohr and Ulrich R\"ude}, 20642 type = {Technical Report}, 20643 number = {394}, 20644 institution = {University of Augsburg}, 20645 year = {1998} 20646} 20647 20648@InProceedings{ mohr2000, 20649 title = {Low Communication Parallel Multigrid}, 20650 author = {Mohr, Marcus}, 20651 booktitle = {Euro-Par 2000 Parallel Processing}, 20652 pages = {806--814}, 20653 year = {2000}, 20654 organization = {Springer} 20655} 20656 20657@Article{ brandtdiskin1994, 20658 title = {Multigrid solvers on decomposed domains}, 20659 author = {Achi Brandt and Boris Diskin}, 20660 journal = {Contemporary Mathematics}, 20661 volume = {157}, 20662 year = {1994}, 20663 publisher = {AMERICAN MATHEMATICAL SOCIETY} 20664} 20665 20666@InProceedings{ prabhuetal2011, 20667 title = {A Survey of the Practice of Computational Science}, 20668 author = {Prabhu, Prakash and Jablin, Thomas B. and Raman, Arun and Zhang, Yun and Huang, 20669 Jialu and Kim, Hanjun and Johnson, Nick P. and Liu, Feng and Ghosh, Soumyadeep and 20670 Beard, Stephen and Oh, Taewook and Zoufaly, Matthew and Walker, David and August, 20671 David I.}, 20672 booktitle = {State of the Practice Reports}, 20673 series = {SC '11}, 20674 year = {2011}, 20675 isbn = {978-1-4503-1139-7}, 20676 location = {Seattle, Washington}, 20677 pages = {19:1--19:12}, 20678 articleno = {19}, 20679 numpages = {12}, 20680 doi = {10.1145/2063348.2063374}, 20681 acmid = {2063374}, 20682 publisher = {ACM}, 20683 address = {New York, NY, USA} 20684} 20685 20686@PhDThesis{ dinarthesis1979, 20687 title = {Fast methods for the numerical solution of boundary value problems}, 20688 author = {N. Dinar}, 20689 school = {Weizmann Institute of Science}, 20690 year = {1979} 20691} 20692 20693@Article{ thomasdiskinbrandt2001, 20694 title = {Textbook multigrid efficiency for the incompressible Navier--Stokes equations: 20695 high Reynolds number wakes and boundary layers}, 20696 author = {James L Thomas and Boris Diskin and Achi Brandt}, 20697 journal = {Computers \& fluids}, 20698 volume = {30}, 20699 number = {7}, 20700 pages = {853--874}, 20701 year = {2001}, 20702 publisher = {Elsevier} 20703} 20704 20705@Article{ greenbaumptakstrakos1996, 20706 title = {Any nonincreasing convergence curve is possible for {GMRES}}, 20707 author = {Anne Greenbaum and Vlastimil Pt{\'a}k and Zden{\v{e}}k Strako{\v{s}}}, 20708 journal = {SIAM Journal on Matrix Analysis and Applications}, 20709 volume = {17}, 20710 number = {3}, 20711 pages = {465--469}, 20712 year = {1996}, 20713 publisher = {SIAM} 20714} 20715 20716@Article{ nangiapatankarbhalla2019, 20717 title = {A {DLM} immersed boundary method based wave-structure interaction solver for high 20718 density ratio multiphase flows}, 20719 author = {Nishant Nangia and Neelesh A Patankar and Amneet Pal Singh Bhalla}, 20720 journal = {Journal of Computational Physics}, 20721 volume = {398}, 20722 pages = {108804}, 20723 year = {2019} 20724} 20725 20726@Article{ bhallanangiadafnakisbraccomattiazzo2019, 20727 title = {Simulating water-entry/exit problems using {Eulerian}-{Lagrangian} and 20728 fully-{Eulerian} fictitious domain methods within the open-source {IBAMR} 20729 library}, 20730 author = {Amneet Pal Singh Bhalla and Nishant Nangia and Panagiotis Dafnakis and Giovanni 20731 Bracco and Giuliana Mattiazzo}, 20732 journal = {Applied Ocean Research}, 20733 note = {In press}, 20734 year = {2019} 20735} 20736 20737@Article{ bhallagriffithpatankardonev2013, 20738 title = {A minimally-resolved immersed boundary model for reaction-diffusion problems}, 20739 author = {Amneet Pal Singh Bhalla and Boyce E. Griffith and Neelesh A. Patankar and 20740 Alexander Donev}, 20741 journal = {Journal of Chemical Physics}, 20742 volume = {139}, 20743 number = {21}, 20744 pages = {214112}, 20745 year = {2013} 20746} 20747 20748@Article{ bhallabalegriffithpatankar2014, 20749 title = {Fully resolved immersed electrohydrodynamics for particle motion, 20750 electrolocation, and self-propulsion}, 20751 author = {Amneet Pal Singh Bhalla and R. Bale and Boyce E. Griffith and Neelesh A. 20752 Patankar}, 20753 journal = {Journal of Computational Physics}, 20754 volume = {256}, 20755 pages = {88--108}, 20756 year = {2014} 20757} 20758 20759@Article{ usabiagakallemovdelmottebhallagriffithdonev2016, 20760 title = {Hydrodynamics of suspensions of passive and active rigid particles: a rigid 20761 multiblob approach}, 20762 author = {F. Balboa Usabiaga and B. Kallemov and B. Delmotte and Amneet Pal Singh Bhalla 20763 and Boyce E. Griffith and Alexander Donev}, 20764 journal = {Communications in Applied Mathematics and Computational Science}, 20765 volume = {11}, 20766 number = {2}, 20767 pages = {217--296}, 20768 year = {2016} 20769} 20770 20771@Article{ koubhallagriffithpandolfinokahrilaspatankar2015, 20772 title = {A fully resolved active musculo-mechanical model for esophageal transport}, 20773 author = {W. Kou and Amneet Pal Singh Bhalla and Boyce E. Griffith and J.E. Pandolfino and 20774 P.J. Kahrilas and Neelesh A. Patankar}, 20775 journal = {Journal of Computational Physics}, 20776 volume = {298}, 20777 pages = {446--465}, 20778 year = {2015} 20779} 20780 20781@Article{ balenevelnbhallamaciverpatankar2015, 20782 title = {Convergent evolution of mechanically optimal locomotion in aquatic invertebrates 20783 and vertebrates}, 20784 author = {R. Bale and I. D. Neveln and Amneet Pal Singh Bhalla and M.A. MacIver and Neelesh 20785 A. Patankar}, 20786 journal = {PLoS Biology}, 20787 volume = {13}, 20788 number = {4}, 20789 pages = {1--22}, 20790 year = {2015} 20791} 20792 20793@Article{ balehaobhallapatankar2014, 20794 title = {Energy efficiency and allometry of movement of swimming and flying animals}, 20795 author = {Rahul Bale and Max Hao and Amneet Pal Singh Bhalla and Neelesh A Patankar}, 20796 journal = {Proceedings of the National Academy of Sciences}, 20797 volume = {111}, 20798 number = {21}, 20799 pages = {7517--7521}, 20800 year = {2014} 20801} 20802 20803@Article{ bhallabalegriffithpatankar2013, 20804 title = {A unified mathematical framework and an adaptive numerical method for 20805 fluid--structure interaction with rigid, deforming, and elastic bodies}, 20806 author = {Amneet Pal Singh Bhalla and Rahul Bale and Boyce E Griffith and Neelesh A 20807 Patankar}, 20808 journal = {Journal of Computational Physics}, 20809 volume = {250}, 20810 pages = {446--476}, 20811 year = {2013}, 20812 publisher = {Elsevier} 20813} 20814 20815@Article{ takeikatz2013, 20816 title = {Consequences of viscous anisotropy in a deforming, two-phase aggregate. Part 1. 20817 Governing equations and linearized analysis}, 20818 author = {Yasuko Takei and Richard F. Katz}, 20819 journal = {Journal of Fluid Mechanics}, 20820 volume = {734}, 20821 issn = {1469-7645}, 20822 pages = {424--455}, 20823 numpages = {32}, 20824 doi = {10.1017/jfm.2013.482}, 20825 month = nov, 20826 year = {2013} 20827} 20828 20829@Misc{ stewart2011, 20830 title = {Fredholm, Hilbert, Schmidt: Three Fundamental Papers on Integral Equations}, 20831 author = {G. W. Stewart}, 20832 note = {Translated with commentary by G. W. Stewart}, 20833 url = {http://www.cs.umd.edu/~stewart/FHS.pdf}, 20834 year = {2011} 20835} 20836 20837@Article{ douglisnirenberg1955, 20838 title = {nterior Estimates for Elliptic Systems of Partial Differential Equations}, 20839 author = {Avron Douglis and Louis Nirenberg}, 20840 journal = {Communications on Pure and Applied Mathematics}, 20841 volume = {8}, 20842 pages = {503--538}, 20843 year = {1955} 20844} 20845 20846@Article{ gorelickgalunsharonbasribrandt2006, 20847 title = {Shape Representation and Classification Using the Poisson Equation}, 20848 author = {Lena Gorelick and Meirav Galun and Eitan Sharon and Ronen Basri and Achi Brandt}, 20849 journal = {IEEE Transactions on Pattern Analysis and Machine Intelligence}, 20850 volume = {28}, 20851 number = {12}, 20852 pages = {1991--2005}, 20853 year = {2006} 20854} 20855 20856@Article{ salsbury2006, 20857 title = {Analysis of errors in {Still's} equation for macromolecular electrostatic 20858 solvation energies}, 20859 author = {Freddie R. Salsbury Jr.}, 20860 journal = {Molecular Physics}, 20861 volume = {104}, 20862 number = {08}, 20863 pages = {1299--1309}, 20864 year = {2006} 20865} 20866 20867@Article{ sigalov2006, 20868 title = {Analytical electrostatics for biomolecules: {Beyond} the generalized {Born} 20869 approximation}, 20870 author = {G. Sigalov and A. Fenley and A. Onufriev}, 20871 journal = {Journal of Chemical Physics}, 20872 volume = {124}, 20873 number = {124902}, 20874 year = {2006} 20875} 20876 20877@Article{ dennard1974, 20878 title = {Design of ion-implanted {MOSFET's} with very small physical dimensions}, 20879 author = {Robert H Dennard and Fritz H Gaensslen and V Leo Rideout and Ernest Bassous and 20880 Andre R LeBlanc}, 20881 journal = {IEEE Journal of Solid-State Circuits}, 20882 volume = {9}, 20883 number = {5}, 20884 pages = {256--268}, 20885 year = {1974} 20886} 20887 20888@Article{ zeegeijn2015, 20889 author = {Field G. {V}an~{Z}ee and Robert A. {v}an~{d}e~{G}eijn}, 20890 title = {{BLIS}: A Framework for Rapidly Instantiating {BLAS} Functionality}, 20891 journal = {ACM Transactions on Mathematical Software}, 20892 volume = {41}, 20893 number = {3}, 20894 pages = {14:1--14:33}, 20895 month = jun, 20896 year = {2015}, 20897 issue_date = {jun}, 20898 doi = {10.1145/2764454} 20899} 20900 20901@Article{ campbell1976, 20902 title = {Assessing the Impact of Planned Social Change}, 20903 author = {Donald T. Campbell}, 20904 journal = {Occasional Paper Series, The Public Affairs Center}, 20905 number = {8}, 20906 publisher = {Dartmouth College}, 20907 year = {1976} 20908} 20909 20910@Article{ smaldinomcelreath2016, 20911 title = {The natural selection of bad science}, 20912 author = {Paul E. Smaldino and Richard McElreath}, 20913 journal = {Royal Society Open Science}, 20914 volume = {3}, 20915 number = {9}, 20916 url = {http://rsos.royalsocietypublishing.org/content/3/9/160384}, 20917 eprint = {http://rsos.royalsocietypublishing.org/content/3/9/160384.full.pdf}, 20918 doi = {10.1098/rsos.160384}, 20919 year = {2016}, 20920 publisher = {The Royal Society} 20921} 20922 20923@Article{ harlowwelch1965, 20924 title = {Numerical calculation of time-dependent viscous incompressible flow of fluid with 20925 free surface}, 20926 author = {Francis H Harlow and J Eddie Welch}, 20927 journal = {Physics of fluids}, 20928 volume = {8}, 20929 number = {12}, 20930 pages = {2182--2189}, 20931 url = {http://www.cs.rpi.edu/~cutler/classes/advancedgraphics/S12/papers/harlow_welch.pdf}, 20932 year = {1965} 20933} 20934 20935@Article{ diskinthomasmineck2005, 20936 title = {{On Quantitative Analysis Methods for Multigrid Solutions}}, 20937 author = {Boris Diskin and James L. Thomas and Raymond E. Mineck}, 20938 journal = {SIAM Journal on Scientific Computing}, 20939 volume = {27}, 20940 number = {1}, 20941 pages = {108--129}, 20942 doi = {10.1137/030601521}, 20943 issn = {1064-8275}, 20944 year = {2005} 20945} 20946 20947@TechReport{ scott2012, 20948 title = {Fostering Interactions Between the Geosciences and Mathematics, Statistics, and 20949 Computer Science}, 20950 author = {L. Ridgway Scott and Jed Brown and George W. Bergantz and Dan Cooley and Clint 20951 Dawson and Maarten de Hoop and Donald Estep and Natasha Flyer and Efi 20952 Foufoula-Georgiou and Michael Ghil and Matthew G. Knepley and Randall J. LeVeque 20953 and Lek-Heng Lim and Serge Prudhomme and Adrian Sandu and Frederik J. Simons and 20954 Philip B. Stark and Michael Stein and Seth Stein and Toshiro Tanimoto and Daniel 20955 Tartakovsky and Jonathan Weare and Robert Weiss and Grady B. Wright and Dave 20956 Yuen}, 20957 institution = {University of Chicago}, 20958 number = {2012-02}, 20959 url = {http://cs.uchicago.edu/files/tr_authentic/TR-2012-02.pdf}, 20960 year = {2012} 20961} 20962 20963@Article{ paigesaunders1975, 20964 title = {Solution of Sparse Indefinite Systems of Linear Equations}, 20965 author = {C. C. Paige and M. A. Saunders}, 20966 journal = {SIAM Journal on Numerical Analysis}, 20967 volume = {12}, 20968 pages = {617--629}, 20969 year = {1975} 20970} 20971 20972@Article{ roth2010, 20973 title = {Fundamental measure theory for hard-sphere mixtures: a review}, 20974 author = {Roland Roth}, 20975 journal = {J. Phys. Cond. Mat.}, 20976 volume = {22}, 20977 pages = {063102}, 20978 year = {2010} 20979} 20980 20981@Article{ wu2008, 20982 title = {Density functional theory for liquid structure and thermodynamics}, 20983 author = {J. Z. Wu}, 20984 journal = {Struct. Bond.}, 20985 doi = {10.1007/430_2008_3}, 20986 year = {2008} 20987} 20988 20989@Article{ goel2008, 20990 title = {Molecular solvent model of cylindrical electric double layers: a systematic study 20991 by {Monte Carlo} simulations and density functional theory}, 20992 author = {T. Goel and C. N. Patra and S. K. Ghosh and T. Mukherjee}, 20993 journal = {J. Chem. Phys.}, 20994 volume = {129}, 20995 pages = {154707}, 20996 year = {2008} 20997} 20998 20999@Article{ marchxiaoyubiros2015, 21000 title = {{ASKIT:} An efficient, parallel library for high-dimensional kernel summations}, 21001 author = {William B March and Bo Xiao and Chenhan D Yu and George Biros}, 21002 journal = {SIAM Journal on Scientific Computing (to appear)}, 21003 year = {2015} 21004} 21005 21006@InProceedings{ yangduraiswamigumerovdavis2003, 21007 title = {Improved fast gauss transform and efficient kernel density estimation}, 21008 author = {Changjiang Yang and Ramani Duraiswami and Nail A Gumerov and Larry Davis}, 21009 booktitle = {Proceedings of the Ninth IEEE International Conference on Computer Vision}, 21010 pages = {664--671}, 21011 year = {2003}, 21012 organization = {IEEE} 21013} 21014 21015@Article{ fornberglarssonflyer2011, 21016 title = {Stable computations with Gaussian radial basis functions}, 21017 author = {Bengt Fornberg and Elisabeth Larsson and Natasha Flyer}, 21018 journal = {SIAM Journal on Scientific Computing}, 21019 volume = {33}, 21020 number = {2}, 21021 pages = {869--892}, 21022 year = {2011}, 21023 publisher = {SIAM} 21024} 21025 21026@InProceedings{ srinivasanqiduraiswami2010, 21027 title = {GPUML: Graphical processors for speeding up kernel machines}, 21028 author = {Balaji Vasan Srinivasan and H Qi and Ramani Duraiswami}, 21029 booktitle = {SIAM Conf. on Data Mining. Workshop on High Performance Analytics-Algorithms, 21030 Implementations, and Applications}, 21031 year = {2010} 21032} 21033 21034@Article{ jadamecbillen2010, 21035 title = {Reconciling surface plate motions with rapid three-dimensional mantle flow around 21036 a slab edge}, 21037 author = {Margarete A Jadamec and Magali I Billen}, 21038 journal = {Nature}, 21039 volume = {465}, 21040 number = {7296}, 21041 pages = {338--341}, 21042 year = {2010} 21043} 21044 21045@Article{ jadamecbillen2012, 21046 title = {The role of rheology and slab shape on rapid mantle flow: Three-dimensional 21047 numerical models of the Alaska slab edge}, 21048 author = {Margarete A Jadamec and Magali I Billen}, 21049 journal = {Journal of Geophysical Research: Solid Earth}, 21050 volume = {117}, 21051 number = {B2}, 21052 year = {2012} 21053} 21054 21055@Article{ jadamec2015, 21056 title = {Slab-driven Mantle Weakening and Rapid Mantle Flow}, 21057 author = {Margarete A Jadamec}, 21058 journal = {Subduction Dynamics: From Mantle Flow to Mega Disasters}, 21059 volume = {211}, 21060 pages = {135}, 21061 year = {2015} 21062} 21063 21064@Article{ durancejadamecfalloonnicholls2012, 21065 title = {Magmagenesis within the {H}unter {R}idge {R}ift {Z}one resolved from 21066 olivine-hosted melt inclusions and geochemical modelling with insights from 21067 geodynamic models}, 21068 author = {Patricia MJ Durance and Margarete A Jadamec and TJ Falloon and IA Nicholls}, 21069 journal = {Australian Journal of Earth Sciences}, 21070 volume = {59}, 21071 number = {6}, 21072 pages = {913--931}, 21073 year = {2012} 21074} 21075 21076@Article{ sharplesmoresijadamecrevote2015, 21077 title = {Styles of rifting and fault spacing in numerical models of crustal extension}, 21078 author = {Wendy Sharples and Louis N Moresi and Margarete A Jadamec and Jerico Revote}, 21079 journal = {Journal of Geophysical Research: Solid Earth}, 21080 volume = {120}, 21081 number = {6}, 21082 pages = {4379--4404}, 21083 year = {2015} 21084} 21085 21086@Article{ hayniejadamec2017, 21087 title = {Tectonic drivers of the {Wrangell}-block forearc sliver: Insights from 3D 21088 geodynamic models}, 21089 author = {Kirstie L Haynie and Margarete A Jadamec}, 21090 journal = {Tectonics}, 21091 note = {in review}, 21092 year = {2017} 21093} 21094 21095@Article{ cammaranoromanowiczstixrudelithgowbertellonixu2009, 21096 title = {Inferring the thermochemical structure of the upper mantle from seismic data}, 21097 author = {Fabio Cammarano and Barbara Romanowicz and Lars Stixrude and Carolina 21098 Lithgow-Bertelloni and Wenbo Xu}, 21099 journal = {Geophysical Journal International}, 21100 volume = {179}, 21101 number = {2}, 21102 pages = {1169--1185}, 21103 year = {2009} 21104} 21105 21106@Article{ zhong2006, 21107 title = {Constraints on thermochemical convection of the mantle from plume heat flux, 21108 plume excess temperature, and upper mantle temperature}, 21109 author = {Shijie Zhong}, 21110 journal = {Journal of Geophysical Research: Solid Earth}, 21111 volume = {111}, 21112 number = {B4}, 21113 year = {2006} 21114} 21115 21116@Article{ billenhirth2007, 21117 title = {Rheologic controls on slab dynamics}, 21118 author = {Magali I Billen and Greg Hirth}, 21119 journal = {Geochemistry, Geophysics, Geosystems}, 21120 volume = {8}, 21121 number = {8}, 21122 year = {2007} 21123} 21124 21125@Article{ hirthkohlstedt2003, 21126 title = {Rheology of the upper mantle and the mantle wedge: A view from the 21127 experimentalists}, 21128 author = {Greg Hirth and David Kohlstedt}, 21129 journal = {Inside the subduction Factory}, 21130 pages = {83--105}, 21131 year = {2003} 21132} 21133 21134@Article{ longsilver2008, 21135 title = {The subduction zone flow field from seismic anisotropy: A global view}, 21136 author = {Maureen D Long and Paul G Silver}, 21137 journal = {science}, 21138 volume = {319}, 21139 number = {5861}, 21140 pages = {315--318}, 21141 year = {2008} 21142} 21143 21144@Article{ karatowu1993, 21145 title = {Rheology of the upper mantle: A synthesis}, 21146 author = {Shun-ichiro Karato and Patrick Wu}, 21147 journal = {Science}, 21148 volume = {260}, 21149 number = {5109}, 21150 pages = {771--778}, 21151 year = {1993} 21152} 21153 21154@Article{ long2013mantle, 21155 title = {Mantle flow in subduction systems: The mantle wedge flow field and implications 21156 for wedge processes}, 21157 author = {Long, Maureen D and Wirth, Erin A}, 21158 journal = {Journal of Geophysical Research: Solid Earth}, 21159 volume = {118}, 21160 number = {2}, 21161 pages = {583--606}, 21162 year = {2013}, 21163 publisher = {Wiley Online Library} 21164} 21165 21166@Article{ hoernle2008arc, 21167 title = {Arc-parallel flow in the mantle wedge beneath Costa Rica and Nicaragua}, 21168 author = {Hoernle, Kaj and Abt, David L and Fischer, Karen M and Nichols, Holly and Hauff, 21169 Folkmar and Abers, Geoffrey A and van den Bogaard, Paul and Heydolph, Ken and 21170 Alvarado, Guillermo and Protti, Marino and others}, 21171 journal = {Nature}, 21172 volume = {451}, 21173 number = {7182}, 21174 pages = {1094--1097}, 21175 year = {2008}, 21176 publisher = {Nature Publishing Group} 21177} 21178 21179@Article{ savage1999, 21180 title = {Seismic anisotropy and mantle deformation: what have we learned from shear wave 21181 splitting?}, 21182 author = {MK Savage}, 21183 journal = {Reviews of Geophysics}, 21184 volume = {37}, 21185 number = {1}, 21186 pages = {65--106}, 21187 year = {1999} 21188} 21189 21190@InProceedings{ akcelikbirosdraganescuhillghattaswaanders2005, 21191 title = {Dynamic data-driven inversion for terascale simulations: Real-time identification 21192 of airborne contaminants}, 21193 author = {Volkan Ak{\c{c}}elik and George Biros and Andrei Draganescu and Judith Hill and 21194 Omar Ghattas and Bart Van Bloemen Waanders}, 21195 booktitle = {Proceedings of the 2005 ACM/IEEE conference on Supercomputing}, 21196 pages = {43}, 21197 year = {2005}, 21198 organization = {IEEE Computer Society} 21199} 21200 21201@Article{ draganescusoane2013, 21202 title = {Multigrid solution of a distributed optimal control problem constrained by the 21203 {Stokes} equations}, 21204 author = {Andrei Dr{\u{a}}g{\u{a}}nescu and Ana Maria Soane}, 21205 journal = {Applied Mathematics and Computation}, 21206 volume = {219}, 21207 number = {10}, 21208 pages = {5622--5634}, 21209 year = {2013} 21210} 21211 21212@Article{ zhonggurnis1995, 21213 title = {Mantle convection with plates and mobile, faulted plate margins}, 21214 author = {Shijie Zhong and Michael Gurnis}, 21215 journal = {Science}, 21216 volume = {267}, 21217 number = {5199}, 21218 pages = {838}, 21219 year = {1995} 21220} 21221 21222@Article{ studerbobinchahidmousavicandesdahan2012, 21223 title = {Compressive fluorescence microscopy for biological and hyperspectral imaging}, 21224 author = {Vincent Studer and J{\'e}rome Bobin and Makhlad Chahid and Hamed Shams Mousavi 21225 and Emmanuel Candes and Maxime Dahan}, 21226 journal = {Proceedings of the National Academy of Sciences}, 21227 volume = {109}, 21228 number = {26}, 21229 pages = {E1679--E1687}, 21230 year = {2012} 21231} 21232 21233@Article{ borsukhigdonstowreckhow2001, 21234 title = {A {Bayesian} hierarchical model to predict benthic oxygen demand from organic 21235 matter loading in estuaries and coastal zones}, 21236 author = {Mark E Borsuk and David Higdon and Craig A Stow and Kenneth H Reckhow}, 21237 journal = {Ecological Modelling}, 21238 volume = {143}, 21239 number = {3}, 21240 pages = {165--181}, 21241 year = {2001} 21242} 21243 21244@Article{ liebermanwillcox2012, 21245 title = {Goal-oriented inference: Approach, linear theory, and application to advection 21246 diffusion}, 21247 author = {Chad Lieberman and Karen Willcox}, 21248 journal = {SIAM Journal on Scientific Computing}, 21249 volume = {34}, 21250 number = {4}, 21251 pages = {A1880--A1904}, 21252 year = {2012} 21253} 21254 21255@Article{ chaillatbiros2012, 21256 title = {{FaIMS}: A fast algorithm for the inverse medium problem with multiple 21257 frequencies and multiple sources for the scalar {Helmholtz} equation}, 21258 author = {St{\'e}phanie Chaillat and George Biros}, 21259 journal = {Journal of Computational Physics}, 21260 volume = {231}, 21261 number = {12}, 21262 pages = {4403--4421}, 21263 year = {2012} 21264} 21265 21266@Article{ farhattezaurdjellouli2002, 21267 title = {On the solution of three-dimensional inverse obstacle acoustic scattering 21268 problems by a regularized {Newton} method}, 21269 author = {Charbel Farhat and Radek Tezaur and Rabia Djellouli}, 21270 journal = {Inverse problems}, 21271 volume = {18}, 21272 number = {5}, 21273 pages = {1229}, 21274 year = {2002} 21275} 21276 21277@Article{ orozcoghattas1992, 21278 title = {Massively parallel aerodynamic shape optimization}, 21279 author = {Orozco, Carlos E and Ghattas, ON}, 21280 journal = {Computing Systems in Engineering}, 21281 volume = {3}, 21282 number = {1-4}, 21283 pages = {311--320}, 21284 year = {1992} 21285} 21286 21287@Article{ reutheralonsorimlingerjameson1999, 21288 title = {Aerodynamic shape optimization of supersonic aircraft configurations via an 21289 adjoint formulation on distributed memory parallel computers}, 21290 author = {James Reuther and Juan Jose Alonso and Mark J Rimlinger and Antony Jameson}, 21291 journal = {Computers \& fluids}, 21292 volume = {28}, 21293 number = {4}, 21294 pages = {675--700}, 21295 year = {1999} 21296} 21297 21298@Article{ rudistadlerghattas2016, 21299 title = {Weighted {BFBT} Preconditioner for {Stokes} Flow Problems with Highly 21300 Heterogeneous Viscosity}, 21301 author = {Johan Rudi and Georg Stadler and Omar Ghattas}, 21302 journal = {ArXiv e-prints}, 21303 archiveprefix = {arXiv}, 21304 primaryclass = {math.NA}, 21305 eprint = {1607.03936}, 21306 month = jul, 21307 year = {2016} 21308} 21309 21310@Article{ borzikunisch2006, 21311 title = {A globalization strategy for the multigrid solution of elliptic optimal control 21312 problems}, 21313 author = {Borzi, A and Kunisch, K}, 21314 journal = {Optimisation Methods and Software}, 21315 volume = {21}, 21316 number = {3}, 21317 pages = {445--459}, 21318 year = {2006} 21319} 21320 21321@Article{ nash2000, 21322 title = {A multigrid approach to discretized optimization problems}, 21323 author = {Stephen G Nash}, 21324 journal = {Optimization Methods and Software}, 21325 volume = {14}, 21326 number = {1-2}, 21327 pages = {99--116}, 21328 year = {2000} 21329} 21330 21331@Article{ jameson1983, 21332 title = {Solution of the Euler equations for two dimensional transonic flow by a multigrid 21333 method}, 21334 author = {Antony Jameson}, 21335 journal = {Applied mathematics and computation}, 21336 volume = {13}, 21337 number = {3-4}, 21338 pages = {327--355}, 21339 year = {1983} 21340} 21341 21342@Article{ billen2008, 21343 title = {Modeling the dynamics of subducting slabs}, 21344 author = {Magali I Billen}, 21345 journal = {Annu. Rev. Earth Planet. Sci.}, 21346 volume = {36}, 21347 pages = {325--356}, 21348 year = {2008} 21349} 21350 21351@Article{ gerya2011, 21352 title = {Future directions in subduction modeling}, 21353 author = {Taras Gerya}, 21354 journal = {Journal of Geodynamics}, 21355 volume = {52}, 21356 number = {5}, 21357 pages = {344--378}, 21358 year = {2011} 21359} 21360 21361@Article{ tackley2000, 21362 title = {Mantle convection and plate tectonics: Toward an integrated physical and chemical 21363 theory}, 21364 author = {Paul J Tackley}, 21365 journal = {Science}, 21366 volume = {288}, 21367 number = {5473}, 21368 pages = {2002--2007}, 21369 year = {2000} 21370} 21371 21372@Article{ caseydewey1984, 21373 title = {Initiation of subduction zones along transform and accreting plate boundaries, 21374 triple-junction evolution, and forearc spreading centres—implications for 21375 ophiolitic geology and obduction}, 21376 author = {JF Casey and JF Dewey}, 21377 journal = {Geological Society, London, Special Publications}, 21378 volume = {13}, 21379 number = {1}, 21380 pages = {269--290}, 21381 year = {1984} 21382} 21383 21384@Article{ doughertyclayton2014, 21385 title = {Seismicity and structure in central {Mexico}: Evidence for a possible slab tear 21386 in the {South Cocos} plate}, 21387 author = {Sara L Dougherty and Robert W Clayton}, 21388 journal = {Journal of Geophysical Research: Solid Earth}, 21389 volume = {119}, 21390 number = {4}, 21391 pages = {3424--3447}, 21392 year = {2014} 21393} 21394 21395@Article{ syracusemaceiraprietozhangammon2016, 21396 title = {Multiple plates subducting beneath Colombia, as illuminated by seismicity and 21397 velocity from the joint inversion of seismic and gravity data}, 21398 author = {Ellen M Syracuse and Monica Maceira and German A Prieto and Haijiang Zhang and 21399 Charles J Ammon}, 21400 journal = {Earth and Planetary Science Letters}, 21401 volume = {444}, 21402 pages = {139--149}, 21403 year = {2016} 21404} 21405 21406@Article{ bowergurnisflament2015, 21407 title = {Assimilating lithosphere and slab history in 4-D Earth models}, 21408 author = {Dan J Bower and Michael Gurnis and Nicolas Flament}, 21409 journal = {Physics of the Earth and Planetary Interiors}, 21410 volume = {238}, 21411 pages = {8--22}, 21412 year = {2015} 21413} 21414 21415@Book{ ciarlet1976, 21416 title = {Numerical analysis of the finite element method}, 21417 author = {Philippe G Ciarlet}, 21418 volume = {59}, 21419 year = {1976}, 21420 publisher = {Presses de l'Universit{\'e} de Montr{\'e}al} 21421} 21422 21423@InProceedings{ liumellorcrummey2013, 21424 title = {A data-centric profiler for parallel programs}, 21425 author = {Xu Liu and John Mellor-Crummey}, 21426 booktitle = {2013 SC-International Conference for High Performance Computing, Networking, 21427 Storage and Analysis (SC)}, 21428 pages = {1--12}, 21429 year = {2013}, 21430 organization = {IEEE} 21431} 21432 21433@InCollection{ ernstgander2012, 21434 title = {Why it is difficult to solve Helmholtz problems with classical iterative 21435 methods}, 21436 author = {Oliver G Ernst and Martin J Gander}, 21437 booktitle = {Numerical analysis of multiscale problems}, 21438 pages = {325--363}, 21439 url = {http://www.mathe.tu-freiberg.de/~ernst/PubArchive/helmholtzDurham.pdf}, 21440 year = {2012} 21441} 21442 21443@Article{ warburtonkarniadakis1999, 21444 title = {A discontinuous Galerkin method for the viscous {MHD} equations}, 21445 author = {Timothy C Warburton and George E Karniadakis}, 21446 journal = {Journal of Computational Physics}, 21447 volume = {152}, 21448 number = {2}, 21449 pages = {608--641}, 21450 year = {1999} 21451} 21452 21453@Article{ salahsoulaimanihabashi2001, 21454 title = {A finite element method for magnetohydrodynamics}, 21455 author = {Nizar Ben Salah and Azzeddine Soulaimani and Wagdi G Habashi}, 21456 journal = {Computer Methods in Applied Mechanics and Engineering}, 21457 volume = {43}, 21458 number = {190}, 21459 pages = {5867--5892}, 21460 year = {2001} 21461} 21462 21463@Article{ nesliturktezersezgin2005, 21464 title = {The finite element method for {MHD} flow at high {Hartmann} numbers}, 21465 author = {Ali I Nesliturk and M Tezer-Sezgin}, 21466 journal = {Computer methods in applied mechanics and engineering}, 21467 volume = {194}, 21468 number = {9}, 21469 pages = {1201--1224}, 21470 year = {2005} 21471} 21472 21473@Article{ strakschellart2016, 21474 title = {Control of Slab Width on Subduction-Induced Upper Mantle Flow and Associated 21475 Upwellings: Insights from Analog Models}, 21476 author = {Vincent Strak and Wouter P Schellart}, 21477 journal = {Journal of Geophysical Research: Solid Earth}, 21478 year = {2016} 21479} 21480 21481@InBook{ kirbyloggrognesterrel2012, 21482 title = {Common and unusual finite elements}, 21483 author = {Robert C. Kirby and Anders Logg and Marie E. Rognes and Andy R. Terrel}, 21484 editor = {Anders Logg and Kent-Andre Mardal and Garth Wells}, 21485 booktitle = {Automated Solution of Differential Equations by the Finite Element Method: The 21486 FEniCS Book}, 21487 publisher = {Springer Berlin Heidelberg}, 21488 address = {Berlin, Heidelberg}, 21489 pages = {95--119}, 21490 isbn = {978-3-642-23099-8}, 21491 doi = {10.1007/978-3-642-23099-8_3}, 21492 year = {2012} 21493} 21494 21495@InBook{ kirbymardal2012, 21496 author = {Robert C. Kirby and Kent-Andre Mardal}, 21497 title = {Constructing general reference finite elements}, 21498 editor = {Anders Logg and Kent-Andre Mardal and Garth Wells}, 21499 booktitle = {Automated Solution of Differential Equations by the Finite Element Method: The 21500 FEniCS Book}, 21501 publisher = {Springer Berlin Heidelberg}, 21502 address = {Berlin, Heidelberg}, 21503 pages = {121--132}, 21504 isbn = {978-3-642-23099-8}, 21505 doi = {10.1007/978-3-642-23099-8_4}, 21506 year = {2012} 21507} 21508 21509@Book{ wriggers2008, 21510 title = {Nonlinear finite element methods}, 21511 author = {Peter Wriggers}, 21512 publisher = {Springer Science \& Business Media}, 21513 year = {2008} 21514} 21515 21516@Book{ zienkiewicztaylor1977, 21517 title = {The finite element method}, 21518 author = {Zienkiewicz, Olgierd Cecil and Taylor, Robert Leroy and Taylor, Robert Lee}, 21519 publisher = {McGraw-hill London}, 21520 volume = {3}, 21521 year = {1977} 21522} 21523 21524@Article{ rogneskirbylogg2009, 21525 title = {Efficient assembly of {H(div)} and {H(curl)} conforming finite elements}, 21526 author = {Marie E Rognes and Robert C Kirby and Anders Logg}, 21527 journal = {SIAM Journal on Scientific Computing}, 21528 volume = {31}, 21529 number = {6}, 21530 pages = {4130--4151}, 21531 year = {2009} 21532} 21533 21534@Book{ kelley03, 21535 title = {Solving nonlinear equations with Newton's method}, 21536 author = {Carl T. Kelley}, 21537 publisher = {SIAM}, 21538 year = {2003} 21539} 21540 21541@Article{ turing1937, 21542 title = {The Chemical Basis of Morphogenesis}, 21543 author = {A. M. Turing}, 21544 journal = {Philosophical Transactions of the Royal Society B: Biological Sciences}, 21545 volume = {237}, 21546 number = {641}, 21547 pages = {37--72}, 21548 doi = {10.1098/rstb.1952.0012}, 21549 issn = {0080-4622}, 21550 url = {http://rstb.royalsocietypublishing.org/content/237/641/37}, 21551 eprint = {http://rstb.royalsocietypublishing.org/content/237/641/37.full.pdf}, 21552 year = {1952} 21553} 21554 21555@Article{ fabienknepleymillsriviere2017, 21556 title = {Manycore parallel computing for a hybridizable discontinuous {Galerkin} nested 21557 multigrid method}, 21558 author = {Maurice S. Fabien and Matthew G. Knepley and Richard Mills and B\'eatrice M. 21559 Rivi\`ere}, 21560 journal = {SIAM Journal on Scientific Computing}, 21561 url = {https://arxiv.org/abs/1705.09907}, 21562 volume = {41}, 21563 number = {2}, 21564 pages = {C73--C96}, 21565 doi = {10.1137/17M1128903}, 21566 year = {2018} 21567} 21568 21569@Article{ fabienknepleyriviere2018, 21570 title = {A hybridizable discontinuous Galerkin method for two-phase flow in heterogeneous 21571 porous media}, 21572 author = {Maurice S. Fabien and Matthew G. Knepley and B\'eatrice M. Rivier\'e}, 21573 journal = {International Journal for Numerical Methods in Engineering}, 21574 volume = {116}, 21575 number = {3}, 21576 pages = {161--177}, 21577 doi = {10.1002/nme.5919}, 21578 year = {2018} 21579} 21580 21581@Article{ fabienknepleyriviere2020, 21582 title = {A high order hybridizable discontinuous Galerkin method for incompressible 21583 miscible displacement in heterogeneous media}, 21584 author = {Maurice S. Fabien and Matthew G. Knepley and B\'eatrice M. Rivi\`ere}, 21585 journal = {Results in Applied Mathematics}, 21586 url = {https://arxiv.org/abs/1809.00747}, 21587 volume = {8}, 21588 pages = {100089}, 21589 doi = {10.1016/j.rinam.2019.100089}, 21590 year = {2020} 21591} 21592 21593@Article{ fabienknepleyriviere2019b, 21594 title = {Families of Interior Penalty Hybridizable discontinuous Galerkin methods for 21595 second order elliptic problems}, 21596 author = {Maurice S. Fabien and Matthew G. Knepley and B\'eatrice M. Rivi\`ere}, 21597 journal = {Journal of Numerical Mathematics}, 21598 volume = {28}, 21599 number = {3}, 21600 pages = {161--174}, 21601 doi = {10.1515/jnma-2019-0027}, 21602 year = {2019} 21603} 21604 21605@Article{ fabien2019, 21606 title = {A {GPU}-Accelerated Hybridizable Discontinuous {Galerkin} Method for Linear 21607 Elasticity}, 21608 author = {Maurice S. Fabien}, 21609 journal = {Communications in Computational Physics}, 21610 volume = {27}, 21611 number = {2}, 21612 pages = {513--545}, 21613 issn = {1991-7120}, 21614 doi = {10.4208/cicp.OA-2018-0235}, 21615 year = {2019} 21616} 21617 21618@Unpublished{ awanoufabienguzmanstern2020, 21619 title = {Hybridization and postprocessing in finite element exterior calculus}, 21620 author = {Gerard Awanou and Maurice Fabien and Johnny Guzm\'an and Ari Stern}, 21621 eprint = {2008.00149}, 21622 note = {preprint}, 21623 primaryclass = {math.NA}, 21624 year = {2020} 21625} 21626 21627@Article{ chaabanegiraultrivierethompson2018, 21628 title = {A stable enriched Galerkin element for the Stokes problem}, 21629 author = {Nabil Chaabane and Vivette Girault and B\'eatrice Rivi\`ere and Travis Thompson}, 21630 journal = {Applied Numerical Mathematics}, 21631 volume = {132}, 21632 pages = {1--21}, 21633 issn = {0168-9274}, 21634 doi = {https://doi.org/10.1016/j.apnum.2018.04.008}, 21635 url = {http://www.sciencedirect.com/science/article/pii/S0168927418300977}, 21636 year = {2018} 21637} 21638 21639@Article{ thompsonriviereknepley2018, 21640 title = {An Implicit Discontinuous Galerkin Method For Modeling Acute Edema and 21641 Resuscitation In The Small Intestine}, 21642 author = {Travis Thompson and B\'eatrice M. Rivi\`ere and Matthew G. Knepley}, 21643 journal = {Mathematical Medicine and Biology}, 21644 volume = {36}, 21645 number = {4}, 21646 pages = {513--548}, 21647 doi = {10.1093/imammb/dqz00}, 21648 year = {2019} 21649} 21650 21651@Article{ kevrekidisthompsongoriely2020, 21652 title = {Anisotropic Diffusion and Traveling Waves of Toxic Proteins in Neurodegenerative 21653 Diseases}, 21654 author = {P. G. Kevrekidis and Travis Thompson and Alain Goriely}, 21655 journal = {Physics Letters A}, 21656 volume = {384}, 21657 number = {36}, 21658 pages = {126935}, 21659 year = {2020} 21660} 21661 21662@Article{ mardalrognesthompson2021, 21663 title = {Accurate Discretization Of Poroelasticity Without {Darcy} Stability -- 21664 {Stokes-Biot} Stability Revisited}, 21665 author = {Kent-Andre Mardal and Marie E. Rognes and Travis B. Thompson}, 21666 journal = {BIT Numerical Mathematics}, 21667 pages = {1--36}, 21668 year = {2021} 21669} 21670 21671@Article{ piersantileethompsonmardalrognes2021, 21672 title = {Parameter robust preconditioning by congruence for multiple-network 21673 poroelasticity}, 21674 author = {Piersanti, Eleonora and Lee, Jeonghun J and Thompson, Travis and Mardal, K-A and 21675 Rognes, Marie E}, 21676 journal = {SIAM Journal on Scientific Computing}, 21677 volume = {43}, 21678 number = {4}, 21679 pages = {B984--B1007}, 21680 year = {2021}, 21681 publisher = {SIAM} 21682} 21683 21684@Article{ walkerknepleyaagaardwilliams2023, 21685 title = {Multiphysics Modeling in {PyLith}: Poroelasticity}, 21686 author = {Robert L. Walker and Matthew G. Knepley and Brad T. Aagaard and Charles A. Williams}, 21687 journal = {Geophysical Journal International}, 21688 volume = {235}, 21689 number = {3}, 21690 pages = {2442--2475}, 21691 doi = {10.1093/gji/ggad370}, 21692 year = {2023} 21693} 21694 21695@InProceedings{ actorfuentesriviere2020b, 21696 title = {Identification of Kernels in a Convolutional Neural Network: Connections Between 21697 Level Set Equation and Deep Learning for Image Segmentation}, 21698 author = {Jonas A. Actor and David T. Fuentes and B\'eatrice M. Rivi\`ere}, 21699 booktitle = {Proceedings of the SPIE Medical Imaging Conference}, 21700 year = {2020} 21701} 21702 21703@Article{ actorfuentesriviere2020, 21704 title = {Robust Regularized Networks in the Presence of Noise}, 21705 author = {Jonas A. Actor and David T. Fuentes and B\'eatrice M. Rivi\`ere}, 21706 journal = {Medical Image Analysis}, 21707 note = {In revision}, 21708 year = {2020} 21709} 21710 21711@Book{ byerly1893, 21712 title = {An elementary treatise on Fourier's series: and spherical, cylindrical, and 21713 ellipsoidal harmonics, with applications to problems in mathematical physics}, 21714 author = {William Elwood Byerly}, 21715 publisher = {Dover}, 21716 year = {1893} 21717} 21718 21719@Book{ hobson1931, 21720 title = {The theory of spherical and ellipsoidal harmonics}, 21721 author = {Ernest William Hobson}, 21722 year = {1931}, 21723 publisher = {CUP Archive} 21724} 21725 21726@Book{ dassios2012, 21727 title = {Ellipsoidal harmonics: theory and applications}, 21728 author = {George Dassios}, 21729 volume = {146}, 21730 year = {2012}, 21731 publisher = {Cambridge University Press} 21732} 21733 21734@Book{ miller1977, 21735 title = {Symmetry and separation of variables}, 21736 author = {Miller, Jr, Willard}, 21737 year = {1977}, 21738 address = {Reading, MA}, 21739 publisher = {Addison-Wesley Publishing Co., Inc.} 21740} 21741 21742@TechReport{ epanet-users-manual, 21743 author = {Lewis A. Rossman}, 21744 title = {{EPANET 2} Users Manual}, 21745 institution = {Water Supply and Water Resources Division, National Risk Management Research 21746 Laboratory, Cincinnati, OH 45268}, 21747 year = {2000} 21748} 21749 21750@Article{ klocknerbarnettgreengardoneil2013, 21751 title = {Quadrature by expansion: A new method for the evaluation of layer potentials}, 21752 author = {Andreas Kl{\"o}ckner and Alexander Barnett and Leslie Greengard and Michael 21753 O'Neil}, 21754 journal = {Journal of Computational Physics}, 21755 volume = {252}, 21756 pages = {332--349}, 21757 year = {2013} 21758} 21759 21760@Article{ turcksinkronbichlerbangerth2016, 21761 title = {WorkStream--A Design Pattern for Multicore-Enabled Finite Element Computations}, 21762 author = {Bruno Turcksin and Martin Kronbichler and Wolfgang Bangerth}, 21763 journal = {ACM Transactions on Mathematical Software)}, 21764 volume = {43}, 21765 number = {1}, 21766 pages = {2}, 21767 year = {2016} 21768} 21769 21770@Article{ vitushkin1954, 21771 title = {On {Hilbert's} thirteenth problem}, 21772 author = {A. G. Vitushkin}, 21773 journal = {Dokl. Akad. Nauk SSSR}, 21774 volume = {95}, 21775 pages = {701--704}, 21776 year = {1954} 21777} 21778 21779@Article{ kolmogorov1957, 21780 title = {On the representation of continuous functions of several variables as 21781 superpositions of continuous functions of one variable and addition}, 21782 author = {Andrei N. Kolmogorov}, 21783 journal = {Dokl. Akad. Nauk SSSR}, 21784 pages = {953--956}, 21785 volume = {114:5}, 21786 note = {English transl. Amer. Math. Soc. Transl. (2) 28 (1963), 55}, 21787 year = {1957} 21788} 21789 21790@Article{ fridman1967, 21791 title = {Improvement in the smoothness of functions in the {Kolmogorov Superposition 21792 Theorem}}, 21793 author = {B. L. Fridman}, 21794 journal = {Dokl. Akad. Nauk SSR}, 21795 volume = {177:5}, 21796 pages = {1019--1022}, 21797 note = {English transl. Soviet Math. Dokl. 8, 6 (1967), 1550-1553}, 21798 year = {1967} 21799} 21800 21801@Article{ sprecher1972, 21802 title = {An improvement in The {Superposition Theorem of Kolmogorov}}, 21803 author = {David Sprecher}, 21804 journal = {Journal of Mathematical Analysis and Applications}, 21805 volume = {38}, 21806 pages = {208--213}, 21807 year = {1972} 21808} 21809 21810@Article{ diaconisshahshahani1984, 21811 title = {On nonlinear functions of linear combinations}, 21812 author = {Persi Diaconis and Mehrdad Shahshahani}, 21813 journal = {SIAM Journal on Scientific and Statistical Computing}, 21814 volume = {5}, 21815 number = {1}, 21816 pages = {175--191}, 21817 year = {1984}, 21818 publisher = {SIAM} 21819} 21820 21821@InProceedings{ hechtnielsen1987, 21822 title = {Kolmogorov's mapping neural network existence theorem}, 21823 author = {R. Hecht-Nielsen}, 21824 booktitle = {Proceedings of the International Conference on Neural Networks}, 21825 volume = {III}, 21826 pages = {11--14}, 21827 publisher = {IEEE Press}, 21828 year = {1987} 21829} 21830 21831@InProceedings{ hechtnielsen1989, 21832 title = {Theory of the back-propagation neural network}, 21833 author = {R. Hecht-Nielsen}, 21834 booktitle = {Proceedings of the International Joint Conference on Neural Networks}, 21835 volume = {I}, 21836 pages = {593--608}, 21837 publisher = {IEEE Press}, 21838 year = {1989} 21839} 21840 21841@Article{ girosipoggio1989, 21842 title = {Representation properties of networks: {Kolmogorov's} theorem is irrelevant}, 21843 author = {Federico Girosi and Tomaso Poggio}, 21844 journal = {Neural Computation}, 21845 volume = {1}, 21846 number = {4}, 21847 pages = {465--469}, 21848 year = {1989}, 21849 publisher = {MIT Press} 21850} 21851 21852@InBook{ koppen2002, 21853 title = {On the Training of a Kolmogorov Network}, 21854 author = {Mario K\"oppen}, 21855 pages = {474--9}, 21856 publisher = {ICANN 2002, LNCS 2415}, 21857 year = {2002} 21858} 21859 21860@PhDThesis{ bryant2008, 21861 title = {Analysis of {Kolmogorov's} superposition theorem and its implementation in 21862 applications with low and high dimensional data}, 21863 author = {Donald W Bryant}, 21864 school = {University of Central Florida}, 21865 year = {2008} 21866} 21867 21868@InCollection{ griebel2006, 21869 title = {Sparse Grids for Higher Dimensional Problems}, 21870 author = {Michael Griebel}, 21871 booktitle = {Foundations of Computational Mathematics}, 21872 editor = {Luis M. Pardo and Allan Pinkus and Endre Suli and Michael J. Todd}, 21873 publisher = {Cambridge University Press}, 21874 pages = {106--161}, 21875 doi = {10.1017/CBO9780511721571.004}, 21876 url = {https://www.cambridge.org/core/books/foundations-of-computational-mathematics-santander-2005/sparse-grids-for-higher-dimensional-problems/C6E91FFE07DF5F6C069B80805B216B50}, 21877 month = jun, 21878 day = {29}, 21879 year = {2006} 21880} 21881 21882@Article{ braungriebel2009, 21883 title = {On a constructive proof of {Kolmogorov}'s superposition theorem}, 21884 author = {Jurgen Bra\"un and Michael Griebel}, 21885 journal = {Constructive Approximation}, 21886 pages = {653--675}, 21887 volume = {30}, 21888 year = {2009} 21889} 21890 21891@InProceedings{ lenifougerolletruchetet2009, 21892 title = {Kolmogorov superposition theorem and its application to wavelet image 21893 decompositions}, 21894 author = {Pierre-Emmanuel Leni and Yohan D Fougerolle and Fr{\'{e}}d{\'{e}}ric Truchetet}, 21895 booktitle = {Electronic Imaging-Wavelet Applications in Industrial Processing VI, Proceedings 21896 of the SPIE}, 21897 pages = {724804--724804}, 21898 doi = {10.1117/12.805916}, 21899 url = {http://le2i.cnrs.fr/IMG/publications/2228{\_}main.pdf{\%}5Cnhttp://proceedings.spiedigitallibrary.org/proceeding.aspx?articleid=1335035}, 21900 year = {2009} 21901} 21902 21903@Article{ oseledets2011, 21904 title = {Tensor-train decomposition}, 21905 author = {Ivan V Oseledets}, 21906 journal = {SIAM Journal on Scientific Computing}, 21907 volume = {33}, 21908 number = {5}, 21909 pages = {2295--2317}, 21910 year = {2011} 21911} 21912 21913@PhDThesis{ liu2015, 21914 title = {Kolmogorov superposition theorem and its applications}, 21915 author = {Xing Liu}, 21916 school = {Imperial College London}, 21917 year = {2015} 21918} 21919 21920@Article{ lecunbengiohinton2015, 21921 title = {Deep learning}, 21922 author = {Yann LeCun and Yoshua Bengio and Geoffrey Hinton}, 21923 journal = {Nature}, 21924 volume = {521}, 21925 number = {7553}, 21926 pages = {436--444}, 21927 year = {2015} 21928} 21929 21930@Book{ trefethen2013, 21931 title = {Approximation theory and approximation practice}, 21932 author = {Lloyd N Trefethen}, 21933 publisher = {SIAM}, 21934 year = {2013} 21935} 21936 21937@Article{ butlergrahammattiswalsh2017, 21938 title = {A measure-theoretic interpretation of sample based numerical integration with 21939 applications to inverse and prediction problems under uncertainty}, 21940 author = {Troy Butler and Lindsey Graham and S. Mattis and S. Walsh}, 21941 journal = {SIAM Journal on Scientific Computing}, 21942 volume = {39}, 21943 number = {5}, 21944 pages = {A2072--A2098}, 21945 year = {2017} 21946} 21947 21948@Article{ logg2009, 21949 title = {Efficient representation of computational meshes}, 21950 author = {Anders Logg}, 21951 journal = {International Journal of Computational Science and Engineering}, 21952 volume = {4}, 21953 number = {4}, 21954 pages = {283--295}, 21955 year = {2009} 21956} 21957 21958@Article{ agelekandersonbangerthbarth2017, 21959 title = {On orienting edges of unstructured two-and three-dimensional meshes}, 21960 author = {Rainer Agelek and Michael Anderson and Wolfgang Bangerth and William L Barth}, 21961 journal = {ACM Transactions on Mathematical Software (TOMS)}, 21962 volume = {44}, 21963 number = {1}, 21964 pages = {5}, 21965 year = {2017} 21966} 21967 21968@Article{ actorknepley2018, 21969 title = {An Algorithm for Computing {Lipschitz} Inner Functions in {Kolmogorov's 21970 Superposition Theorem}}, 21971 author = {Jonas Actor and Matthew G. Knepley}, 21972 eprint = {1712.08286}, 21973 archiveprefix = {arXiv}, 21974 primaryclass = {math.na}, 21975 note = {\url{http://arxiv.org/abs/1712.08286}}, 21976 year = {2018} 21977} 21978 21979@Book{ driscollhaletrefethen2014, 21980 title = {Chebfun guide}, 21981 author = {Tobin A Driscoll and Nicholas Hale and Lloyd N Trefethen}, 21982 publisher = {Pafnuty Publications, Oxford}, 21983 year = {2014} 21984} 21985 21986@Article{ johntobiska2000, 21987 title = {Numerical performance of smoothers in coupled multigrid methods for the parallel 21988 solution of the incompressible Navier-Stokes equations}, 21989 author = {Volker John and Lutz Tobiska}, 21990 journal = {International Journal for Numerical Methods in Fluids}, 21991 volume = {33}, 21992 number = {4}, 21993 pages = {453--473}, 21994 year = {2000} 21995} 21996 21997@Article{ vanka1986, 21998 title = {Block-implicit multigrid calculation of two-dimensional recirculating flows}, 21999 author = {S. P. Vanka}, 22000 journal = {Computer Methods in Applied Mechanics and Engineering}, 22001 volume = {59}, 22002 number = {1}, 22003 pages = {29--48}, 22004 year = {1986} 22005} 22006 22007@Article{ bartelgunther2018, 22008 author = {Andreas Bartel and Michael G\"unther}, 22009 title = {{PDAEs} in refined electrical network modeling}, 22010 journal = {SIAM Review}, 22011 volume = {60}, 22012 number = {1}, 22013 pages = {56--91}, 22014 doi = {10.1137/17M1113643}, 22015 year = {2018} 22016} 22017 22018@Article{ matpower, 22019 author = {Ray D. Zimmerman and Carlos E. Murillo-S{\'a}nchez and Robert J. Thomas}, 22020 title = {{MATPOWER}: Steady-state operations, planning and analysis tools for power 22021 systems research and education}, 22022 journal = {IEEE Transactions on Power Systems}, 22023 volume = {26}, 22024 number = {1}, 22025 pages = {12--19}, 22026 year = {2011}, 22027 doi = {10.1109/TPWRS.2010.2051168} 22028} 22029 22030@Article{ betrieyan2018, 22031 author = {G. Betrie and E. Yan}, 22032 title = {Development and Verification of Thermoelectric Power Plant Model for Assessing 22033 Energy and Water Nexus}, 22034 journal = {Applied Energy, Submitted}, 22035 volume = {}, 22036 number = {}, 22037 pages = {}, 22038 doi = {}, 22039 year = {2018} 22040} 22041 22042@Article{ faeth2012, 22043 author = {P. Faeth}, 22044 title = {{U.S.} Energy Security and Water: The Challenges We Face}, 22045 journal = {Environment: Science and Policy for Sustainable Development}, 22046 volume = {54(1)}, 22047 number = {1}, 22048 pages = {4--19}, 22049 year = {2012}, 22050 doi = {10.1080/00139157.2012.639595} 22051} 22052 22053@InProceedings{ hagberg2008, 22054 title = {Exploring network structure, dynamics, and function using {NetworkX}}, 22055 author = {Hagberg, Aric A. and Schult, Daniel A. and Swart, Pieter J.}, 22056 booktitle = {Proceedings of the 7th Python in Science Conference (SciPy2008), Ga\"{e}l 22057 Varoquaux, Travis Vaught, and Jarrod Millman (Eds), (Pasadena, CA USA)}, 22058 year = {2008}, 22059 pages = {11--15} 22060} 22061 22062@Misc{ simulink-web-page, 22063 author = {Mathworks}, 22064 title = {{SIMULINK} web page}, 22065 note = {\url{https://www.mathworks.com/products/simulink.html}}, 22066 year = {2017} 22067} 22068 22069@Misc{ labview-web-page, 22070 author = {National Instruments}, 22071 title = {{LabVIEW} web page}, 22072 note = {\url{http://www.ni.com/labview/}}, 22073 key = {labview}, 22074 year = {2017} 22075} 22076 22077@Misc{ modelica-web-page, 22078 author = {Modelica Association}, 22079 title = {Modelica web page}, 22080 note = {\url{https://www.modelica.org/}}, 22081 year = {2017} 22082} 22083 22084@InProceedings{ yangsc16, 22085 author = {C. Yang and W. Xue and H. Fu and H. You and X. Wang and Y. Ao and F. Liu and L. 22086 Gan and P. Xu and L. Wang and G. Yang and W. Zheng}, 22087 booktitle = {{SC '16}: Proceedings of the International Conference for High Performance 22088 Computing, Networking, Storage and Analysis}, 22089 title = {{10M-Core} Scalable Fully-Implicit Solver for Nonhydrostatic Atmospheric 22090 Dynamics}, 22091 note = {Gordon Bell Award}, 22092 year = {2016} 22093} 22094 22095@InProceedings{ bekassc15, 22096 author = {C. Bekas and A. Curioni and O. Ghattas and M. Gurnis and Y. Ineichen and T. Isaac 22097 and C. Malossi and J. Rudi and G. Stadler and P.W.J. Staar}, 22098 booktitle = {{SC '15}: Proceedings of the International Conference for High Performance 22099 Computing, Networking, Storage and Analysis}, 22100 title = {An Extreme-Scale Implicit Solver for Complex {PDEs}: Highly Heterogeneous Flow in 22101 Earth's Mantle}, 22102 note = {Gordon Bell Award}, 22103 year = {2015} 22104} 22105 22106@Misc{ improving-software-whitepaper2017, 22107 author = {M. Heroux and L.C. McInnes}, 22108 title = {Improving and accelerating scientific discovery through better software}, 22109 note = {whitepaper for 2017 ASCR Applied Mathematics PI Meeting}, 22110 doi = {10.6084/m9.figshare.5339692}, 22111 year = {2017} 22112} 22113 22114@Misc{ doe:40thanniversarycollection, 22115 title = {{DOE Office of Science} 40th anniversary collection of 40 major papers that have 22116 changed the face of science}, 22117 key = {Department of Energy, Office of Science}, 22118 howpublished = {\url{https://science.energy.gov/news/doe-science-at-40}}, 22119 year = {2017} 22120} 22121 22122@Misc{ siam:fellowsprogram, 22123 title = {{Society for Industrial and Applied Mathematics, Fellows Program}}, 22124 key = {SIAM}, 22125 howpublished = {\url{http://www.siam.org/prizes/fellows}} 22126} 22127 22128@Misc{ r-and-d100:awards2009, 22129 title = {{R\&D100 Award Winners 2009}}, 22130 key = {{R\&D100 Award Winners 2009}}, 22131 howpublished = {\url{https://www.rdmag.com/2009/08/2009-r-d-100-award-winners}} 22132} 22133 22134@Misc{ xsdk:website, 22135 title = {{xSDK: Extreme-scale Scientific Software Development Kit}}, 22136 key = {xSDK: Extreme-scale Scientific Software Development Kit}, 22137 howpublished = {\url{https://xsdk.info}} 22138} 22139 22140@Misc{ xsdk-community-installation-policies2017, 22141 title = {{xSDK} Community Installation Policies: {GNU Autoconf} and {CMake} Options}, 22142 author = {R. Bartlett and J. Sarich and B. Smith and T. Gamblin and {xSDK developers}}, 22143 note = {version 0.3, November 7, 2017}, 22144 doi = {10.6084/m9.figshare.4495133}, 22145 year = {2017} 22146} 22147 22148@Misc{ xsdk-community-package-policies2017, 22149 title = {{xSDK} Community Package Policies}, 22150 author = {B. Smith and R. Bartlett and {xSDK developers}}, 22151 note = {version 0.3, November 7, 2017}, 22152 doi = {10.6084/m9.figshare.4495136}, 22153 year = {2017} 22154} 22155 22156@Misc{ ideas-what-are-interoperable-libraries, 22157 title = {What Are Interoperable Software Libraries: Introducing the {xSDK}}, 22158 author = {Lois Curfman McInnes and Michael A. Heroux and Xiaoye Li and Barry Smith and 22159 Ulrike Yang and {all xSDK developers}}, 22160 note = {IDEAS {\em WhatIs} document, version 0.2, April 25, 2016, available via 22161 \url{https://ideas-productivity.org/resources/howtos/}}, 22162 year = {2016} 22163} 22164 22165@Misc{ ideas-productivity:website, 22166 title = {{IDEAS Scientific Software Productivity Project}}, 22167 key = {IDEAS Scientific Software Productivity Project}, 22168 howpublished = {\url{https://ideas-productivity.org}} 22169} 22170 22171@Misc{ ecp:website, 22172 key = {{U.S. DOE Exascale Computing Project (ECP)}}, 22173 title = {{U.S. DOE Exascale Computing Project (ECP)}}, 22174 note = {\url{https://exascaleproject.org}}, 22175 year = {2018} 22176} 22177 22178@Misc{ siam-cse-jan2018, 22179 author = {Ulrich R\"{u}de and Karen Willcox and Lois Curfman McInnes and Hans {De Sterck} 22180 and George Biros and Hans Bungartz and James Corones and Evin Cramer and James 22181 Crowley and Omar Ghattas and Max Gunzburger and Michael Hanke and Robert Harrison 22182 and Michael Heroux and Jan Hesthaven and Peter Jimack and Chris Johnson and Kirk 22183 E. Jordan and David E. Keyes and Rolf Krause and Vipin Kumar and Stefan Mayer and 22184 Juan Meza and Knut Martin M{\o}rken and J. Tinsley Oden and Linda Petzold and 22185 Padma Raghavan and Suzanne M. Shontz and Anne Trefethen and Peter Turner and 22186 Vladimir Voevodin and Barbara Wohlmuth and Carol S. Woodward}, 22187 title = {Research and Education in Computational Science and Engineering}, 22188 note = {available via \url{https://arxiv.org/abs/1610.02608}, to appear in {\em SIAM 22189 Review}}, 22190 year = {2018} 22191} 22192 22193@Misc{ doe-appliedmathpimeeting2017, 22194 author = {Jeff Hittinger and Lois Curfman McInnes and Abani Patra and Nathan Baker and 22195 Miranda Holmes-Cerfon and Barney Maccabe and Esmong Ng and Pieter Swart and Karen 22196 Willcox and Steven Lee}, 22197 title = {{Report on the 2017 ASCR Applied Mathematics Principal Investigators Meeting}}, 22198 note = {\url{http://www.orau.gov/ascr-appliedmath-pi2017}}, 22199 year = {2017} 22200} 22201 22202@Misc{ doe-fusionintegratedsimulationsworkshopreport2015, 22203 author = {P. Bonoli and L. C. {McInnes (Chairs)}}, 22204 title = {{Report on the DOE Workshop on Integrated Simulations for Magnetic Fusion Energy 22205 Sciences}}, 22206 note = {available via 22207 \url{http://science.energy.gov/~/media/fes/pdf/workshop-reports/2016/ISFusionWorkshopReport_11-12-2015.pdf}}, 22208 year = {2015} 22209} 22210 22211@Misc{ sisc-specialissueintro, 22212 title = {Introduction to {SISC} Special section associated with {CSE15} on {'CSE 22213 Software'} and {'Big Data in CSE'}}, 22214 author = {H. {De Sterck} and C. Johnson and L.C. McInnes}, 22215 month = nov, 22216 year = {2016}, 22217 journal = {SIAM J. Sci. Comput.}, 22218 doi = {10.1137/16N974188} 22219} 22220 22221@Article{ xsdk-foundations2017, 22222 title = {{xSDK} Foundations: Toward an Extreme-scale Scientific Software Development Kit}, 22223 author = {R. Bartlett and I. Demeshko and T. Gamblin and G. Hammond and M. Heroux and J. 22224 Johnson and A. Klinvex and X. Li and L.C. McInnes and J.D. Moulton and D. 22225 Osei-Kuffuor and J. Sarich and B. Smith and J. Willenbring and U.M. Yang}, 22226 journal = {Supercomputing Frontiers and Innovations}, 22227 month = feb, 22228 year = {2017}, 22229 note = {available via \url{https://arxiv.org/abs/1702.08425}} 22230} 22231 22232@Misc{ openfoam:website, 22233 title = {{OpenFOAM}}, 22234 author = {OpenFOAM Team}, 22235 key = {OpenFOAM}, 22236 howpublished = {\url{https://openfoam.com}} 22237} 22238 22239@Misc{ mfem:website, 22240 title = {{MFEM}}, 22241 author = {Tzanio Kolev and MFEM Team}, 22242 key = {MFEM}, 22243 howpublished = {\url{https://mfem.org}} 22244} 22245 22246@Misc{ deal.ii:website, 22247 title = {{{deal.II}: An open-source finite element library}}, 22248 author = {Wolfgang Bangerth and Deal.II Team}, 22249 howpublished = {\url{http://www.dealii.org}}, 22250 year = {2018} 22251} 22252 22253@Misc{ ibamr:website, 22254 title = {{{IBAMR}: Immersed Boundary Method Adaptive Mesh Refinement Software Infrastructure}}, 22255 author = {Boyce Griffith and IBAMR Team}, 22256 howpublished = {\url{https://ibamr.github.io/}}, 22257 year = {2023} 22258} 22259 22260@Misc{ fission-gas-scidac:website, 22261 title = {{Simulation of Fission Gas in Uranium Oxide Nuclear Fuel}}, 22262 author = {A. David {Andersson (PI)}}, 22263 howpublished = {SciDAC project, \url{https://collab.cels.anl.gov/display/FissionGasSciDAC2}}, 22264 year = {2018} 22265} 22266 22267@Misc{ tokamak-disruption-scidac:project, 22268 title = {{Tokamak Disruption Simulation}}, 22269 author = {Xianzhu {Tang (PI)}}, 22270 howpublished = {SciDAC project}, 22271 year = {2018} 22272} 22273 22274@InProceedings{ duplyakin2018memory, 22275 title = {Evaluating Active Learning with Cost and Memory Awareness}, 22276 author = {Duplyakin, Dmitry and Brown, Jed and Calhoun, Donna}, 22277 booktitle = {2018 IEEE International Parallel and Distributed Processing Symposium (IPDPS)}, 22278 pages = {214--223}, 22279 year = {2018}, 22280 organization = {IEEE}, 22281 pdf = {https://jedbrown.org/files/DuplyakinBrownCalhoun-ActiveLearningCostMemoryAware-2018.pdf} 22282} 22283 22284@InProceedings{ duplyakin2016active, 22285 author = {Dmitry Duplyakin and Jed Brown and Robert Ricci}, 22286 title = {Active Learning in Performance Analysis}, 22287 booktitle = {Proceedings of the IEEE Cluster Conference}, 22288 year = {2016}, 22289 month = sep, 22290 url = {http://www.flux.utah.edu/paper/duplyakin-cluster16}, 22291 pdf = {https://jedbrown.org/files/DuplyakinBrownRicci-ActiveLearningPerformanceAnalysis-2016.pdf} 22292} 22293 22294@Misc{ xgc1:website, 22295 title = {{XGC1 project website}}, 22296 author = {C. S. Chang and others}, 22297 howpublished = {\url{https://epsi.pppl.gov/computing/xgc-1}}, 22298 year = {2018} 22299} 22300 22301@Misc{ wdmapp-bhattacharjee-ecp:website, 22302 title = {{WDMApp: High-Fidelity Whole Device Modeling of Magnetically Confined Fusion 22303 Plasmas}}, 22304 author = {A. Bhattacharjee and others}, 22305 note = {ECP application project}, 22306 howpublished = {\url{https://www.exascaleproject.org/activity/energy-applications}}, 22307 year = {2018} 22308} 22309 22310@Misc{ subsurface-steefel-ecp:website, 22311 title = {{Subsurface: Exascale Subsurface Simulator of Coupled Flow, Transport, Reactions, 22312 and Mechanics}}, 22313 note = {ECP application project}, 22314 author = {C. Steefel and others}, 22315 howpublished = {\url{https://www.exascaleproject.org/activity/earth-space-science-applications}}, 22316 year = {2018} 22317} 22318 22319@Article{ chombo-crunch:2014, 22320 title = {High-Resolution Simulation of Pore-Scale Reactive Transport Processes Associated 22321 with Carbon Sequestration}, 22322 author = {D. Trebotich and M. F. Adams and S. Molins and C. Steefel and C. Shen}, 22323 journal = {Computing in Science and Engineering}, 22324 volume = {16}, 22325 issue = {6}, 22326 year = {2014}, 22327 pages = {22--31}, 22328 doi = {10.1109/MCSE.2014.77} 22329} 22330 22331@Article{ courantfriedrichslewy1967, 22332 title = {On the partial difference equations of mathematical physics}, 22333 author = {Richard Courant and Kurt Friedrichs and Hans Lewy}, 22334 journal = {IBM journal of Research and Development}, 22335 volume = {11}, 22336 number = {2}, 22337 pages = {215--234}, 22338 year = {1967}, 22339 publisher = {IBM} 22340} 22341 22342@Article{ erway2017solving, 22343 title = {On solving large-scale limited-memory quasi-Newton equations}, 22344 author = {Erway, Jennifer B and Marcia, Roummel F}, 22345 journal = {Linear Algebra and its Applications}, 22346 volume = {515}, 22347 pages = {196--225}, 22348 year = {2017}, 22349 publisher = {Elsevier} 22350} 22351 22352@Article{ griewank2012broyden, 22353 title = {Broyden updating, the good and the bad!}, 22354 author = {Griewank, Andreas}, 22355 journal = {Optimization Stories, Documenta Mathematica. Extra Volume: Optimization Stories}, 22356 pages = {301--315}, 22357 year = {2012} 22358} 22359 22360@Book{ tarantola2005, 22361 title = {Inverse problem theory and methods for model parameter estimation}, 22362 author = {Albert Tarantola}, 22363 volume = {89}, 22364 year = {2005}, 22365 publisher = {SIAM} 22366} 22367 22368@Article{ rutkaikristof2010, 22369 title = {Dynamic Monte Carlo simulation in mixtures}, 22370 author = {G{\'a}bor Rutkai and Tam{\'a}s Krist{\'o}f}, 22371 journal = {The Journal of Chemical Physics}, 22372 volume = {132}, 22373 number = {10}, 22374 pages = {104107}, 22375 year = {2010}, 22376 publisher = {AIP} 22377} 22378 22379@Book{ vogel2002, 22380 title = {Computational methods for inverse problems}, 22381 author = {Curtis R Vogel}, 22382 volume = {23}, 22383 year = {2002}, 22384 publisher = {SIAM} 22385} 22386 22387@Article{ malqvistpeterseim2014, 22388 title = {Localization of elliptic multiscale problems}, 22389 author = {Axel M{\aa}lqvist and Daniel Peterseim}, 22390 journal = {Mathematics of Computation}, 22391 volume = {83}, 22392 number = {290}, 22393 pages = {2583--2603}, 22394 year = {2014} 22395} 22396 22397@Article{ brandtbrannickkahllivshits2011, 22398 title = {Bootstrap {AMG}}, 22399 author = {Achi Brandt and James Brannick and Karsten Kahl and Irene Livshits}, 22400 journal = {SIAM Journal on Scientific Computing}, 22401 volume = {33}, 22402 number = {2}, 22403 pages = {612--632}, 22404 year = {2011} 22405} 22406 22407@InProceedings{ barralalauzet2014, 22408 title = {Large displacement body-fitted {FSI} simulations using a mesh-connectivity-change 22409 moving mesh strategy}, 22410 author = {Nicolas Barral and Fr{\'e}d{\'e}ric Alauzet}, 22411 booktitle = {44th AIAA Fluid Dynamics Conference}, 22412 pages = {2773}, 22413 year = {2014} 22414} 22415 22416@InProceedings{ barralalauzetloseille2015, 22417 title = {Metric-based anisotropic mesh adaptation for three-dimensional time-dependent 22418 problems involving moving geometries}, 22419 author = {Nicolas Barral and Fr{\'e}d{\'e}ric Alauzet and Adrien Loseille}, 22420 booktitle = {53rd AIAA Aerospace Sciences Meeting}, 22421 pages = {2039}, 22422 year = {2015} 22423} 22424 22425@Article{ barralolivieralauzet2017, 22426 title = {Time-accurate anisotropic mesh adaptation for three-dimensional time-dependent 22427 problems with body-fitted moving geometries}, 22428 author = {Nicolas Barral and G{\'e}raldine Olivier and Fr{\'e}d{\'e}ric Alauzet}, 22429 journal = {Journal of Computational Physics}, 22430 volume = {331}, 22431 pages = {157--187}, 22432 year = {2017} 22433} 22434 22435@Article{ ibanezbarralkrakosloseillemichalpark2017, 22436 title = {First Benchmark of the Unstructured Grid Adaptation Working Group}, 22437 author = {Daniel Ibanez and Nicolas Barral and Joshua Krakos and Adrien Loseille and Todd 22438 Michal and Mike Park}, 22439 journal = {Procedia engineering}, 22440 volume = {203}, 22441 pages = {154--166}, 22442 year = {2017} 22443} 22444 22445@InProceedings{ parkbarralibanezkamenetskiykrakosmichalloseille2018, 22446 title = {Unstructured Grid Adaptation and Solver Technology for Turbulent Flows}, 22447 author = {Michael A Park and Nicolas Barral and Daniel Ibanez and Dmitry S Kamenetskiy and 22448 Joshua A Krakos and Todd R Michal and Adrien Loseille}, 22449 booktitle = {2018 AIAA Aerospace Sciences Meeting}, 22450 pages = {1103}, 22451 year = {2018} 22452} 22453 22454@InProceedings{ barralangeloudiskramergormanpiggott2018, 22455 title = {An anisotropic mesh adaptation approach for regional tidal energy hydrodynamics 22456 modelling}, 22457 author = {Nicolas Barral and Athanasios Angeloudis and Stephan C Kramer and Gerard J Gorman 22458 and Matthew D Piggott}, 22459 booktitle = {EGU General Assembly Conference Abstracts}, 22460 volume = {20}, 22461 pages = {19168}, 22462 year = {2018} 22463} 22464 22465@Article{ principe2009, 22466 title = {{Mathematical models for thermally coupled low speed flows}}, 22467 author = {Javier Principe and Ramon Codina}, 22468 journal = {Advances in Theoretical and Applied Mechanics}, 22469 volume = {2}, 22470 number = {1-4}, 22471 pages = {93--112}, 22472 url = {http://www.m-hikari.com/atam/atam2009/atam1-4-2009/principeATAM1-4-2009.pdf}, 22473 year = {2009} 22474} 22475 22476@Book{ vandervorst2003, 22477 title = {Iterative {K}rylov Methods for Large Linear Systems}, 22478 author = {van der Vorst, H.}, 22479 isbn = {9780521818285}, 22480 publisher = {Cambridge University Press}, 22481 year = {2003} 22482} 22483 22484@Book{ peres2006, 22485 author = {Asher Peres}, 22486 title = {Quantum theory: concepts and methods}, 22487 volume = {57}, 22488 publisher = {Springer Science \& Business Media}, 22489 year = {2006} 22490} 22491 22492@Book{ kuttler2012, 22493 title = {Linear algebra: theory and applications}, 22494 author = {Kenneth Kuttler}, 22495 url = {http://www.math.byu.edu/~klkuttle/Linearalgebra.pdf}, 22496 year = {2012} 22497} 22498 22499@Book{ elman_silvester_wathen_2014, 22500 place = {Oxford}, 22501 title = {Finite elements and fast iterative solvers: with applications in incompressible 22502 fluid dynamics}, 22503 publisher = {Oxford University Press}, 22504 author = {Elman, Howard C. and Silvester, David J. and Wathen, Andrew J.}, 22505 url = {https://global.oup.com/academic/product/finite-elements-and-fast-iterative-solvers-9780199678792?cc=us&lang=en&}, 22506 year = {2014} 22507} 22508 22509@Article{ alametal2007, 22510 title = {An evaluation of the ORNL Cray XT3}, 22511 author = {S. R. Alam and R. F. Barrett and M. R. Fahey and J. A. Kuehn and O. E. B. Messer 22512 and R. T. Mills and P. C. Roth and J. S. Vetter and P. H. Worley}, 22513 journal = {International Journal of High Performance Computing Applications}, 22514 volume = {22}, 22515 number = {1}, 22516 pages = {52--80}, 22517 doi = {10.1177/1094342007085019}, 22518 year = {2007} 22519} 22520 22521@Article{ plazacarey2000, 22522 title = {Local refinement of simplicial grids based on the skeleton}, 22523 author = {Plaza, A. and Carey, Graham F.}, 22524 journal = {Applied Numerical Mathematics}, 22525 doi = {10.1016/S0168-9274(99)00022-7}, 22526 issn = {01689274}, 22527 volume = {32}, 22528 number = {2}, 22529 pages = {195--218}, 22530 year = {2000} 22531} 22532 22533@Article{ carsonstrakos2020, 22534 title = {On the cost of iterative computations}, 22535 author = {Eric Carson and Zden\v{e}k Strako\v{s}}, 22536 journal = {Phil. Trans. R. Soc. A}, 22537 volume = {378}, 22538 number = {20190050}, 22539 doi = {10.1098/rsta.2019.0050}, 22540 url = {https://royalsocietypublishing.org/doi/full/10.1098/rsta.2019.0050}, 22541 year = {2020} 22542} 22543 22544@Article{ schoberl1999, 22545 title = {Multigrid methods for a parameter dependent problem in primal variables}, 22546 author = {Joachim Sch{\"o}berl}, 22547 journal = {Numerische Mathematik}, 22548 volume = {84}, 22549 number = {1}, 22550 pages = {97--119}, 22551 year = {1999} 22552} 22553 22554@Article{ wuleexuzikatanov2008, 22555 title = {Convergence analysis on iterative methods for semidefinite systems}, 22556 author = {Jinbiao Wu and Young-Ju Lee and Jinchao Xu and Ludmil Zikatanov}, 22557 journal = {Journal of Computational Mathematics}, 22558 pages = {797--815}, 22559 year = {2008} 22560} 22561 22562@Article{ maierrannacher2016, 22563 title = {Duality-based adaptivity in finite element discretization of heterogeneous 22564 multiscale problems}, 22565 author = {Maier, Matthias and Rannacher, Rolf}, 22566 journal = {Journal of Numerical Mathematics}, 22567 volume = {24}, 22568 number = {3}, 22569 pages = {167--187}, 22570 year = {2016} 22571} 22572 22573@Article{ maierrannacher2018, 22574 title = {A duality-based optimization approach for model adaptivity in heterogeneous 22575 multiscale problems}, 22576 author = {Maier, Matthias and Rannacher, Rolf}, 22577 journal = {Multiscale Modeling \& Simulation}, 22578 volume = {16}, 22579 number = {1}, 22580 pages = {412--428}, 22581 year = {2018} 22582} 22583 22584@Article{ margetismaierluskin2017, 22585 title = {On the Wiener--Hopf method for surface plasmons: Diffraction from semiinfinite 22586 metamaterial sheet}, 22587 author = {Margetis, Dionisios and Maier, Matthias and Luskin, Mitchell}, 22588 journal = {Studies in Applied Mathematics}, 22589 volume = {139}, 22590 number = {4}, 22591 pages = {599--625}, 22592 year = {2017} 22593} 22594 22595@Article{ maiermargetisluskin2017b, 22596 title = {Dipole excitation of surface plasmon on a conducting sheet: Finite element 22597 approximation and validation}, 22598 author = {Maier, Matthias and Margetis, Dionisios and Luskin, Mitchell}, 22599 journal = {Journal of Computational Physics}, 22600 volume = {339}, 22601 pages = {126--145}, 22602 year = {2017} 22603} 22604 22605@Article{ maiermargetisluskin2018, 22606 title = {Generation of surface plasmon-polaritons by edge effects}, 22607 author = {Matthias Maier and Dionisios Margetis and Mitchell Luskin}, 22608 journal = {Communications in Mathematical Sciences}, 22609 volume = {16}, 22610 number = {1}, 22611 pages = {77--95}, 22612 url = {http://arxiv.org/abs/1702.00848}, 22613 year = {2018} 22614} 22615 22616@Article{ maiermattheakiskaxirasluskinmargetis2018, 22617 title = {Universal behavior of a dispersive Dirac cone in gradient-index plasmonic 22618 metamaterials}, 22619 author = {Maier, Matthias and Mattheakis, Marios and Kaxiras, Efthimios and Luskin, 22620 Mitchell and Margetis, Dionisios}, 22621 journal = {Physical Review B}, 22622 volume = {97}, 22623 number = {3}, 22624 pages = {035307}, 22625 year = {2018} 22626} 22627 22628@Article{ maiermattheakiskaxirasluskinmargetis2019, 22629 title = {Homogenization of plasmonic crystals: seeking the epsilon-near-zero effect}, 22630 author = {Maier, Matthias and Mattheakis, Marios and Kaxiras, Efthimios and Luskin, 22631 Mitchell and Margetis, Dionisios}, 22632 journal = {Proceedings of the Royal Society A}, 22633 volume = {475}, 22634 number = {2230}, 22635 pages = {20190220}, 22636 year = {2019} 22637} 22638 22639@Article{ maiermargetisluskin2020, 22640 title = {Finite-size effects in wave transmission through plasmonic crystals: A tale of 22641 two scales}, 22642 author = {Maier, Matthias and Luskin, Mitchell and Margetis, Dionisios}, 22643 journal = {Physical Review B}, 22644 volume = {102}, 22645 number = {7}, 22646 pages = {075308}, 22647 year = {2020} 22648} 22649 22650@Article{ margetismaierstauberlowluskin2020, 22651 title = {Nonretarded edge plasmon-polaritons in anisotropic two-dimensional materials}, 22652 author = {Margetis, Dionisios and Maier, Matthias and Stauber, Tobias and Low, Tony and 22653 Luskin, Mitchell}, 22654 journal = {Journal of Physics A: Mathematical and Theoretical}, 22655 volume = {53}, 22656 number = {5}, 22657 pages = {055201}, 22658 year = {2020} 22659} 22660 22661@Article{ maiermargetismellet2020, 22662 title = {Homogenization of time-harmonic Maxwell’s equations in nonhomogeneous plasmonic 22663 structures}, 22664 author = {Maier, Matthias and Margetis, Dionisios and Mellet, Antoine}, 22665 journal = {Journal of Computational and Applied Mathematics}, 22666 volume = {377}, 22667 pages = {112909}, 22668 year = {2020} 22669} 22670 22671@Article{ maierkronbichler2021, 22672 title = {Efficient parallel 3D computation of the compressible Euler equations with an 22673 invariant-domain preserving second-order finite-element scheme}, 22674 author = {Maier, Matthias and Kronbichler, Martin}, 22675 journal = {ACM Transactions on Parallel Computing}, 22676 volume = {8}, 22677 number = {3}, 22678 pages = {1--30}, 22679 year = {2021} 22680} 22681 22682@Article{ guermondmaierpopovtomas2021, 22683 title = {Second-order invariant domain preserving approximation of the compressible 22684 Navier--Stokes equations}, 22685 author = {Guermond, Jean-Luc and Maier, Matthias and Popov, Bojan and Tomas, Ignacio}, 22686 journal = {Computer Methods in Applied Mechanics and Engineering}, 22687 volume = {375}, 22688 pages = {113608}, 22689 year = {2021} 22690} 22691 22692@Article{ liliptonmaier2021, 22693 title = {Lorentz Resonance in the Homogenization of Plasmonic Crystals}, 22694 author = {Li, Wei and Lipton, Robert and Maier, Matthias}, 22695 eprint = {2009.12166}, 22696 archiveprefix = {arXiv}, 22697 primaryclass = {phys.optics}, 22698 year = {2021} 22699} 22700 22701@Article{ songmaierluskin2020, 22702 title = {Nonlinear eigenvalue problems for coupled Helmholtz equations modeling 22703 gradient-index graphene waveguides}, 22704 author = {Song, Jung Heon and Maier, Matthias and Luskin, Mitchell}, 22705 journal = {Journal of Computational Physics}, 22706 volume = {423}, 22707 pages = {109871}, 22708 year = {2020} 22709} 22710 22711@Article{ songmaierluskin2019, 22712 title = {Adaptive finite element simulations of waveguide configurations involving 22713 parallel 2D material sheets}, 22714 author = {Song, Jung Heon and Maier, Matthias and Luskin, Mitchell}, 22715 journal = {Computer Methods in Applied Mechanics and Engineering}, 22716 volume = {351}, 22717 pages = {20--34}, 22718 year = {2019} 22719} 22720 22721% 22722% <a name="consults"></a><H3><center>Users Who have Visited ANL for Consulting on PETSc</center></H3> 22723% 22724% 22725@Unpublished{ rob1, 22726 author = {Rob Kunz}, 22727 institution = {Computational Mechanics Division, Applied Research Laboratory, The Pennsylvania 22728 State University}, 22729 url = {http://www.arl.psu.edu/areas/compmech/compmech.html}, 22730 sponsors = {U.S. Navy, NRC}, 22731 note = {Using the PETSc and hypre linear solvers to solve pressure equations in CFD 22732 simulations, including lake warming by power plants}, 22733 dates = {Oct 3 and 4, 2002}, 22734 email = {rfk@wt.arl.psu.edu} 22735} 22736 22737@Unpublished{ au1, 22738 author = {Feng Wang and William Appelbe}, 22739 institution = {VPAC, Victorian Partnership for Advanced Computing, Melbourne, Australia}, 22740 url = {http://www.vpac.org}, 22741 sponsors = { }, 22742 note = {Using PETSc for a Variety of Geophysical Simulations}, 22743 dates = {Nov 22, 2002} 22744} 22745 22746@Unpublished{ carl1, 22747 author = {Carl Sovinec}, 22748 institution = {Applied Physics, University of Wisconsin}, 22749 url = {http://nimrodteam.org}, 22750 sponsors = {DOE Office of Fusion Research}, 22751 note = {Investigating using PETSc for NIMROD}, 22752 dates = {Nov 21, 2002}, 22753 email = {sovinec@engr.wisc.edu} 22754} 22755 22756@Unpublished{ au1b, 22757 author = {Pablo Carrica and Robert Wilson}, 22758 institution = {INSTITUTE HYDRAULIC RESEARCH, University of Iowa}, 22759 url = {http://}, 22760 sponsors = {Office of Naval Research}, 22761 note = {Using PETSc for a hydrodynamics of ships and submarines}, 22762 dates = {Sept, 2002}, 22763 email = {pablo-carrica@uiowa.edu and robert-wilson@uiowa.edu} 22764} 22765 22766% ------------------- TAO References ---------------------- 22767@Article{ benson:2001:csp, 22768 author = {Steven J. Benson and Lois Curfman McInnes and Jorge J. More'}, 22769 title = {A Case Study in the Performance and Scalability of Optimization Algorithms}, 22770 journal = {{ACM} Transactions on Mathematical Software}, 22771 volume = {27}, 22772 number = {3}, 22773 month = sep, 22774 year = {2001}, 22775 pages = {361--376} 22776} 22777 22778@TechReport{ tao-user-ref-2000, 22779 author = {Steve Benson and Lois Curfman McInnes and Jorge Mor\'{e}}, 22780 title = {{TAO} Users Manual}, 22781 year = {2000}, 22782 institution = {Mathematics and Computer Science Division, Argonne National Laboratory}, 22783 number = {ANL/MCS-TM-242}, 22784 note = {See \url{http://www.mcs.anl.gov/tao}} 22785} 22786 22787% ------------------- Optimization References ---------------------- 22788@Book{ optguide93, 22789 title = {Optimization Software Guide}, 22790 author = {Jorge J. Mor\'{e} and Stephen J. Wright}, 22791 publisher = {SIAM Publications}, 22792 address = {Philadelphia}, 22793 year = {1993} 22794} 22795 22796@InProceedings{ more84, 22797 author = {Jorge J. Mor\'{e} and Danny C. Sorenson and Burton S. Garbow and Kenneth E. 22798 Hillstrom}, 22799 title = {The {MINPACK} Project}, 22800 booktitle = {Sources and Development of Mathematical Software}, 22801 editor = {Wayne R. Cowell}, 22802 year = {1984}, 22803 pages = {88--111} 22804} 22805 22806@Article{ steihaug:83, 22807 author = {Trond Steihaug}, 22808 title = {The Conjugate Gradient Method and Trust Regions in Large Scale Optimization}, 22809 journal = {SIAM J. Numer. Anal.}, 22810 volume = {20}, 22811 year = {1983}, 22812 pages = {626--637}, 22813 key = {steihaug92 ! trust_region} 22814} 22815 22816@TechReport{ minpack2test, 22817 author = {Brett M. Averick and Richard G. Carter and Jorge J. Mor\'{e}}, 22818 title = {The {MINPACK-2} Test Problem Collection}, 22819 institution = {Argonne National Laboratory}, 22820 year = {1991}, 22821 number = {ANL/MCS-TM-150}, 22822 key = {more91 ! MINPACK-2} 22823} 22824 22825@TechReport{ hohmann:94, 22826 author = {Andreas Hohmann}, 22827 title = {Object Oriented Design of Multilevel {N}ewton and Continuation Methods}, 22828 institution = {Konrad-Zuse-Zentrum fur Informationstechnik Berlin}, 22829 year = {1994}, 22830 number = {SC-94-4}, 22831 key = {Hohmann94} 22832} 22833 22834@TechReport{ meza:94, 22835 author = {Juan C. Meza}, 22836 title = {{OPT}++: An Object-Oriented Class Library for Nonlinear Optimization}, 22837 institution = {Sandia National Laboratory}, 22838 year = {1994}, 22839 number = {SAND94-8225}, 22840 key = {Meza94} 22841} 22842 22843@Book{ nw99, 22844 author = {Jorge Nocedal and Stephen J. Wright}, 22845 title = {Numerical Optimization}, 22846 year = {1999}, 22847 publisher = {Springer-Verlag}, 22848 address = {New York} 22849} 22850 22851@Book{ dennis:83, 22852 author = {J. E. {Dennis Jr.} and Robert B. Schnabel}, 22853 title = {Numerical Methods for Unconstrained Optimization and Nonlinear Equations}, 22854 publisher = {Prentice-Hall, Inc.}, 22855 address = {Englewood Cliffs, NJ}, 22856 year = {1983} 22857} 22858 22859@TechReport{ more:92, 22860 author = {Jorge J. Mor\'{e} and David Thuente}, 22861 title = {Line search algorithms with guaranteed sufficient decrease}, 22862 institution = {Mathematics and Computer Science Division, Argonne National Laboratory}, 22863 year = {1992}, 22864 number = {MCS-P330-1092} 22865} 22866 22867@Article{ more-toraldo, 22868 author = {Jorge J. Mor\'e and G. Toraldo}, 22869 journal = {SIOPT}, 22870 pages = {93--113}, 22871 title = {On the solution of large quadratic programming problems with bound constraints}, 22872 volume = {1}, 22873 year = {1991} 22874} 22875 22876@Article{ byrd:1995:lma, 22877 author = {Richard H. Byrd and Peihuang Lu and Jorge Nocedal and Ci You Zhu}, 22878 title = {A Limited Memory Algorithm for Bound Constrained Optimization}, 22879 journal = {SIAM Journal on Scientific Computing}, 22880 volume = {16}, 22881 number = {5}, 22882 pages = {1190--1208}, 22883 month = sep, 22884 year = {1995}, 22885 coden = {SJOCE3}, 22886 issn = {1064-8275 (print), 1095-7197 (electronic)}, 22887 mrclass = {90C30 (65K05)}, 22888 mrnumber = {96e:90039}, 22889 mrreviewer = {Henry Wolkowicz}, 22890 bibdate = {Fri Dec 4 16:17:35 MST 1998} 22891} 22892 22893@Article{ lin_c3, 22894 author = {C.-J. Lin and J. J. Mor\'e}, 22895 title = {Newton's method for large bound-constrained optimization problems}, 22896 year = {1999}, 22897 journal = {SIOPT}, 22898 volume = {9(4)}, 22899 pages = {1100--1127}, 22900 url = {http://www.mcs.anl.gov/home/more/papers/nb.ps.gz} 22901} 22902 22903@TechReport{ dolan2, 22904 author = {E. Dolan and J. J. Mor\'{e}}, 22905 title = {Benchmarking Optimization Software with Performance Profiles}, 22906 year = {2001}, 22907 month = jan, 22908 number = {ANL/MCS-P861-1200}, 22909 institution = {Mathematics and Computer Science Division, Argonne National Laboratory}, 22910 address = {Argonne, IL}, 22911 url = {http://www.mcs.anl.gov/~more/cops/} 22912} 22913 22914@InProceedings{ owlqn, 22915 author = {Galen Andrew and Jianfeng Gao}, 22916 title = {Scalable training of L1-regularized log-linear models}, 22917 booktitle = {Proceedings of the 24th international conference on Machine learning (ICML)}, 22918 pages = {33--40}, 22919 year = {2007} 22920} 22921 22922@Article{ bmrm, 22923 author = {Choon Hue Teo and S.V.N. Vishwanathan and Alex J. Smola and Quoc V. Le}, 22924 title = {Bundle methods for regularized risk minimization}, 22925 year = {2010}, 22926 journal = {Journal of Machine Learning Research}, 22927 volume = {11}, 22928 pages = {311--365} 22929} 22930 22931% ------------------- Component Software References ---------------------- 22932@InProceedings{ cca99, 22933 author = {R. Armstrong and D. Gannon and A. Geist and K. Keahey and S. Kohn and L. C. 22934 McInnes and S. Parker and B. Smolinski}, 22935 title = {Toward a Common Component Architecture for High-Performance Scientific 22936 Computing}, 22937 booktitle = {Proceedings of {High Performance Distributed Computing}}, 22938 pages = {115--124}, 22939 year = {1999}, 22940 note = {See \url{http://cca-forum.org}} 22941} 22942 22943@Book{ szyperski98, 22944 author = {Clemens Szyperski}, 22945 title = {Component Software: Beyond Object-Oriented Programming}, 22946 publisher = {ACM Press}, 22947 address = {New York}, 22948 year = {1998} 22949} 22950 22951@Article{ broy98, 22952 author = {Manfred Broy and Anton Deimel and Juergen Henn and Kai Koskimies and 22953 Franti\v{s}ek Pl\'{a}\v{s}il and Gustave Pomberger and Wolfgang Pree and Michael 22954 Stal and Clemens Szyperski}, 22955 title = {What Characterizes a (Software) Component?}, 22956 journal = {Software -- Concepts and Tools}, 22957 publisher = {Springer-Verlag}, 22958 year = {1998}, 22959 volume = {19}, 22960 pages = {49--56} 22961} 22962 22963@Article{ componentware:94, 22964 author = {Jon Udell}, 22965 title = {Componentware}, 22966 journal = {Byte}, 22967 volume = {may}, 22968 pages = {46--56}, 22969 year = {1994}, 22970 key = {Udell94 ! componentware} 22971} 22972 22973@Misc{ cca-web-page, 22974 author = {{Common Component Architecture Forum}}, 22975 note = {See \url{http://cca-forum.org}} 22976} 22977 22978% --------------- References for Tools Used by TAO Developers ----------------- 22979 22980% 22981% tohtml: Used to generate on-line TAO users manual and manual pages 22982% 22983@TechReport{ tohtml, 22984 author = {William Gropp}, 22985 title = {Users Manual for tohtml: Producing true hypertext documents from {LaTeX}}, 22986 institution = {Argonne National Laboratory}, 22987 number = {ANL/MCS-TM-00}, 22988 month = jan, 22989 year = {1995}, 22990 key = {tohtml} 22991} 22992 22993% 22994% doctext: Used to generate tex version of TAO manual pages 22995% 22996@TechReport{ doctext, 22997 author = {William Gropp}, 22998 title = {Users Manual for doctext: Producing documentation from {C} source code}, 22999 institution = {Argonne National Laboratory}, 23000 number = {ANL/MCS-TM-00}, 23001 month = jan, 23002 year = {1995}, 23003 key = {doctext} 23004} 23005 23006% 23007% bfort: Used to generate TAO Fortran interface 23008% 23009@TechReport{ bfort, 23010 author = {William Gropp}, 23011 title = {Users Manual for bfort: Producing {F}ortran interfaces to {C} source code}, 23012 institution = {Argonne National Laboratory}, 23013 number = {ANL/MCS-TM-208}, 23014 month = mar, 23015 year = {1995}, 23016 key = {doctext} 23017} 23018 23019% ------------------------- PETSc References ------------------------------ 23020@InProceedings{ petsc, 23021 author = {Satish Balay and William D. Gropp and Lois Curfman McInnes and Barry F. Smith}, 23022 title = {Efficient Management of Parallelism in Object Oriented Numerical Software 23023 Libraries}, 23024 booktitle = {Modern Software Tools in Scientific Computing}, 23025 editor = {E. Arge and A. M. Bruaset and H. P. Langtangen}, 23026 publisher = {Birkhauser Press}, 23027 pages = {163--202}, 23028 year = {1997} 23029} 23030 23031% ------------------------- Misc Other References ------------------------------ 23032@Misc{ indeps-web-page, 23033 title = {{InDEPS} {W}eb page}, 23034 note = {http://z.ca.sandia.gov/\~{ }indeps/}, 23035 author = {et al. Robert Armstrong}, 23036 institution = {Sandia National Laboratory}, 23037 key = {{InDEPS} {W}eb page} 23038} 23039 23040@Misc{ pooma, 23041 title = {{POOMA}: {A} FrameWork for scientific computing applications on parallel ar 23042 chitectures}, 23043 year = {1996}, 23044 author = {J. V. W. Reynders and J. C. Cummings and P. J. Hinker and M. Tholburn a nd M. S. 23045 S. Banerjee and S. Karmesin and S. Atlas and K. Keahey and W. F. Humphr ey} 23046} 23047 23048@Misc{ isis++-web-page, 23049 title = {{ISIS++} {W}eb Page}, 23050 note = {See \url{http://ca.sandia.gov/isis}}, 23051 author = {Robert L. Clay and Kyran Mish and Alan B. Williams}, 23052 institution = {Sandia National Laboratories} 23053} 23054 23055@Misc{ trilinos-web-page, 23056 title = {{Trilinos} {W}eb Page}, 23057 note = {See 23058 \url{http://www.cs.sandia.gov/\~mheroux/Trilinos/doc/TrilinosIntroduction.htm}}, 23059 author = {Mike Heroux et al.}, 23060 institution = {Sandia National Laboratories} 23061} 23062 23063@Misc{ alice-web-page, 23064 title = {{ALICE} {W}eb page}, 23065 note = {http://www.mcs.anl.gov/\-alice, Mathematics and Computer Science Division, 23066 Argonne National Laboratory}, 23067 key = {{ALICE} {W}eb page} 23068} 23069 23070@Misc{ autodiff-webpage, 23071 author = {{Computational Differentiation Project}}, 23072 note = {See \url{http://www.mcs.anl.gov/autodiff}} 23073} 23074 23075@Misc{ coool-home-page, 23076 author = {Lydia Deng and Wences Gouveia and John Scales}, 23077 title = {{The CWP Object-Oriented Optimization Library}}, 23078 note = {See \url{http://www.cwp.mines.edu/cwpcodes/coool}} 23079} 23080 23081@Misc{ rice-inversion-home-page, 23082 author = {Mark S. Gokenbach and William W. Symes}, 23083 title = {{The Hilbert Class Library}}, 23084 note = {See \url{http://www.trip.caam.rice.edu/}} 23085} 23086 23087@Misc{ opt++-home-page, 23088 author = {{OPT++: An Object-Oriented Nonlinear Optimization Library}}, 23089 note = {See \url{http://csmr.ca.sandia.gov/projects/opt/opt++.html}} 23090} 23091 23092@Article{ gockenbach:1999:ccl, 23093 author = {Mark S. Gockenbach and Matthew J. Petro and William W. Symes}, 23094 title = {C++ Classes for Linking Optimization with Complex Simulations}, 23095 journal = {{ACM} Transactions on Mathematical Software}, 23096 volume = {25}, 23097 number = {2}, 23098 month = jun, 23099 year = {1999}, 23100 pages = {191-212}, 23101 abstract = {The object-oriented programming paradigm can be used to overcome the 23102 incompatibilities between off-the-shelf optimization software and application 23103 software. The Hilbert Class Library (HCL) defines the fundamental mathematical 23104 objects arising in optimization problems, such as vectors, linear operators, and 23105 so forth, as C++ classes, making it possible to write optimization code in a 23106 natural fashion, while allowing application software such as simulators to use the 23107 most convenient data structures and programming style. In spite of the poor 23108 reputation C++ has for runtime performance, the use of mixed-language programming 23109 allows performance equal to that achieved by standard Fortran packages, as 23110 comparisons with the popular code LBFGS and ARPACK demonstrate.}, 23111 accepted = {April 1999}, 23112 url = {http://www.acm.org/pubs/citations/journals/toms/1999-25-2/p191-gockenbach/} 23113} 23114 23115@Misc{ neos-guide, 23116 author = {{The Optimization Software Guide}}, 23117 note = {See \url{http://www.mcs.anl.gov/otc/Guide/}} 23118} 23119 23120@Article{ boyd, 23121 title = {Distributed optimization and statistical learning via the alternating direction 23122 method of multipliers}, 23123 author = {Boyd, Stephen and Parikh, Neal and Chu, Eric and Peleato, Borja and Eckstein, 23124 Jonathan and others}, 23125 journal = {Foundations and Trends{\textregistered} in Machine learning}, 23126 volume = {3}, 23127 number = {1}, 23128 pages = {1-122}, 23129 year = {2011}, 23130 publisher = {Now Publishers, Inc.} 23131} 23132 23133@Misc{ :alertsys, 23134 title = {page{ALERT}}, 23135 organization = {Alert Systems, Inc}, 23136 address = {Madison, Wisconsin}, 23137 note = {http://www.alertsys.com/} 23138} 23139 23140@Manual{ :cmfortran, 23141 title = {{CM} {F}ortran Language Reference Manual}, 23142 organization = {Thinking Machines Corporation}, 23143 year = {1994}, 23144 address = {Cambridge, MA} 23145} 23146 23147@Manual{ :cmmd, 23148 title = {{CMMD} Reference Manual, Version 3.0}, 23149 organization = {Thinking Machines Corporation}, 23150 year = {1993}, 23151 address = {Cambridge, MA} 23152} 23153 23154@Manual{ :cmssl, 23155 title = {{CMSSL} for {CM} {F}ortran}, 23156 volume = {I}, 23157 organization = {Thinking Machines Corporation}, 23158 year = {1994}, 23159 address = {Cambridge, MA} 23160} 23161 23162@Misc{ :condor, 23163 author = {M. Livny}, 23164 title = {{PI}, The {Condor} Project, High Throughput Computing}, 23165 howpublished = {www.cs.wisc.edu/condor} 23166} 23167 23168@Manual{ :connection, 23169 title = {Connection Machine {CM}--5 Technical Summary}, 23170 organization = {Thinking Machines Corporation}, 23171 year = {1993}, 23172 address = {Cambridge, MA} 23173} 23174 23175@Manual{ :cplex, 23176 title = {{CPLEX} Optimizer}, 23177 organization = {ILOG CPLEX Division}, 23178 address = {889 Alder Avenue, Incline Village, Nevada}, 23179 note = {http://www.cplex.com/} 23180} 23181 23182@Manual{ :cplextm, 23183 title = {Using the {CPLEX(TM)} Linear Optimizer and {CPLEX(TM)} Mixed Integer Optimizer 23184 (Version 2.0)}, 23185 organization = {CPLEX Optimization Inc.}, 23186 year = {1992}, 23187 address = {Incline Village, Nevada} 23188} 23189 23190@Misc{ :fatcop, 23191 author = {M. C. Ferris}, 23192 title = {{PI}, {FATCOP}: {A} Fault Tolerant {Condor} {PVM} Mixed Integer Programming 23193 Solver}, 23194 howpublished = {www.cs.wisc.edu/math-prog/fatcop} 23195} 23196 23197@Misc{ :metaneos, 23198 author = {S. J. Wright}, 23199 title = {{metaNEOS}: Metacomputing Environments for Optimization}, 23200 howpublished = {www-unix.mcs.anl.gov/metaneos} 23201} 23202 23203@InCollection{ gropp.more:optimization, 23204 author = {W. Gropp and J. J. Mor\'e}, 23205 title = {Optimization environments and the {NEOS} Server}, 23206 booktitle = {Approximation Theory and Optimization}, 23207 pages = {167--182}, 23208 publisher = {Cambridge University Press}, 23209 year = {1997}, 23210 editor = {M. D. Buhmann and A. Iserles} 23211} 23212 23213@Article{ czyzyk.mesnier.ea:neos, 23214 author = {J. Czyzyk and M. P. Mesnier and J. J. Mor\'e}, 23215 title = {The {NEOS} Server}, 23216 journal = {IEEE Journal on Computational Science and Engineering}, 23217 volume = {5}, 23218 year = {1998}, 23219 pages = {68--75} 23220} 23221 23222@Book{ :osl, 23223 title = {Handbook for {IBM OSL}}, 23224 author = {M. S. Hung and W. O. Rom and A. D. Warren}, 23225 year = {1994}, 23226 publisher = {Boyd and Fraser}, 23227 address = {Danvers, Massachusetts} 23228} 23229 23230@Manual{ :pro-matlab, 23231 title = {{PRO}--{MATLAB} User's Guide}, 23232 organization = {The MathWorks, Inc.}, 23233 year = {1989}, 23234 address = {21 Eliot Street, South Natick, MA 01760} 23235} 23236 23237@Misc{ :prostate, 23238 key = {Biomedical}, 23239 title = {Biomedical Business International Newsletter}, 23240 howpublished = {pp. 72--75}, 23241 year = {1996} 23242} 23243 23244@Misc{ :sipcase, 23245 key = {Natural}, 23246 title = {Natural Gas Planning: An Application of Stochastic Linear Programming}, 23247 howpublished = {http://www-fp.mcs.anl.gov/otc/Guide/CaseStudies/slp/index.html} 23248} 23249 23250@Book{ aarts.korst:simulated, 23251 author = {E. Aarts and J. Korst}, 23252 title = {Simulated Annealing and Boltzman Machines}, 23253 year = {1990}, 23254 publisher = {John Wiley \& Sons}, 23255 address = {Chichester} 23256} 23257 23258@TechReport{ aarts.laarhoven.ea:local-search-based, 23259 author = {E. H. L. Aarts and P. J. M. van Laarhoven and N. L. J. Ulder}, 23260 title = {Local-Search-Based Algorithms for Job Shop Scheduling}, 23261 institution = {Centre for Quantitative Methods}, 23262 year = {1991}, 23263 address = {Nederlandse Philips Bedrijven B.V., P.O. Box 218, NL-5600 MD Eindhoven}, 23264 number = {106}, 23265 type = {CQM-Not} 23266} 23267 23268@Article{ aashtiani.magnanti:equilibria, 23269 author = {H. Z. Aashtiani and T. L. Magnanti}, 23270 title = {Equilibria on a congested transportation network}, 23271 journal = {SIAM Journal on Algebraic and Discrete Methods}, 23272 volume = {2}, 23273 year = {1981}, 23274 pages = {213--226} 23275} 23276 23277@Article{ ablow.brigham:analog, 23278 author = {C. M. Ablow and G. Brigham}, 23279 title = {An Analog Solution of Programming Problems}, 23280 journal = {Operations Research}, 23281 year = {1955}, 23282 volume = {3}, 23283 pages = {388--394} 23284} 23285 23286@Article{ achuthan.grabowski.ea:optimal, 23287 author = {N. R. Achuthan and J. Grabowski and J. B. Sidney}, 23288 title = {Optimal Flow--Shop Scheduling with Earliness and Tardiness Penalties}, 23289 journal = {Opsearch}, 23290 year = {1981}, 23291 volume = {18}, 23292 pages = {117--138} 23293} 23294 23295@Book{ adelman.robinson:income, 23296 author = {I. Adelman and S. Robinson}, 23297 title = {Income Distribution Policy in Developing Countries}, 23298 publisher = {Stanford University Press}, 23299 year = {1978}, 23300 address = {Stanford, California} 23301} 23302 23303@Article{ adler.resende.ea:implementation, 23304 author = {I. Adler and M. G. C. Resende and G. Veiga and N. K. Karmarkar}, 23305 title = {An Implementation of {K}armarkar's Algorithm for Linear Programming}, 23306 journal = {Mathematical Programming}, 23307 year = {1989}, 23308 volume = {44}, 23309 pages = {297--336} 23310} 23311 23312@TechReport{ aeberhard.coomans.ea:comparison, 23313 author = {S. Aeberhard and D. Coomans and O. de Vel}, 23314 title = {Comparison of Classifiers in High Dimensional Settings}, 23315 institution = {Departments of Computer Science and of Mathematics and Statistics, James Cook 23316 University of North Queensland}, 23317 year = {1992}, 23318 number = {92-02}, 23319 type = {Technical Report} 23320} 23321 23322@Article{ aganagic.cottle:constructive, 23323 author = {M. Aganagi\'{c} and R. W. Cottle}, 23324 title = {A Constructive Characterization of ${Q}_0$ Matrices with Nonnegative Principal 23325 Minors}, 23326 journal = {Mathematical Programming}, 23327 year = {1987}, 23328 volume = {37}, 23329 pages = {223--231} 23330} 23331 23332@TechReport{ aganagic:iterative, 23333 author = {M. Aganagi\'{c}}, 23334 title = {Iterative Methods for the Linear Complementarity Problem}, 23335 institution = {Systems Optimization Laboratory, Department of Operations Research, Stanford 23336 University}, 23337 year = {1978}, 23338 type = {SOL}, 23339 number = {78-10}, 23340 address = {Stanford, California} 23341} 23342 23343@Book{ ahlfors:complex, 23344 author = {L. V. Ahlfors}, 23345 title = {Complex Analysis}, 23346 publisher = {McGraw--Hill Book Company}, 23347 address = {New York}, 23348 series = {International Series in Pure and Applied Mathematics}, 23349 edition = {Second}, 23350 year = {1966} 23351} 23352 23353@Article{ ahn:solution, 23354 author = {B--H. Ahn}, 23355 title = {Solution of Non--Symmetric Linear Complementarity Problems by Iterative Methods}, 23356 journal = {Journal of Optimization Theory and Applications}, 23357 year = {1981}, 23358 volume = {33}, 23359 pages = {175--185} 23360} 23361 23362@Article{ al-fahed.stavroulakis.ea:hard, 23363 author = {A. M. Al-Fahed and G. E. Stavroulakis and P. D. Panagiotopoulos}, 23364 title = {Hard and soft fingered robot grippers. The linear complementarity approach}, 23365 journal = {Zeitschrift f{\"{u}}r Angewandte Mathematik und Mechanik}, 23366 volume = {71}, 23367 year = {1991}, 23368 pages = {257--265} 23369} 23370 23371@Article{ al-fahed.stavroulakis.ea:linear, 23372 author = {A. M. Al-Fahed and G. E. Stavroulakis and P. D. Panagiotopoulos}, 23373 title = {A linear complementarity approach to the frictionless gripper}, 23374 journal = {International Journal of Robotic Research}, 23375 volume = {11}, 23376 year = {1992}, 23377 pages = {112--122} 23378} 23379 23380@Article{ al-khayyal.falk:jointly, 23381 author = {F. A. Al--Khayyal and J. E. Falk}, 23382 title = {Jointly Constrained Biconvex Programming}, 23383 journal = {Mathematics of Operations Research}, 23384 year = {1983}, 23385 volume = {8}, 23386 pages = {273--286} 23387} 23388 23389@Article{ al-khayyal.kyparisis:finite, 23390 author = {F. A. Al--Khayyal and J. Kyparisis}, 23391 title = {Finite Convergence of Algorithms for Nonlinear Programs and Variational 23392 Inequalities}, 23393 journal = {Journal of Optimization Theory and Applications}, 23394 year = {1991}, 23395 volume = {70}, 23396 pages = {319--332} 23397} 23398 23399@PhDThesis{ al-khayyal:biconvex, 23400 author = {F. A. Al--Khayyal}, 23401 title = {Biconvex Programming and Biconcave Minimization}, 23402 year = {1977}, 23403 school = {The George Washington University} 23404} 23405 23406@Article{ alart.curnier:mixed, 23407 author = {P. Alart and A. Curnier}, 23408 title = {A mixed formulation for frictional contact problems prone to {N}ewton like 23409 solution methods}, 23410 journal = {Computer Methods in Applied Mechanics and Engineering}, 23411 volume = {92}, 23412 year = {1991}, 23413 pages = {353--375} 23414} 23415 23416@Misc{ alexander.kellog.ea:piecewise, 23417 author = {J.~C. Alexander and R.~B. Kellog and T.-Y. Li and J~.A. Yorke}, 23418 title = {Piecewise smooth continuation}, 23419 howpublished = {Manuscript}, 23420 year = {1979} 23421} 23422 23423@InCollection{ alexander.li.ea:piecewise, 23424 author = {J.~C. Alexander and T.-Y. Li and J~.A. Yorke}, 23425 title = {Piecewise smooth homotopies}, 23426 booktitle = {Homotopy Methods and Global Convergence}, 23427 pages = {1--14}, 23428 publisher = {Plenum Press}, 23429 year = {1983}, 23430 editor = {B.~C. Eaves and F.~J. Gould and H.-O. Peitgen and M.~J. Todd}, 23431 address = {New York} 23432} 23433 23434@InCollection{ alexander:topological, 23435 author = {J.~C. Alexander}, 23436 title = {The topological theory of an embedding method}, 23437 booktitle = {Continuation Methods}, 23438 pages = {37--68}, 23439 publisher = {Academic Press}, 23440 year = {1978}, 23441 editor = {H. Wacker}, 23442 address = {New York} 23443} 23444 23445@Book{ allen:probability, 23446 author = {A. O. Allen}, 23447 title = {Probability, Statistics and Queueing Theory}, 23448 publisher = {Academic Press}, 23449 year = {1990}, 23450 address = {London}, 23451 edition = {Second} 23452} 23453 23454@Book{ allgower.georg:numerical, 23455 author = {E. L. Allgower and K. Georg}, 23456 title = {Numerical Continuation Methods, An Introduction}, 23457 publisher = {Springer-Verlag}, 23458 year = {1990}, 23459 address = {Berlin} 23460} 23461 23462@InProceedings{ allgower.georg:predictor-corrector, 23463 crossref = {bachem.grotschel.ea:mathematical}, 23464 author = {E. L. Allgower and K. Georg}, 23465 title = {Predictor--Corrector and Simplicial Methods for Approximating Fixed Points and 23466 Zero Points of Nonlinear Mappings}, 23467 pages = {15--56} 23468} 23469 23470@Article{ aluffi-pentini.parisi.ea:algorithm, 23471 author = {F. Aluffi-Pentini and V. Parisi and F. Zirilli}, 23472 title = {Algorithm 667: {SIGMA}- {A} Stochastic-Integration Global Minimization 23473 Algorithm}, 23474 journal = {ACM Transactions on Mathematical Software}, 23475 year = {1988}, 23476 volume = {14}, 23477 pages = {366--380} 23478} 23479 23480@Article{ anandalingam.friesz:hierarchical, 23481 author = {G. Anandalingam and T. L. Friesz}, 23482 title = {Hierarchical Optimization: An Introduction}, 23483 journal = {Annals of Operations Research}, 23484 year = {1992}, 23485 volume = {34}, 23486 pages = {1--11} 23487} 23488 23489@Article{ anandalingam.white:solution, 23490 author = {G. Anandalingam and D. J. White}, 23491 title = {A Solution Method for the Linear Static Stackelberg Problem Using Penalty 23492 Functions}, 23493 journal = {IEEE Transactions on Automatic Control}, 23494 year = {1990}, 23495 volume = {35}, 23496 number = {10}, 23497 pages = {1170--1173} 23498} 23499 23500@Article{ andersen.andersen:presolving, 23501 author = {E. Andersen and K. Andersen}, 23502 title = {Presolving in Linear Programming}, 23503 year = {1995}, 23504 journal = {Mathematical Programming}, 23505 volume = {71}, 23506 pages = {221--245} 23507} 23508 23509@InProceedings{ andersen.ye:homogeneous, 23510 author = {E. Andersen and Y. Ye}, 23511 title = {On a Homogeneous Algorithm for a Monotone Complementarity Problem with Nonlinear 23512 Equality Constraints}, 23513 crossref = {ferris.pang:complementarity}, 23514 pages = {1--11} 23515} 23516 23517@Book{ anderson.bai.ea:lapack, 23518 author = {E. Anderson and Z. Bai and C. Bischof and J. Demmel and J. Dongarra and J. Du 23519 Cros and A. Greenbaum and S. Hammarling and A. McKenney and S. Ostrouchov and D. 23520 Sorensen}, 23521 title = {{LAPACK} User's Guide}, 23522 publisher = {SIAM}, 23523 year = {1995}, 23524 address = {Philadelphia, Pennsylvania}, 23525 edition = {Second} 23526} 23527 23528@Article{ anderson.ferris:direct, 23529 author = {E. J. Anderson and M. C. Ferris}, 23530 title = {A Direct Search Algorithm for Optimization with Noisy Function Evaluations}, 23531 year = {2001}, 23532 journal = {SIAM Journal on Optimization, forthcoming}, 23533 url = {ftp://ftp.cs.wisc.edu/math-prog/tech-reports/96-11.ps}, 23534 key = {55} 23535} 23536 23537@InProceedings{ anderson.ferris:genetic, 23538 author = {E. J. Anderson and M. C. Ferris}, 23539 title = {A Genetic Algorithm for the Assembly Line Balancing Problem}, 23540 booktitle = {Proceedings of the Integer Programming / Combinatorial Optimization Conference, 23541 Waterloo, Ontario, Canada, May 28--30}, 23542 publisher = {University of Waterloo Press}, 23543 key = {14}, 23544 year = {1990} 23545} 23546 23547@Article{ anderson.ferris:genetic*1, 23548 author = {E. J. Anderson and M. C. Ferris}, 23549 title = {Genetic Algorithms for Combinatorial Optimization: The Assembly Line Balancing 23550 Problem}, 23551 journal = {ORSA Journal on Computing}, 23552 year = {1994}, 23553 url = {ftp: //ftp.cs.wisc.edu/math-prog/tech-reports/93-ga.ps}, 23554 volume = {6}, 23555 pages = {161--173}, 23556 key = {22} 23557} 23558 23559@InProceedings{ anderson.ferris:parallel, 23560 author = {E. J. Anderson and M. C. Ferris}, 23561 title = {Parallel Genetic Algorithms in Optimization}, 23562 booktitle = {Proceedings of the Fourth SIAM conference on Parallel Processing for Scientific 23563 Computing, Chicago, Illinois, December 11-13}, 23564 year = {1989}, 23565 key = {12} 23566} 23567 23568@Unpublished{ anderson.lewis:primal, 23569 author = {E. J. Anderson and A. S. Lewis}, 23570 title = {A New Primal Algorithm for Semi-Infinite Linear Programming}, 23571 note = {In preparation} 23572} 23573 23574@Book{ anderson.nash:linear, 23575 author = {E. J. Anderson and P. Nash}, 23576 title = {Linear Programming in Infinite--Dimensional Spaces}, 23577 year = {1987}, 23578 publisher = {John Wiley \& Sons}, 23579 address = {Chichester} 23580} 23581 23582@InProceedings{ anderson:primal, 23583 author = {E. J. Anderson}, 23584 title = {A New Primal Algorithm for Semi-Infinite Linear Programming}, 23585 booktitle = {Proceedings of an International Symposium on Infinite Dimensional Linear 23586 Programming, Cambridge, September 1984}, 23587 year = {1985}, 23588 editor = {E. J. Anderson and A. B. Philpott}, 23589 publisher = {Springer-Verlag}, 23590 address = {Berlin} 23591} 23592 23593@Article{ andradottir:method, 23594 author = {S. Andrad\'{o}ttir}, 23595 title = {A Method of Discrete Stochastic Optimization}, 23596 journal = {Management Science}, 23597 year = {1995}, 23598 volume = {41}, 23599 pages = {1946--1961} 23600} 23601 23602@Article{ andradottir:global, 23603 author = {S. Andrad\'{o}ttir}, 23604 title = {A Global Search Method for Discrete Stochastic Optimization}, 23605 journal = {SIAM Journal on Optimization}, 23606 year = {1996}, 23607 volume = {6}, 23608 pages = {513--530} 23609} 23610 23611@TechReport{ anitescu.lesaja.ea:infeasible-interior-point, 23612 author = {M. Anitescu and G. Lesaja and F. A. Potra}, 23613 title = {An infeasible--interior--point predictor--corrector algorithm for the 23614 {P}$_x$--geometric {LCP}}, 23615 institution = {Department of Mathematics, The University of Iowa}, 23616 address = {Iowa City, Iowa}, 23617 year = {1994}, 23618 number = {62}, 23619 type = {Reports on Computational Mathematics} 23620} 23621 23622@TechReport{ anitescu.potra:formulating, 23623 author = {M. Anitescu and F. A. Potra}, 23624 title = {Formulating Dynamic Multi-Rigid-Body Contact Problems with Friction as Solvable 23625 Linear Complementarity Problems}, 23626 institution = {Department of Mathematics, The University of Iowa}, 23627 year = {1996}, 23628 type = {Report}, 23629 number = {93}, 23630 address = {Iowa City, Iowa} 23631} 23632 23633@Article{ anstreicher.lee.ea:crashing, 23634 author = {K. M. Anstreicher and J. Lee and T. F. Rutherford}, 23635 title = {Crashing a Maximum-Weight Complementarity Basis}, 23636 journal = {Mathematical Programming}, 23637 year = {1992}, 23638 volume = {54}, 23639 pages = {281--294} 23640} 23641 23642@Article{ anstreicher:combined, 23643 author = {K. M. Anstreicher}, 23644 title = {A combined phase {I}--phase {II} scaled potential algorithm for linear 23645 programming}, 23646 journal = {Mathematical Programming}, 23647 year = {1991}, 23648 volume = {52}, 23649 pages = {429--440} 23650} 23651 23652@Article{ anstreicher:combined*1, 23653 author = {K. M. Anstreicher}, 23654 title = {A combined phase {I}--phase {II} projective algorithm for linear programming}, 23655 journal = {Mathematical Programming}, 23656 year = {1989}, 23657 volume = {43}, 23658 pages = {209--223} 23659} 23660 23661@InCollection{ arbenz.gander.ea:remote, 23662 author = {P. Arbenz and W. Gander and M. Oettli}, 23663 title = {The Remote Computational System}, 23664 booktitle = {High-Performance Computation and Networks}, 23665 publisher = {Springer-Verlag}, 23666 year = {1996}, 23667 volume = {1067}, 23668 series = {Lecture Notes in Computer Science}, 23669 pages = {662--667} 23670} 23671 23672@InCollection{ arcus:comsoal, 23673 author = {A. L. Arcus}, 23674 title = {{COMSOAL}: {A} Computer Method of Sequencing Operations for Assembly Lines}, 23675 booktitle = {Readings in Production and Operations Management}, 23676 year = {1966}, 23677 editor = {E. S. Buffa}, 23678 publisher = {John Wiley \& Sons}, 23679 address = {New York} 23680} 23681 23682@TechReport{ arioli.chan.ea:computing, 23683 author = {M. Arioli and T. F. Chan and I. S. Duff and N. I. M. Gould and J. K. Reid}, 23684 title = {Computing a Search Direction for Large-Scale Linearly-Constrained Nonlinear 23685 Optimization Calculations}, 23686 institution = {CERFACS}, 23687 year = {1993}, 23688 number = {TR/PA/93/34} 23689} 23690 23691@Article{ armijo:minimization, 23692 author = {L. Armijo}, 23693 title = {Minimization of Functions having {L}ipschitz-continuous First Partial 23694 Derivatives}, 23695 journal = {Pacific Journal of Mathematics}, 23696 year = {1966}, 23697 volume = {16}, 23698 pages = {1--3} 23699} 23700 23701@Article{ arrow.debreu:existence, 23702 author = {K. Arrow and G. Debreu}, 23703 title = {Existence of Equilibrium for a Competitive Economy}, 23704 journal = {Econometrica}, 23705 year = {1954}, 23706 volume = {22}, 23707 pages = {265--290} 23708} 23709 23710@InCollection{ arrow.solow:gradient, 23711 author = {K. J. Arrow and R. M. Solow}, 23712 title = {Gradient Methods for Constrained Maxima with Weakened Assumptions}, 23713 booktitle = {Studies in Linear and Nonlinear Programming}, 23714 year = {1958}, 23715 editor = {K. J. Arrow and L. Hurwicz and H. Uzawa}, 23716 publisher = {Stanford University Press}, 23717 address = {Stanford, California}, 23718 pages = {166--176} 23719} 23720 23721@Book{ aubin.ekeland:nonlinear, 23722 author = {J.-P. Aubin and I. Ekeland}, 23723 title = {Applied nonlinear analysis}, 23724 publisher = {John Wiley \& Sons}, 23725 address = {New York}, 23726 year = {1984} 23727} 23728 23729@Article{ auchmuty:variational, 23730 author = {G. Auchmuty}, 23731 title = {Variational Principles for Variational Inequalities}, 23732 journal = {Numerical Functional Analysis and Optimization}, 23733 year = {1989}, 23734 volume = {10}, 23735 pages = {863--874} 23736} 23737 23738@Book{ auerbach.kotlikoff:dynamic, 23739 author = {A. J. Auerbach and L. J. Kotlikoff}, 23740 title = {Dynamic Fiscal Policy}, 23741 publisher = {Cambridge University Press}, 23742 address = {Cambridge, England}, 23743 year = {1987} 23744} 23745 23746@InProceedings{ ault.deutsch.ea:interpolating, 23747 author = {D. A. Ault and F. R. Deutsch and P. D. Morris and J. E. Olson}, 23748 title = {Interpolating Subspaces in Approximation Theory}, 23749 booktitle = {Approximation Theory}, 23750 year = {1970}, 23751 editor = {A. Talbot}, 23752 publisher = {Academic Press}, 23753 address = {London} 23754} 23755 23756@Article{ auslender.crouzeix:global, 23757 author = {A. A. Auslender and J.--P. Crouzeix}, 23758 title = {Global Regularity Theorems}, 23759 journal = {Mathematics of Operations Research}, 23760 year = {1988}, 23761 volume = {13}, 23762 pages = {243--253} 23763} 23764 23765@Article{ auslender.haddou:interior-proximal, 23766 author = {A. Auslender and M. Haddou}, 23767 title = {An interior-proximal method for convex linearly constrained problems and its 23768 extension to variational inequalities}, 23769 year = {1995}, 23770 journal = {Mathematical Programming}, 23771 pages = {77--100}, 23772 volume = {71} 23773} 23774 23775@Article{ auslender:convergence, 23776 author = {A. Auslender}, 23777 title = {Convergence of stationary sequences for variational inequalities with maximal 23778 monotone operators}, 23779 journal = {Applied Mathematics and Optimization}, 23780 volume = {28}, 23781 year = {1993}, 23782 pages = {161--172} 23783} 23784 23785@Book{ auslender:optimization, 23786 author = {A. Auslender}, 23787 title = {Optimization {M}\'{e}thodes Num\'{e}riques}, 23788 year = {1976}, 23789 publisher = {Masson}, 23790 address = {Paris} 23791} 23792 23793@TechReport{ averick.carter.ea:minpack-2, 23794 author = {B. M. Averick and R. G. Carter and J. J. Mor\'e and G. -L. Xue}, 23795 title = {The {MINPACK-2} Test Problem Collection}, 23796 institution = {Argonne National Laboratory}, 23797 year = {1992}, 23798 address = {Argonne, Illinois}, 23799 number = {MCS-P153-0692} 23800} 23801 23802@TechReport{ axline.billups.ea:guidelines, 23803 author = {R. A. Axline and S. C. Billups and M. F. Grady}, 23804 title = {Guidelines for Software Security ({U})}, 23805 institution = {SNL}, 23806 year = {1989}, 23807 month = oct, 23808 address = {Albuquerque, New Mexico}, 23809 number = {SAND88-2955} 23810} 23811 23812@Article{ ayres.walter:greenhouse, 23813 author = {R. U. Ayres and J. Walter}, 23814 title = {The Greenhouse Effect: Damages, Costs and Abatement}, 23815 journal = {Environmental and Resource Economics}, 23816 year = {1991}, 23817 volume = {1}, 23818 pages = {237--270} 23819} 23820 23821@PhDThesis{ bagley:behaviour, 23822 author = {J. D. Bagley}, 23823 title = {The Behaviour of Adaptive Systems which employ Genetic and Correlation 23824 Algorithms}, 23825 year = {1967}, 23826 school = {University of Michigan} 23827} 23828 23829@Article{ bain.stewart:application, 23830 author = {R. S. Bain and W. E. Stewart}, 23831 title = {Application of Robust Nonmonotonic Descent Criteria to the Solution of Nonlinear 23832 Algebraic Equation Systems}, 23833 journal = {Computers in Chemical Engineering}, 23834 year = {1991}, 23835 volume = {15}, 23836 pages = {203--208} 23837} 23838 23839@Article{ baker.lasdon:successive, 23840 author = {T. E. Baker and L. S. Lasdon}, 23841 title = {Successive Linear Programming at {E}xxon}, 23842 journal = {Management Science}, 23843 year = {1985}, 23844 volume = {31}, 23845 pages = {264--274} 23846} 23847 23848@InProceedings{ baker:reducing, 23849 crossref = {grefenstette:genetic}, 23850 author = {J. E. Baker}, 23851 title = {Reducing Bias and Inefficiency in the Selection Algorithm}, 23852 pages = {14--21} 23853} 23854 23855@Article{ balas.zemel:algorithm, 23856 author = {E. Balas and E. Zemel}, 23857 title = {An Algorithm for Large Zero--One Knapsack Problems}, 23858 journal = {Operations Research}, 23859 year = {1980}, 23860 volume = {28}, 23861 pages = {1132--1154} 23862} 23863 23864@Book{ ballard.fullerton.ea:general, 23865 author = {C. Ballard and D. Fullerton and J. B. Shoven and J. Whalley}, 23866 title = {A General Equilibrium Model for Tax Policy Evaluation}, 23867 publisher = {The University of Chicago Press}, 23868 year = {1985}, 23869 series = {National Bureau of Economic Research Monograph} 23870} 23871 23872@InProceedings{ balog.angelos.ea:dose, 23873 author = {J. Balog and L. Angelos and T. R. Mackie and P. Reckwerdt}, 23874 title = {Dose Computation for a One-Dimensional Multileaf Collimator}, 23875 booktitle = {Proceedings of the XII International Conference on the Use of Computers in 23876 Radiation Therapy, Salt Lake City}, 23877 year = {1997}, 23878 editor = {D. D. Leavitt and G. Starkshall}, 23879 publisher = {Medical Physics Publishing}, 23880 address = {St. Louis, Missouri}, 23881 pages = {323--326} 23882} 23883 23884@Article{ baraff:fast, 23885 author = {D. Baraff}, 23886 title = {Fast contact force computation for nonpenetrating rigid bodies}, 23887 journal = {Computer Graphics (Proceedings SIGRAPH)}, 23888 year = {1994}, 23889 pages = {23--34}, 23890 volume = {28} 23891} 23892 23893@Article{ baraff:issues, 23894 author = {D. Baraff}, 23895 title = {Issues in computing contact forces for nonpenetrating rigid bodies}, 23896 journal = {Algorithmica}, 23897 volume = {10}, 23898 year = {1993}, 23899 pages = {292--352} 23900} 23901 23902@Book{ barrett.berry.ea:templates, 23903 title = {Templates for the Solution of Linear Systems: Building Blocks for Iterative 23904 Methods}, 23905 author = {R. Barrett and M. Berry and T. F. Chan and J. Demmel and J. Donato and J. 23906 Dongarra and V. Eijkhout and R. Pozo and C. Romine and H. van der Vorst}, 23907 year = {1994}, 23908 publisher = {SIAM}, 23909 address = {Philadelphia, Pennsylvania} 23910} 23911 23912@Article{ bard:algorithm, 23913 author = {J. F. Bard}, 23914 title = {An Algorithm for Solving the General Bi--Level Programming Problem}, 23915 journal = {Mathematics of Operations Research}, 23916 year = {1983}, 23917 volume = {8}, 23918 pages = {260--272} 23919} 23920 23921@Article{ bard:convex, 23922 author = {J. F. Bard}, 23923 title = {Convex Two-Level Optimization}, 23924 journal = {Mathematical Programming}, 23925 year = {1988}, 23926 volume = {40}, 23927 pages = {15--27} 23928} 23929 23930@InCollection{ bard:eclectic, 23931 author = {Y. Bard}, 23932 title = {An Eclectic Approach to Nonlinear Programming}, 23933 booktitle = {Optimization}, 23934 publisher = {University of Queensland Press}, 23935 editor = {R. S. Anderson and L. S. Jennings and D. M. Ryan}, 23936 year = {1972}, 23937 address = {St. Lucia, Queensland, Australia}, 23938 pages = {116--128} 23939} 23940 23941@Article{ barnes:variation, 23942 author = {E. R. Barnes}, 23943 title = {A Variation on {K}armarkar's Algorithm for Solving Linear Programming Problems}, 23944 journal = {Mathematical Programming}, 23945 year = {1986}, 23946 volume = {36}, 23947 pages = {174--182} 23948} 23949 23950@Article{ bartels.golub:simplex, 23951 author = {R. H. Bartels and G. H. Golub}, 23952 title = {The Simplex Method of Linear Programming using {LU} Decomposition}, 23953 journal = {Communications of the Asociation for Computing Machinery}, 23954 year = {1969}, 23955 volume = {12}, 23956 pages = {266--268} 23957} 23958 23959@Article{ barton.ivey:nelder, 23960 author = {R. Barton and J. S. Ivey}, 23961 title = {{N}elder {M}ead Simplex Modifications for Simulation Optimization}, 23962 journal = {Management Science}, 23963 year = {1996}, 23964 volume = {42}, 23965 number = {7}, 23966 pages = {954--973} 23967} 23968 23969@Article{ battiti:first-, 23970 author = {R. Battiti}, 23971 title = {First- and Second-Order Methods for Learning: Between Steepest Descent and 23972 {N}ewton's Method}, 23973 journal = {Neural Computation}, 23974 year = {1992}, 23975 volume = {4}, 23976 pages = {141--166} 23977} 23978 23979@Article{ baudet:asynchronous, 23980 author = {G. M. Baudet}, 23981 title = {Asynchronous iterative methods for multiprocesors}, 23982 journal = {Journal of the Association for Computing Machinery}, 23983 year = {1978}, 23984 volume = {25}, 23985 pages = {226--244} 23986} 23987 23988@InProceedings{ baum.haussler:what, 23989 author = {E. B. Baum and D. Haussler}, 23990 title = {What Size Net Gives Valid Generalization}, 23991 booktitle = {Advances in Neural Information Processing Systems I}, 23992 year = {1989}, 23993 editor = {D. S. Touretzky}, 23994 publisher = {Morgan Kaufmann}, 23995 address = {San Mateo, California}, 23996 pages = {81--90} 23997} 23998 23999@Misc{ baum:private, 24000 author = {E. B. Baum}, 24001 title = {Private Communication}, 24002 year = {1992}, 24003 address = {NEC Research Institute, Princeton, New Jersey} 24004} 24005 24006@Book{ bazaraa.sherali.ea:nonlinear, 24007 author = {M. S. Bazaraa and H. D. Sherali and C. M. Shetty}, 24008 title = {Nonlinear Programming}, 24009 edition = {Second}, 24010 publisher = {John Wiley and Sons}, 24011 address = {New York}, 24012 year = {1993} 24013} 24014 24015@Book{ bazaraa.shetty:nonlinear, 24016 author = {M. S. Bazaraa and C. M. Shetty}, 24017 title = {Nonlinear Programming: Theory and Algorithms}, 24018 publisher = {John Wiley \& Sons}, 24019 year = {1979}, 24020 address = {New York, New York} 24021} 24022 24023@Article{ beale:cycling, 24024 author = {E. M. L. Beale}, 24025 title = {Cycling in the Dual Simplex Method}, 24026 journal = {Naval Research Logistics Quarterly}, 24027 year = {1955}, 24028 volume = {2}, 24029 pages = {103--107} 24030} 24031 24032@InProceedings{ becker.cun:improving, 24033 author = {S. Becker and Y. le Cun}, 24034 title = {Improving the Convergence of Backpropagation Learning with Second Order Methods}, 24035 booktitle = {Proceedings of 1988 Connectionist Models Summer School}, 24036 year = {1988}, 24037 editor = {D. S. Touretzky}, 24038 publisher = {Morgan Kaufmann}, 24039 address = {San Mateo, California}, 24040 pages = {29--37} 24041} 24042 24043@Book{ ben-israel.ben-tal.ea:optimality, 24044 author = {A. Ben--Israel and A. Ben--Tal and S. Zlobec}, 24045 title = {Optimality in Nonlinear Programming: {A} Feasible Directions Approach}, 24046 year = {1981}, 24047 publisher = {John Wiley \& Sons}, 24048 address = {New York} 24049} 24050 24051@Article{ ben-israel:newton-raphson, 24052 author = {A. Ben--Israel}, 24053 title = {A {N}ewton--{R}aphson Method for the Solution of Systems of Equations}, 24054 journal = {Journal of Mathematical Analysis and its Applications}, 24055 year = {1966}, 24056 volume = {15}, 24057 pages = {243--252} 24058} 24059 24060@Article{ ben-tal.melman.ea:curved, 24061 author = {A. Ben--Tal and A. Melman and J. Zowe}, 24062 title = {Curved Search Methods for Unconstrained Optimization}, 24063 journal = {Optimization}, 24064 year = {1990}, 24065 volume = {21}, 24066 pages = {669--695}, 24067 publisher = {John Wiley \& Sons}, 24068 address = {New York} 24069} 24070 24071@InProceedings{ bennett.ferris.ea:genetic, 24072 crossref = {belew.booker:fourth}, 24073 author = {K. Bennett and M. C. Ferris and Y. E. Ioannidis}, 24074 title = {A Genetic Algorithm for Database Query Optimization}, 24075 pages = {400--407}, 24076 url = {ftp: //ftp.cs.wisc.edu/tech-reports/reports/1991/tr1004.ps}, 24077 key = {19} 24078} 24079 24080@Article{ bennett.mangasarian:bilinear, 24081 author = {K. P. Bennett and O. L. Mangasarian}, 24082 title = {Bilinear Separation of Two Sets in n-Space}, 24083 journal = {Computational Optimization and Applications}, 24084 year = {1993}, 24085 volume = {2}, 24086 pages = {207--227} 24087} 24088 24089@Article{ bennett.mangasarian:multicategory, 24090 author = {K. P. Bennett and O. L. Mangasarian}, 24091 title = {Multicategory Separation via Linear Programming}, 24092 journal = {Optimization Methods and Software}, 24093 year = {1993}, 24094 volume = {3}, 24095 pages = {27--39} 24096} 24097 24098@InProceedings{ bennett.mangasarian:neural, 24099 author = {K. P. Bennett and O. L. Mangasarian}, 24100 title = {Neural Network Training via Linear Programming}, 24101 booktitle = {Advances in Optimization and Parallel Computing}, 24102 year = {1992}, 24103 editor = {P. M. Pardalos}, 24104 publisher = {North Holland}, 24105 address = {Amsterdam}, 24106 pages = {56--67} 24107} 24108 24109@Article{ bennett.mangasarian:robust, 24110 author = {K. P. Bennett and O. L. Mangasarian}, 24111 title = {Robust Linear Programming Discrimination of Two Linearly Inseparable Sets}, 24112 journal = {Optimization Methods and Software}, 24113 year = {1992}, 24114 volume = {1}, 24115 pages = {23--34} 24116} 24117 24118@Article{ bennett.mangasarian:serial, 24119 author = {K. P. Bennett and O. L. Mangasarian}, 24120 title = {Serial and Parallel Multicategory Separation}, 24121 journal = {SIAM Journal on Optimization}, 24122 year = {1994}, 24123 volume = {4}, 24124 pages = {722--734} 24125} 24126 24127@TechReport{ bennett.wu.ea:support, 24128 author = {K. P. Bennett and D. Wu and L. Auslender}, 24129 title = {On Support Vector Decision Trees for Database Marketing}, 24130 institution = {Department of Mathematical Sciences, Rensselaer Polytechnic Institute}, 24131 year = {1998}, 24132 optkey = {}, 24133 opttype = {RPI Math Report}, 24134 optnumber = {98-100}, 24135 optaddress = {Troy, New York}, 24136 optmonth = {}, 24137 optnote = {}, 24138 optannote = {} 24139} 24140 24141@InProceedings{ bennett:decision, 24142 author = {K. P. Bennett}, 24143 title = {Decision Tree Construction Via Linear Programming}, 24144 booktitle = {Proceedings of the 4th Midwest Artificial Intelligence and Cognitive Science 24145 Society Conference}, 24146 year = {1992}, 24147 editor = {M. Evans}, 24148 address = {Utica, Illinois}, 24149 pages = {97--101} 24150} 24151 24152@Book{ berge.ghouila-houri:programming, 24153 author = {C. Berge and A. Ghouila-Houri}, 24154 title = {Programming, Games and Transportation Networks}, 24155 year = {1965}, 24156 publisher = {John Wiley \& Sons}, 24157 address = {New York} 24158} 24159 24160@Book{ berge:topological, 24161 author = {C. Berge}, 24162 title = {Topological Spaces}, 24163 year = {1963}, 24164 publisher = {McMillan}, 24165 address = {New York} 24166} 24167 24168@TechReport{ berkelaar.jansen.ea:basis, 24169 author = {A. B. Berkelaar and B. Jansen and C. Roos and T. Terlaky}, 24170 title = {Basis and Tripartition Identification for Quadratic Programming and Linear 24171 Complementarity Problems}, 24172 institution = {Department of Econometrics and Operations Research}, 24173 year = {1996}, 24174 address = {Erasmus University, Rotterdam, The Netherlands} 24175} 24176 24177@Article{ bertsekas.baz:distributed, 24178 author = {D. P. Bertsekas and D. El Baz}, 24179 title = {Distributed Asynchronous Relaxation Methods for the Convex Network Flow Problem}, 24180 journal = {SIAM Journal on Control and Optimization}, 24181 year = {1987}, 24182 volume = {25}, 24183 pages = {74--85} 24184} 24185 24186@Article{ bertsekas.gafni:projection, 24187 author = {D. P. Bertsekas and E. M. Gafni}, 24188 title = {Projection Methods for Variational Inequalities with Application to the Traffic 24189 Assignment Problem}, 24190 journal = {Mathematical Programming Study}, 24191 year = {1982}, 24192 volume = {17}, 24193 pages = {139--159} 24194} 24195 24196@Article{ bertsekas.hossein.ea:relaxation, 24197 author = {D. P. Bertsekas and P. Hossein and P. Tseng}, 24198 title = {Relaxation Methods for Network Flow Problems with Convex Arc Costs}, 24199 journal = {SIAM Journal on Control and Optimization}, 24200 year = {1987}, 24201 volume = {25}, 24202 pages = {1219--1243} 24203} 24204 24205@Unpublished{ bertsekas.tseng:partial, 24206 author = {D. P. Bertsekas and P. Tseng}, 24207 title = {Partial Proximal Minimization for Convex Programming}, 24208 year = {1991}, 24209 note = {Manuscript} 24210} 24211 24212@Article{ bertsekas.tsitsiklis:analysis, 24213 author = {D. P. Bertsekas and J. N. Tsitsiklis}, 24214 title = {An Analysis of Stochastic Shortest Path Problems}, 24215 journal = {Mathematics of Operations Research}, 24216 year = {1991}, 24217 volume = {16}, 24218 pages = {580--595} 24219} 24220 24221@Book{ bertsekas.tsitsiklis:parallel, 24222 author = {D. P. Bertsekas and J. N. Tsitsiklis}, 24223 title = {Parallel and Distributed Computation: Numerical Methods}, 24224 publisher = {Prentice-Hall, Inc}, 24225 year = {1989}, 24226 address = {Englewood Cliffs, New Jersey} 24227} 24228 24229@Book{ bertsekas:constrained, 24230 author = {D. P. Bertsekas}, 24231 title = {Constrained Optimization and Lagrange Multiplier Methods}, 24232 year = {1982}, 24233 publisher = {Academic Press}, 24234 address = {New York} 24235} 24236 24237@Book{ bertsekas:dynamic, 24238 author = {D. P. Bertsekas}, 24239 title = {Dynamic Programming and Optimal Control}, 24240 publisher = {Athena Scientific}, 24241 year = {1995}, 24242 address = {Belmont MA} 24243} 24244 24245@Article{ bertsekas:enlarging, 24246 author = {D. P. Bertsekas}, 24247 title = {Enlarging the Region of Convergence of {N}ewton's Method for Constrained 24248 Optimization}, 24249 journal = {Journal of Optimization Theory and Applications}, 24250 year = {1982}, 24251 volume = {36}, 24252 pages = {221--252} 24253} 24254 24255@Article{ bertsekas:goldstein-levitin-poljak, 24256 author = {D. P. Bertsekas}, 24257 title = {On the {G}oldstein-{L}evitin-{P}oljak Gradient Projection Algorithm}, 24258 journal = {IEEE Transactions on Automatic Control}, 24259 year = {1976}, 24260 volume = {AC-21}, 24261 pages = {174--184} 24262} 24263 24264@Article{ bertsekas:multiplier, 24265 author = {D. P. Bertsekas}, 24266 title = {Multiplier Methods: {A} Survey}, 24267 journal = {Automatica}, 24268 year = {1976}, 24269 volume = {12}, 24270 pages = {133--145} 24271} 24272 24273@Article{ bertsekas:necessary, 24274 author = {D. P. Bertsekas}, 24275 title = {Necessary and Sufficient Conditions for a Penalty Method to be Exact}, 24276 journal = {Mathematical Programming}, 24277 year = {1975}, 24278 volume = {9}, 24279 pages = {87--99} 24280} 24281 24282@Book{ bertsekas:nonlinear, 24283 author = {D. P. Bertsekas}, 24284 title = {Nonlinear Programming}, 24285 publisher = {Athena Scientific}, 24286 year = {1995}, 24287 address = {Belmont, Massachusetts} 24288} 24289 24290@Article{ bertsekas:projected, 24291 author = {Dimitri P. Bertsekas}, 24292 title = {Projected {N}ewton Methods for Optimization Problems with Simple Constraints}, 24293 journal = {SIAM Journal on Control and Optimization}, 24294 year = {1982}, 24295 volume = {20}, 24296 pages = {221--246} 24297} 24298 24299@Article{ billups.dirkse.ea:comparison, 24300 author = {S. C. Billups and S. P. Dirkse and M. C. Ferris}, 24301 title = {A Comparison of Large Scale Mixed Complementarity Problem Solvers}, 24302 journal = {Computational Optimization and Applications}, 24303 year = {1997}, 24304 pages = {3--25}, 24305 volume = {7}, 24306 url = {ftp: //ftp.cs.wisc.edu/math-prog/tech-reports/95-16.ps}, 24307 key = {51} 24308} 24309 24310@Article{ billups.ferris:convergence, 24311 author = {S. C. Billups and M. C. Ferris}, 24312 title = {Convergence of an Infeasible Interior--Point Algorithm from Arbitrary Positive 24313 Starting Points}, 24314 journal = {SIAM Journal on Optimization}, 24315 year = {1996}, 24316 volume = {6}, 24317 pages = {316--325}, 24318 url = {ftp: //ftp.cs.wisc.edu/tech-reports/reports/1993/tr1180.ps}, 24319 key = {34} 24320} 24321 24322@TechReport{ billups.ferris:convergence*1, 24323 author = {S. C. Billups and M. C. Ferris}, 24324 title = {Convergence of Infeasible Interior--Point Algorithms from Arbitrary Starting 24325 Points}, 24326 institution = {Computer Sciences Department, University of Wisconsin}, 24327 year = {1993}, 24328 address = {Madison, Wisconsin}, 24329 number = {1180}, 24330 note = {Revised version in SIAM Journal on Optimization.} 24331} 24332 24333@Article{ billups.ferris:qpcomp, 24334 author = {S. C. Billups and M. C. Ferris}, 24335 title = {{QPCOMP}: {A} Quadratic Program Based Solver for Mixed Complementarity Problems}, 24336 year = {1997}, 24337 journal = {Mathematical Programming}, 24338 pages = {533--562}, 24339 volume = {76}, 24340 url = {ftp: //ftp.cs.wisc.edu/math-prog/tech-reports/95-09.ps}, 24341 key = {47} 24342} 24343 24344@Article{ billups.ferris:solutions, 24345 author = {S. C. Billups and M. C. Ferris}, 24346 title = {Solutions to Affine Generalized Equations Using Proximal Mappings}, 24347 journal = {Mathematics of Operations Research}, 24348 volume = {24}, 24349 pages = {219--236}, 24350 year = {1999}, 24351 url = {ftp://ftp.cs.wisc.edu/math-prog/tech-reports/94-15.ps}, 24352 key = {42}, 24353 institution = {Computer Sciences Department, University of Wisconsin}, 24354 address = {Madison, Wisconsin}, 24355 type = {Mathematical Programming Technical Report}, 24356 number = {94--15} 24357} 24358 24359@TechReport{ billups.murata.ea:users, 24360 author = {S. C. Billups and K. K. Murata and K. E. Washington and D. L. Y. Louie}, 24361 title = {User's manual for {CONTAIN--HWR/0}, Rev. 1: {A} Computer Code for the Analysis of 24362 Heavy Water Nuclear Reactor Containments Under Accident Conditions}, 24363 institution = {SNL}, 24364 year = {1994}, 24365 month = jan, 24366 address = {Albuquerque, New Mexico}, 24367 number = {SAND91--1482} 24368} 24369 24370@TechReport{ billups.speight.ea:nonmonotone, 24371 author = {S. C. Billups and A. L. Speight and L. T. Watson}, 24372 title = {Nonmonotone Path Following Methods for Nonsmooth Equations and Complementarity 24373 Problems}, 24374 institution = {Department of Mathematics, University of Colorado}, 24375 year = {1999}, 24376 address = {Denver, Colorado} 24377} 24378 24379@PhDThesis{ billups:algorithms, 24380 author = {S. C. Billups}, 24381 title = {Algorithms for Complementarity Problems and Generalized Equations}, 24382 school = {University of Wisconsin--Madison}, 24383 year = {1995}, 24384 address = {Madison, Wisconsin}, 24385 month = aug 24386} 24387 24388@MastersThesis{ billups:augmented, 24389 author = {S. C. Billups}, 24390 title = {An Augmented Jacobian Matrix Algorithm for Tracking Homotopy Zero Curves}, 24391 school = {Virginia Tech}, 24392 year = {1985}, 24393 address = {Blacksburg, Virginia} 24394} 24395 24396@TechReport{ billups:homotopy, 24397 author = {S. C. Billups}, 24398 title = {A Homotopy Based Algorithm for Mixed Complementarity Problems}, 24399 institution = {Department of Mathematics, University of Colorado}, 24400 year = {1998}, 24401 address = {Denver, Colorado} 24402} 24403 24404@Article{ billups:improving, 24405 author = {S. C. Billups}, 24406 title = {Improving the Robustness of Descent-Based Methods for Semi-Smooth Equations Using 24407 Proximal Perturbations}, 24408 year = {2000}, 24409 journal = {Mathematical Programming}, 24410 volume = {87}, 24411 pages = {153--176} 24412} 24413 24414@Book{ birge.louveaux:introduction, 24415 author = {J. R. Birge and R. Louveaux}, 24416 title = {Introduction to Stochastic Programming}, 24417 publisher = {Springer}, 24418 address = {New York}, 24419 year = {1997} 24420} 24421 24422@TechReport{ bischof.carle.ea:adifor, 24423 author = {C. Bischof and A. Carle and P. Khademi and A. Mauer and P. Hovland}, 24424 title = {{ADIFOR} 2.0 User's Guide}, 24425 institution = {Argonne National Laboratory}, 24426 year = {1995}, 24427 address = {Argonne, Illinois}, 24428 number = {ANL/MCS--TM--192}, 24429 type = {Mathematics and Computer Science Division Report} 24430} 24431 24432@Book{ bisschop.entriken:aimms, 24433 author = {J. Bisschop and R. Entriken}, 24434 title = {{AIMMS} -- The Modeling System}, 24435 year = {1993}, 24436 publisher = {Paragon Decision Technology}, 24437 address = {Haarlem, The Netherlands} 24438} 24439 24440@Article{ bisschop.meeraus:development, 24441 author = {J. Bisschop and A. Meeraus}, 24442 title = {On the Development of a General Algebraic Modeling System in a Strategic Planning 24443 Environment}, 24444 journal = {Mathematical Programming Study}, 24445 year = {1982}, 24446 volume = {20}, 24447 pages = {1--29} 24448} 24449 24450@Misc{ bixby.ceria.ea:miplib, 24451 author = {R. E. Bixby and S. Ceria and C. M. McZeal and M. W. P. Savelsbergh}, 24452 title = {{MIPLIB} 3.0}, 24453 howpublished = {http://www.caam.rice.edu/\~bixby/miplib/miplib.html} 24454} 24455 24456@InProceedings{ bjorkman.klarbring.ea:sequential, 24457 author = {G. Bj{\"{o}}rkman and A. Klarbring and T. Larsson and M. R{\"{o}}nnqvist and B. 24458 Sj{\"{o}}din}, 24459 title = {Sequential quadratic programming for non-linear elastic contact problems}, 24460 editor = {J. Herskovits}, 24461 booktitle = {Structural Optimization 93, The World Congress on Optimal Design of Structural 24462 Systems}, 24463 volume = {2}, 24464 year = {1993}, 24465 pages = {301--308} 24466} 24467 24468@Article{ bjorkman:path, 24469 author = {G. Bj{\"o}rkman}, 24470 title = {Path Following and Critical Points for Contact Problems}, 24471 journal = {Computational Mechanics}, 24472 volume = {10}, 24473 pages = {231--246}, 24474 year = {1992} 24475} 24476 24477@Article{ bjorkman:solution, 24478 author = {G. Bj{\"o}rkman}, 24479 title = {The Solution of Large Displacement Frictionless Contact Problems using a Sequence 24480 of Linear Complementarity Problems}, 24481 journal = {International Journal for Numerical Methods in Engineering}, 24482 volume = {31}, 24483 pages = {1553--1566}, 24484 year = {1991} 24485} 24486 24487@Article{ bland:pivot, 24488 author = {R. G. Bland}, 24489 title = {New Pivot Rules for the Simplex Method}, 24490 journal = {Mathematics of Operations Research}, 24491 year = {1977}, 24492 volume = {2}, 24493 pages = {103--107} 24494} 24495 24496@Article{ block.levin:boundedness, 24497 author = {H. D. Block and S. A. Levin}, 24498 title = {On the Boundedness of an Iterative Procedure for Solving a System of Linear 24499 Inequalities}, 24500 journal = {Proceedings of the American Mathematical Society}, 24501 year = {1970}, 24502 volume = {26}, 24503 pages = {229--235} 24504} 24505 24506@Book{ bloomer:power, 24507 author = {J. Bloomer}, 24508 title = {Power Programming with {RPC}}, 24509 publisher = {O'Reilly and Associates, Inc.}, 24510 address = {Sebastopol, CA}, 24511 year = {1992} 24512} 24513 24514@InProceedings{ blum.rivest:training, 24515 author = {A. Blum and R. L. Rivest}, 24516 title = {Training a 3-Node Neural Network is {NP}-Complete}, 24517 booktitle = {Advances in Neural Information Processing Systems I}, 24518 year = {1989}, 24519 editor = {D. S. Touretzky}, 24520 publisher = {Morgan Kaufmann}, 24521 address = {San Mateo, California}, 24522 pages = {494--501} 24523} 24524 24525@InProceedings{ boehringer.ferris.ea:exemptions, 24526 author = {C. B{\"{o}}ehringer and M. C. Ferris and T. F. Rutherford}, 24527 title = {Exemptions, Grandfathered Permits and the Costs of Emission Restrictions: Results 24528 from a General Equilibrium Model for Six {EU} Countries}, 24529 key = {49}, 24530 booktitle = {Economic Aspects of Environmental Policy Making in a Federal System}, 24531 year = {1995} 24532} 24533 24534@Article{ boender.kan:bayesian, 24535 author = {C. G. E. Boender and A. H. G. Rinooy Kan}, 24536 title = {Bayesian Stopping Rules for Global Optimization}, 24537 journal = {Mathematical Programming}, 24538 year = {1987}, 24539 volume = {37}, 24540 pages = {59--80} 24541} 24542 24543@Article{ boggs:convergence, 24544 author = {P. T. Boggs}, 24545 title = {The Convergence of the {B}en--{I}srael Iteration for Nonlinear Least Squares 24546 Problems}, 24547 journal = {Mathematics of Computation}, 24548 year = {1976}, 24549 volume = {30}, 24550 pages = {512--522} 24551} 24552 24553@InProceedings{ bolzon.cochetti.ea:computing, 24554 author = {G. Bolzon and G. Cochetti and G. Maier and F. Tin-Loi}, 24555 title = {On computing all solutions in decohesion}, 24556 booktitle = {IUTAM (International Union of Theoretical and Applied Mechanics), 19th 24557 International Congress of Theoretical and Applied Mechanics}, 24558 year = {1996}, 24559 address = {Kyoto} 24560} 24561 24562@InProceedings{ bolzon.maier.ea:holonomic, 24563 author = {G. Bolzon and G. Maier and F. Tin-Loi}, 24564 title = {Holonomic and nonholonomic simulations of quasi-brittle fracture: a comparative 24565 study of mathematical programming approaches}, 24566 booktitle = {Fracture Mechanics of Concrete Structures}, 24567 editor = {F. H. Wittmann}, 24568 series = {Second International Conference on Fracture Mechanics of Concrete Structures 24569 (FRAMCOS 2)}, 24570 year = {1995}, 24571 publisher = {Aedificatio Publishers}, 24572 pages = {885--898} 24573} 24574 24575@InProceedings{ bolzon.maier.ea:holonomic*1, 24576 author = {G. Bolzon and G. Maier and F. Tin-Loi}, 24577 title = {On holonomic structural analysis as a complementarity problem}, 24578 booktitle = {APCOM96, Seoul}, 24579 year = {1996} 24580} 24581 24582@Article{ bolzon.maier.ea:multiplicity, 24583 author = {G. Bolzon and G. Maier and F. Tin-Loi}, 24584 title = {On the Multiplicity of Solutions in Quasi-Brittle Fracture Computations}, 24585 journal = {Computational Mechanics}, 24586 year = {1997}, 24587 volume = {19}, 24588 pages = {511--516} 24589} 24590 24591@Article{ bongartz.conn.ea:cute, 24592 author = {I. Bongartz and A. R. Conn and N. Gould and Ph. L. Toint}, 24593 title = {{CUTE}: Constrained and Unconstrained Testing Environment}, 24594 year = {1995}, 24595 journal = {{ACM} Transactions on Mathematical Software}, 24596 volume = {21}, 24597 pages = {123--160} 24598} 24599 24600@Article{ boppana:eigenvalues, 24601 author = {R. Boppana}, 24602 title = {Eigenvalues and Graph Bisection: An Average Case Analysis}, 24603 journal = {Proc. 28th Annual Symposium on Foundations of Computer Science}, 24604 pages = {280--285}, 24605 year = {1987} 24606} 24607 24608@Article{ bortfeld.kahler.ea:x-ray, 24609 author = {T. R. Bortfeld and D. L. Kahler and T. J. Waldron and A. L. Boyer}, 24610 title = {{X}-ray field compensation with multileaf collimators}, 24611 journal = {International Journal of Radiation Oncology, Biology and Physics}, 24612 year = {1994}, 24613 volume = {28}, 24614 number = {3}, 24615 pages = {723--730} 24616} 24617 24618@Article{ bortfeld.schlegel:optimization, 24619 author = {T. Bortfeld and W. Schlegel}, 24620 title = {Optimization of beam orientations in radiation therapy: some theoretical 24621 considerations}, 24622 journal = {Physics in Medicine and Biology}, 24623 year = {1993}, 24624 volume = {38}, 24625 number = {2}, 24626 pages = {291--304} 24627} 24628 24629@Article{ borwein:stability, 24630 author = {J. M. Borwein}, 24631 title = {Stability and regular points of inequality systems}, 24632 journal = {Journal of Optimization Theory and Applications}, 24633 year = {1986}, 24634 volume = {48}, 24635 pages = {9--52} 24636} 24637 24638@Article{ boyer:present, 24639 author = {A. L. Boyer}, 24640 title = {Present and Future Developments in Radiotherapy Treatment Units}, 24641 journal = {Seminars in Radiation Oncology}, 24642 year = {1995}, 24643 volume = {5}, 24644 number = {2}, 24645 pages = {146--155} 24646} 24647 24648@Article{ bracken.mcgill:mathematical, 24649 author = {J. Bracken and J. T. McGill}, 24650 title = {Mathematical programs with optimization problems in the constraints}, 24651 journal = {Operations Research}, 24652 volume = {21}, 24653 year = {1973}, 24654 pages = {37--44} 24655} 24656 24657@Article{ bradley.fayyad.ea:mathematical, 24658 author = {P. S. Bradley and U. M. Fayyad and O. L. Mangasarian}, 24659 title = {Mathematical Programming for Data Mining: Formulations and Challenges}, 24660 journal = {INFORMS Journal on Computing}, 24661 year = {1999}, 24662 volume = {11}, 24663 pages = {217--238} 24664} 24665 24666@TechReport{ bradley.mangasarian.ea:clustering, 24667 author = {P. S. Bradley and O. L. Mangasarian and W. N. Street}, 24668 title = {Clustering via Concave Minimization}, 24669 institution = {Computer Sciences Department, University of Wisconsin}, 24670 year = {1996}, 24671 type = {Mathematical Programming Technical Report}, 24672 number = {96-03}, 24673 address = {Madison, Wisconsin} 24674} 24675 24676@TechReport{ bradley.mangasarian.ea:feature, 24677 author = {P. S. Bradley and O. L. Mangasarian and W. N. Street}, 24678 title = {Feature Selection via Mathematical Programming}, 24679 institution = {Computer Sciences Department, University of Wisconsin}, 24680 year = {1995}, 24681 type = {Mathematical Programming Technical Report}, 24682 number = {95-21}, 24683 address = {Madison, Wisconsin} 24684} 24685 24686@Article{ bradley.mangasarian:massive, 24687 author = {P. S. Bradley and O. L. Mangasarian}, 24688 title = {Massive Data Discrimination via Linear Support Vector Machines}, 24689 year = {2000}, 24690 journal = {Optimization Methods and Software}, 24691 volume = {13}, 24692 pages = {1-10} 24693} 24694 24695@PhDThesis{ brady:condition, 24696 author = {L. Brady}, 24697 title = {Condition Constants for Solutions of Convex Inequalities}, 24698 year = {1988}, 24699 address = {Madison, Wisconsin}, 24700 school = {Computer Sciences Department, University of Wisconsin} 24701} 24702 24703@Article{ braess:uber, 24704 author = {D. Braess}, 24705 title = {{\"{U}}ber ein {P}aradoxon aus der {V}erkehrsplanung}, 24706 journal = {Unternehmensforschung}, 24707 year = {1968}, 24708 volume = {12}, 24709 pages = {258--268} 24710} 24711 24712@Article{ brahme:optimization, 24713 author = {A. Brahme}, 24714 title = {Optimization of Radiation Therapy and the Development of Multileaf Collimation}, 24715 journal = {International Journal of Radiation Oncology, Biology and Physics}, 24716 year = {1993}, 24717 volume = {25}, 24718 pages = {373--375} 24719} 24720 24721@Article{ brahme:stationary, 24722 author = {A. Brahme}, 24723 title = {Optimization of stationary and moving beam radiation therapy techniques}, 24724 journal = {Radiother. Oncol.}, 24725 year = {1988}, 24726 volume = {12}, 24727 pages = {129--140} 24728} 24729 24730@InCollection{ brahme:treatment, 24731 author = {A. Brahme}, 24732 title = {Treatment Optimization: Using Physical and Radiobiological Objective Functions}, 24733 booktitle = {Radiation Therapy Physics}, 24734 publisher = {Springer-Verlag}, 24735 year = {1995}, 24736 editor = {A. R. Smith}, 24737 address = {Berlin}, 24738 pages = {209--246} 24739} 24740 24741@TechReport{ branch:getting, 24742 author = {M. A. Branch}, 24743 title = {Getting {CUTE} with {M}atlab}, 24744 institution = {Cornell University}, 24745 year = {1994}, 24746 type = {Cornell Theory Center Report}, 24747 number = {CTC94TR194}, 24748 address = {Ithaca, New York} 24749} 24750 24751@Article{ brearley.mitra.ea:analysis, 24752 author = {A. Brearley and G. Mitra and H. Williams}, 24753 title = {Analysis of Mathematical Programming Problems Prior to Applying the Simplex 24754 Algorithm}, 24755 journal = {Mathematical Programming}, 24756 year = {1975}, 24757 volume = {8}, 24758 pages = {54--83} 24759} 24760 24761@Article{ bredensteiner.bennett:feature, 24762 author = {E. Bredensteiner and K. Bennett}, 24763 title = {Feature Minimization within Decision Trees}, 24764 journal = {Computational Optimization and Applications}, 24765 year = {1998}, 24766 volume = {10}, 24767 pages = {111--126} 24768} 24769 24770@Article{ bregman:relaxation, 24771 author = {L. M. Bregman}, 24772 title = {The Relaxation Method of Finding the Common Point of Convex Sets and its 24773 Application to the Solution of Problems in Convex Programming}, 24774 journal = {USSR Computational Mathematics and Mathematical Physics}, 24775 year = {1967}, 24776 volume = {7}, 24777 pages = {200--217} 24778} 24779 24780@Book{ brenner.hall:making, 24781 author = {D. J. Brenner and E. J. Hall}, 24782 title = {Making the Radiation Therapy Decision}, 24783 publisher = {Contemporary Books}, 24784 year = {1996}, 24785 address = {Chicago, IL} 24786} 24787 24788@Book{ brent:algorithms, 24789 author = {R. P. Brent}, 24790 title = {Algorithms for Minimization without Derivatives}, 24791 publisher = {Prentice-Hall, Inc}, 24792 year = {1973}, 24793 address = {Englewood Cliffs, New Jersey} 24794} 24795 24796@Article{ brewster.mohan.ea:three, 24797 author = {L. Brewster and R. Mohan and G. Mageras and C. Burman and S. Leibel and Z. Fuks}, 24798 title = {Three dimensional conformal treatment planning with multileaf collimators}, 24799 journal = {International Journal of Radiation Oncology, Biology and Physics}, 24800 year = {1995}, 24801 volume = {33}, 24802 number = {5}, 24803 pages = {1081--1089} 24804} 24805 24806@Article{ brezis.lions:produits, 24807 author = {H. Br\'{e}zis and P.--L. Lions}, 24808 title = {Produits Infinis de Resolvantes}, 24809 journal = {Israel Journal of Mathematics}, 24810 year = {1978}, 24811 volume = {29}, 24812 pages = {329--345} 24813} 24814 24815@Book{ brezis:operateurs, 24816 author = {H. Br\'{e}zis}, 24817 title = {Op\'{e}rateurs Maximaux Monotones et Semi-Groupes de Contractions dans les 24818 Espaces de Hilbert}, 24819 publisher = {North-Holland}, 24820 address = {Amsterdam}, 24821 year = {1973} 24822} 24823 24824@Book{ brooke.kendrick.ea:gams, 24825 author = {A. Brooke and D. Kendrick and A. Meeraus}, 24826 title = {{GAMS}: {A} User's Guide}, 24827 year = {1988}, 24828 publisher = {The Scientific Press}, 24829 address = {South San Francisco, CA} 24830} 24831 24832@Article{ brown.demarzo.ea:computing, 24833 author = {D. J. Brown and P. M. DeMarzo and B. C. Eaves}, 24834 title = {Computing Equilibria when Asset Markets Are Incomplete}, 24835 journal = {Econometrica}, 24836 year = {1996}, 24837 volume = {64}, 24838 pages = {1--28} 24839} 24840 24841@Article{ bruck:iterative, 24842 author = {R. E. Bruck}, 24843 title = {An Iterative Solution of a Variational Inequality for Certain Monotone Operators 24844 in {H}ilbert Space}, 24845 journal = {Bulletin of the American Mathematical Society}, 24846 year = {1975}, 24847 volume = {81}, 24848 pages = {890--892} 24849} 24850 24851@Article{ bunch.parlett:direct, 24852 author = {J. R. Bunch and B. N. Parlett}, 24853 title = {Direct Methods for Solving Symmetric Indefinite Systems of Linear Equations}, 24854 journal = {SIAM Journal on Numerical Analysis}, 24855 year = {1971}, 24856 volume = {8}, 24857 pages = {639--655} 24858} 24859 24860@Article{ burachik.iusem.ea:enlargement, 24861 author = {R. S. Burachik and A. N. Iusem and B. F. Svaiter}, 24862 title = {Enlargement of Monotone Operators with Applications to Variational Inequalities}, 24863 year = {1997}, 24864 journal = {Set-Valued Analysis, forthcoming} 24865} 24866 24867@TechReport{ burachik.iusem:generalized, 24868 author = {R. S. Burachik and A. N. Iusem}, 24869 title = {A Generalized Proximal Point Algorithm for the Nonlinear Complementarity 24870 Problem}, 24871 institution = {Instituto de Matem\'{a}tica Pura e Aplicada}, 24872 year = {1995}, 24873 type = {Working Paper}, 24874 address = {Rio de Janeiro} 24875} 24876 24877@Article{ burachik.iusem:generalized*1, 24878 author = {R. S. Burachik and A. N. Iusem}, 24879 title = {A Generalized Proximal Point Algorithm for the Variational Inequality Problem in 24880 {A} {H}ilbert Space}, 24881 year = {1998}, 24882 journal = {SIAM Journal on Optimization}, 24883 volume = {8}, 24884 pages = {197--216} 24885} 24886 24887@Article{ burdakov:globally, 24888 author = {O. P. Burdakov}, 24889 title = {Some Globally Convergent Modifications of {N}ewton's Method for Solving Systems 24890 of Nonlinear Equations}, 24891 journal = {Soviet Mathematics Doklady}, 24892 year = {1980}, 24893 volume = {22}, 24894 pages = {376--379} 24895} 24896 24897@Article{ burges:tutorial, 24898 author = {C. J. C. Burges}, 24899 title = {A Tutorial on Support Vector Machines for Pattern Recognition}, 24900 journal = {Data Mining and Knowledge Discovery}, 24901 volume = {2}, 24902 number = {2}, 24903 pages = {121-167}, 24904 year = {1998} 24905} 24906 24907@Article{ burke.ferris.ea:clarke, 24908 author = {J. V. Burke and M. C. Ferris and M. Qian}, 24909 title = {On the {C}larke Subdifferential of the Distance Function to a Closed Set}, 24910 journal = {Journal of Mathematical Analysis and its Applications}, 24911 year = {1992}, 24912 volume = {166}, 24913 pages = {199--213}, 24914 key = {16} 24915} 24916 24917@Unpublished{ burke.ferris.ea:least, 24918 author = {J. V. Burke and M. C. Ferris and L. Qi}, 24919 title = {A Least Squares Algorithm for Nonlinear Complementarity Problems}, 24920 year = {1994}, 24921 month = mar, 24922 note = {Manuscript}, 24923 key = {999} 24924} 24925 24926@Article{ burke.ferris:characterization, 24927 author = {J. V. Burke and M. C. Ferris}, 24928 title = {Characterization of Solution Sets of Convex Programs}, 24929 journal = {Operations Research Letters}, 24930 year = {1991}, 24931 volume = {10}, 24932 pages = {57--60}, 24933 key = {10} 24934} 24935 24936@Article{ burke.ferris:gauss-newton, 24937 author = {J. V. Burke and M. C. Ferris}, 24938 title = {A {G}auss--{N}ewton Method for Convex Composite Optimization}, 24939 journal = {Mathematical Programming}, 24940 year = {1995}, 24941 volume = {71}, 24942 pages = {179--194}, 24943 url = {ftp: //ftp.cs.wisc.edu/tech-reports/reports/1993/tr1176.ps}, 24944 key = {32} 24945} 24946 24947@Article{ burke.ferris:weak, 24948 author = {J. V. Burke and M. C. Ferris}, 24949 title = {Weak Sharp Minima in Mathematical Programming}, 24950 journal = {SIAM Journal on Control and Optimization}, 24951 year = {1993}, 24952 volume = {31}, 24953 pages = {1340--1359}, 24954 url = {ftp: //ftp.cs.wisc.edu/tech-reports/reports/1991/tr1050a.ps}, 24955 key = {23} 24956} 24957 24958@Article{ burke.more.ea:convergence, 24959 author = {J. V. Burke and J. J. Mor\'{e} and G. Toraldo}, 24960 title = {Convergence Properties of Trust Region Methods for Linear and Convex 24961 Constraints}, 24962 journal = {Mathematical Programming}, 24963 year = {1990}, 24964 volume = {47}, 24965 pages = {305--336} 24966} 24967 24968@Article{ burke.more:exposing, 24969 author = {J. V. Burke and J. J. Mor\'{e}}, 24970 title = {Exposing Constraints}, 24971 journal = {SIAM Journal on Optimization}, 24972 year = {1994}, 24973 volume = {4}, 24974 pages = {573--595} 24975} 24976 24977@Article{ burke.more:identification, 24978 author = {J. V. Burke and J. J. Mor\'{e}}, 24979 title = {On the Identification of Active Constraints}, 24980 journal = {SIAM Journal on Numerical Analysis}, 24981 year = {1988}, 24982 volume = {25}, 24983 pages = {1197--1211} 24984} 24985 24986@Article{ burke.poliquin:optimality, 24987 author = {J. V. Burke and R. A. Poliquin}, 24988 title = {Optimality Conditions for Non Finite--Valued Convex Composite Functions}, 24989 journal = {Mathematical Programming}, 24990 year = {1992}, 24991 volume = {57}, 24992 pages = {103--120} 24993} 24994 24995@Article{ burke.tseng:unified, 24996 author = {J. V. Burke and P. Tseng}, 24997 title = {A Unified Analysis of {H}offman's Bound via {F}enchel Duality}, 24998 journal = {SIAM Journal on Optimization}, 24999 year = {1996}, 25000 volume = {6}, 25001 pages = {265--282} 25002} 25003 25004@Article{ burke.xu:global, 25005 author = {J. V. Burke and S. Xu}, 25006 title = {The Global Linear Convergence of a Non-Interior Path-Following Algorithm for 25007 Linear Complementarity Problems}, 25008 year = {1998}, 25009 journal = {Mathematics of Operations Research}, 25010 volume = {23}, 25011 pages = {719--735} 25012} 25013 25014@TechReport{ burke:algorithms, 25015 author = {J. V. Burke}, 25016 title = {Algorithms for Solving Finite Dimensional Systems of Nonlinear Equations and 25017 Inequalities that have both Global and Quadratic Convergence Properties}, 25018 institution = {Argonne National Laboratory}, 25019 year = {1985}, 25020 address = {Argonne, Illinois}, 25021 number = {ANL/MCS--TM--54}, 25022 type = {Mathematics and Computer Science Division Report} 25023} 25024 25025@Article{ burke:descent, 25026 author = {J. V. Burke}, 25027 title = {Descent Methods for Composite Nondifferentiable Optimization Problems}, 25028 journal = {Mathematical Programming}, 25029 year = {1985}, 25030 volume = {33}, 25031 pages = {260--279} 25032} 25033 25034@Article{ burke:exact, 25035 author = {J. V. Burke}, 25036 title = {An Exact Penalization Viewpoint of Constrained Optimization}, 25037 journal = {SIAM Journal on Control and Optimization}, 25038 year = {1991}, 25039 volume = {29}, 25040 pages = {968--998} 25041} 25042 25043@Article{ burke:identification, 25044 author = {J. V. Burke}, 25045 title = {On the Identification of Active Constraints {II}: The Nonconvex Case}, 25046 journal = {SIAM Journal on Numerical Analysis}, 25047 year = {1990}, 25048 volume = {27}, 25049 pages = {1081--1102} 25050} 25051 25052@Article{ burke:robust, 25053 author = {J. V. Burke}, 25054 title = {A Robust Trust Region Method for Constrained Nonlinear Programming Problem}, 25055 journal = {SIAM Journal on Optimization}, 25056 year = {1992}, 25057 volume = {2}, 25058 pages = {325--347} 25059} 25060 25061@Article{ burke:second, 25062 author = {J. V. Burke}, 25063 title = {Second Order Necessary and Sufficient Conditions for Convex Composite {NDO}}, 25064 journal = {Mathematical Programming}, 25065 year = {1987}, 25066 volume = {38}, 25067 pages = {287--302} 25068} 25069 25070@Article{ burke:sequential, 25071 author = {J. V. Burke}, 25072 title = {A Sequential Quadratic Programming Method for Potentially Infeasible Mathematical 25073 Programs}, 25074 journal = {Journal of Mathematical Analysis and its Applications}, 25075 year = {1989}, 25076 volume = {139}, 25077 pages = {319--351} 25078} 25079 25080@Article{ burman.kutcher.ea:fitting, 25081 author = {C. Burman and G. J. Kutcher and B. Emami and M. Goitein}, 25082 title = {Fitting of Normal Tissue Tolerance Data to an Analytical Function}, 25083 journal = {International Journal of Radiation Oncology, Biology and Physics}, 25084 year = {1991}, 25085 optvolume = {21}, 25086 optpages = {123-135} 25087} 25088 25089@TechReport{ busovaca:handling, 25090 author = {S. Busovaca}, 25091 title = {Handling Degeneracy in a Nonlinear $\ell_1$ algorithm}, 25092 institution = {University of Waterloo}, 25093 year = {1985}, 25094 address = {Ontario}, 25095 number = {CS85 34}, 25096 type = {Technical Report} 25097} 25098 25099@Article{ butler.martin:method, 25100 author = {T. Butler and A. V. Martin}, 25101 title = {On a Method of {C}ourant for Minimizing Functionals}, 25102 journal = {Journal of Mathematical Physics}, 25103 year = {1962}, 25104 volume = {41}, 25105 pages = {291--299} 25106} 25107 25108@Article{ calamai.more:projected, 25109 author = {P. H. Calamai and J. J. Mor\'{e}}, 25110 title = {Projected Gradient Methods for Linearly Constrained Problems}, 25111 journal = {Mathematical Programming}, 25112 year = {1987}, 25113 volume = {39}, 25114 pages = {93--116} 25115} 25116 25117@Article{ cao.ferris:genetic, 25118 author = {M. Cao and M. C. Ferris}, 25119 title = {Genetic Algorithms in Optimization}, 25120 journal = {Journal of Undergraduate Mathematics and its Applications}, 25121 year = {1991}, 25122 volume = {12}, 25123 pages = {81--90}, 25124 key = {17} 25125} 25126 25127@Article{ cao.ferris:interior, 25128 author = {M. Cao and M. C. Ferris}, 25129 title = {An Interior Point Algorithm for Monotone Affine Variational Inequalities}, 25130 journal = {Journal of Optimization Theory and Applications}, 25131 year = {1994}, 25132 volume = {83}, 25133 pages = {269--283}, 25134 url = {ftp: //ftp.cs.wisc.edu/tech-reports/reports/1992/tr1101.ps}, 25135 key = {28} 25136} 25137 25138@Article{ cao.ferris:lineality, 25139 author = {M. Cao and M. C. Ferris}, 25140 title = {Lineality Removal for Copositive--Plus Normal Maps}, 25141 year = {1995}, 25142 volume = {2}, 25143 pages = {1--10}, 25144 journal = {Communications on Applied Nonlinear Analysis}, 25145 url = {ftp: //ftp.cs.wisc.edu/math-prog/tech-reports/94-02.ps}, 25146 key = {38} 25147} 25148 25149@Article{ cao.ferris:pc, 25150 author = {M. Cao and M. C. Ferris}, 25151 title = {{$P_C$} Matrices and the Linear Complementarity Problem}, 25152 journal = {Linear Algebra and Its Applications}, 25153 year = {1996}, 25154 volume = {246}, 25155 pages = {299--312}, 25156 url = {ftp: //ftp.cs.wisc.edu/math-prog/tech-reports/94-01.ps}, 25157 key = {37} 25158} 25159 25160@Article{ cao.ferris:pivotal, 25161 author = {M. Cao and M. C. Ferris}, 25162 title = {A Pivotal Method for Affine Variational Inequalities}, 25163 journal = {Mathematics of Operations Research}, 25164 year = {1996}, 25165 volume = {21}, 25166 pages = {44--64}, 25167 url = {ftp: //ftp.cs.wisc.edu/tech-reports/reports/1992/tr1114.ps}, 25168 key = {29} 25169} 25170 25171@PhDThesis{ cao:piecewise, 25172 author = {M. Cao}, 25173 title = {Piecewise Linear Homotopies and Affine Variational Inequalities}, 25174 school = {Computer Sciences Department, University of Wisconsin}, 25175 year = {1994}, 25176 address = {Madison, Wisconsin}, 25177 note = {Technical Report 1210} 25178} 25179 25180@Article{ caroe.schultz:dual, 25181 author = {C. C. Car{\o}e and R. Schultz}, 25182 title = {Dual Decomposition in Stochastic Integer Programming}, 25183 journal = {Operations Research Letters}, 25184 volume = {24}, 25185 pages = {37-45}, 25186 year = {1999} 25187} 25188 25189@Article{ carol.targovnik.ea:initial, 25190 author = {M. Carol and W. H. Grant and D. Pavord and P. Eddy and H. S. Targovnik and B. 25191 Butler and S. Woo and J. Figura and V. Onufrey and R. Grossman and R. Selkar}, 25192 title = {Initial clinical experience with the Peacock intensity modulation of a 3-{D} 25193 conformal radiation therapy system}, 25194 journal = {Stereotactic and Functional Neurosurgery}, 25195 year = {1996}, 25196 volume = {66}, 25197 pages = {30--34} 25198} 25199 25200@Article{ carolan.hill.ea:empirical, 25201 author = {W. J. Carolan and J. E. Hill and J. L. Kennington and S. Niemi and S. J. 25202 Wichmann}, 25203 title = {An Empirical Evaluation of the {KORBX} Algorithms for Military Airlift 25204 Applications}, 25205 journal = {Operations Research}, 25206 year = {1990}, 25207 volume = {38}, 25208 pages = {240--248} 25209} 25210 25211@Article{ carroll:created, 25212 author = {C. W. Carroll}, 25213 title = {The Created Response Surface Technique for Optimizing Nonlinear Restrained 25214 Systems}, 25215 journal = {Operations Research}, 25216 year = {1961}, 25217 volume = {9}, 25218 pages = {169--184} 25219} 25220 25221@PhDThesis{ carroll:operations, 25222 author = {C. W. Carroll}, 25223 title = {An Operations Research Approach to the Economic Optimization of a Kraft Pulping 25224 Process}, 25225 year = {1959}, 25226 address = {Appleton, Wisconsin}, 25227 school = {Institute of Paper Chemistry} 25228} 25229 25230@TechReport{ casanova.dongarra:netsolve, 25231 author = {H. Casanova and J. Dongarra}, 25232 title = {{N}et{S}olve: {A} Network Server for Solving Computational Science Problems}, 25233 institution = {University of Tennessee}, 25234 year = {1996}, 25235 type = {Technical Report} 25236} 25237 25238@TechReport{ cavalier.soyster:computational, 25239 author = {T. M. Cavalier and A. L. Soyster}, 25240 title = {Some Computational Experience and a Modification of the {K}armarkar Algorithm}, 25241 institution = {Pennsylvania State University}, 25242 year = {1985}, 25243 address = {Pennsylvania}, 25244 number = {85-105}, 25245 type = {ISME Working Paper} 25246} 25247 25248@TechReport{ censor.iusem.ea:interior-point, 25249 author = {Y. Censor and A. N. Iusem and S. A. Zenios}, 25250 title = {An Interior-Point Method with {B}regman Functions for the Variational Inequality 25251 Problem with Paramonotone Operators}, 25252 institution = {University of Haifa}, 25253 year = {1994}, 25254 type = {Working Paper} 25255} 25256 25257@Article{ censor.lent:iterative, 25258 author = {Y. Censor and A. Lent}, 25259 title = {An Iterative Row-Action Method for Interval Convex Programming}, 25260 journal = {Journal of Optimization Theory and Applications}, 25261 year = {1981}, 25262 volume = {34}, 25263 pages = {275--291} 25264} 25265 25266@InCollection{ censor.pierro.ea:iterative, 25267 author = {Y. Censor and A. R. {De~Pierro} and T. Elfving and G. T. Herman and A. N. Iusem}, 25268 title = {On Iterative Methods for Linearly Constrained Entropy Maximization}, 25269 booktitle = {Numerical Analysis and Mathematical Modeling, Banach Center Publication Volume 25270 XXIV}, 25271 publisher = {Banach Center}, 25272 year = {1987}, 25273 editor = {A. J. Wakulicz}, 25274 address = {Warsaw, Poland} 25275} 25276 25277@Article{ censor.segman:block-iterative, 25278 author = {Y. Censor and J. Segman}, 25279 title = {On Block-Iterative Entropy Maximization}, 25280 journal = {Journal of Information and Optimization Science}, 25281 year = {1987}, 25282 volume = {8}, 25283 pages = {275--291} 25284} 25285 25286@Article{ censor.zenios:proximal, 25287 author = {Y. Censor and S. A. Zenios}, 25288 title = {The Proximal Minimization Algorithm with ${D}$-functions}, 25289 journal = {Journal of Optimization Theory and Applications}, 25290 year = {1992}, 25291 volume = {73}, 25292 pages = {451--464} 25293} 25294 25295@Article{ censor:parallel, 25296 author = {Yair Censor}, 25297 title = {Parallel Application of Block-Iterative Methods in Medical Imaging and Radiation 25298 Therapy}, 25299 journal = {Mathematical Programming}, 25300 year = {1988}, 25301 volume = {42}, 25302 pages = {307--325} 25303} 25304 25305@Article{ censor:row-action, 25306 author = {Yair Censor}, 25307 title = {Row-action Methods for Huge and Sparse Systems and their Applications}, 25308 journal = {SIAM Review}, 25309 year = {1981}, 25310 volume = {23}, 25311 pages = {444--466} 25312} 25313 25314@Article{ chajakis.zenios:synchronous, 25315 author = {E. D. Chajakis and S. A. Zenios}, 25316 title = {Synchronous and Asynchronous Implementations of Relaxation Algorithms for 25317 Nonlinear Network Optimization}, 25318 journal = {Parallel Computing}, 25319 year = {1990}, 25320 note = {To appear} 25321} 25322 25323@Article{ chamberlain.powell.ea:watchdog, 25324 author = {R. M. Chamberlain and M. J. D. Powell and C. Lemar\'{e}chal}, 25325 title = {The Watchdog Technique for Forcing Convergence in Algorithms for Constrained 25326 Optimization}, 25327 journal = {Mathematical Programming Study}, 25328 year = {1982}, 25329 volume = {16}, 25330 pages = {1--17} 25331} 25332 25333@Article{ chan.pang:generalized, 25334 author = {D. Chan and J. S. Pang}, 25335 title = {The Generalized Quasi-Variational Inequality Problem}, 25336 journal = {Mathematics of Operations Research}, 25337 volume = {7}, 25338 pages = {211--222}, 25339 year = {1982} 25340} 25341 25342@Article{ charalambous:nonlinear, 25343 author = {C. Charalambous}, 25344 title = {Nonlinear Least p--th Optimization and Nonlinear Programming}, 25345 journal = {Mathematical Programming}, 25346 year = {1977}, 25347 volume = {12}, 25348 pages = {195--225} 25349} 25350 25351@Article{ charnes.cooper.ea:duality, 25352 author = {A. Charnes and W. W. Cooper and K. O. Kortanek}, 25353 title = {Duality, {H}aar Programs and Finite Sequence Spaces}, 25354 journal = {Proceedings of the National Academy of Sciences of the United States}, 25355 year = {1962}, 25356 pages = {783--786} 25357} 25358 25359@Book{ charnes.cooper.ea:introduction, 25360 author = {A. Charnes and W. W. Cooper and A. Henderson}, 25361 title = {An Introduction to Linear Programming}, 25362 year = {1953}, 25363 publisher = {John Wiley \& Sons}, 25364 address = {New York} 25365} 25366 25367@TechReport{ charnes.semple:practical, 25368 author = {A. Charnes and J. Semple}, 25369 title = {Practical Error Bounds for a Class of Quadratic Programming Problems}, 25370 institution = {CCS}, 25371 year = {1991}, 25372 address = {Austin, Texas}, 25373 number = {663}, 25374 type = {Research Report} 25375} 25376 25377@InProceedings{ charnes:fundamental, 25378 author = {A. Charnes}, 25379 title = {Some Fundamental Theorems of Perceptron Theory and Their Geometry}, 25380 booktitle = {Computer and Information Sciences}, 25381 year = {1964}, 25382 editor = {J. T. Lou and R. H. Wilcox}, 25383 publisher = {Spartan Books}, 25384 address = {Washington, D.C.}, 25385 pages = {67--74} 25386} 25387 25388@TechReport{ chen.chen.ea:penalized, 25389 author = {B. Chen and X. Chen and C. Kanzow}, 25390 title = {A Penalized {F}ischer-{B}urmeister {NCP}-Function: Theoretical Investigation and 25391 Numerical Results}, 25392 institution = {Institute of Applied Mathematics, University of Hamburg}, 25393 year = {1997}, 25394 type = {Preprint}, 25395 number = {126}, 25396 address = {Hamburg, Germany} 25397} 25398 25399@Article{ chen.chen:global, 25400 author = {B. Chen and X. Chen}, 25401 title = {A Global and Local Superlinear Continuation-Smoothing Method for ${P}_0$ + 25402 ${R}_0$ {NCP} or Monotone {NCP}}, 25403 journal = {SIAM Journal on Optimization}, 25404 year = {1999}, 25405 volume = {9}, 25406 pages = {624--645} 25407} 25408 25409@Article{ chen.ferris.ea:fatcop, 25410 author = {Q. Chen and M. C. Ferris and J. T. Linderoth}, 25411 title = {{FATCOP} 2.0: Advanced Features in an Opportunistic Mixed Integer Programming 25412 Solver}, 25413 journal = {Annals of Operations Research, forthcoming}, 25414 year = {2000}, 25415 url = {ftp://ftp.cs.wisc.edu/pub/dmi/tech-reports/99-11.ps}, 25416 key = {89}, 25417 type = {Data Mining Institute Technical Report}, 25418 institution = {Computer Sciences Department, University of Wisconsin}, 25419 address = {Madison, Wisconsin}, 25420 number = {99-11} 25421} 25422 25423@TechReport{ chen.ferris:fatcop, 25424 author = {Q. Chen and M. C. Ferris}, 25425 title = {{FATCOP}: {A} Fault Tolerant {C}ondor-{PVM} Mixed Integer Program Solver}, 25426 type = {Mathematical Programming Technical Report}, 25427 institution = {Computer Sciences Department, University of Wisconsin}, 25428 address = {Madison, Wisconsin}, 25429 year = {1999}, 25430 url = {ftp: //ftp.cs.wisc.edu/math-prog/tech-reports/99-05.ps}, 25431 number = {99-05}, 25432 key = {81}, 25433 annote = {Submitted to {\em SIOPT}} 25434} 25435 25436@Article{ chen.florian:nonlinear, 25437 author = {Y. Chen and M. Florian}, 25438 title = {The Nonlinear Bilevel Programming Problem: Formulations, Regularity, and 25439 Optimality Conditions}, 25440 journal = {Optimization}, 25441 year = {1995}, 25442 volume = {32}, 25443 pages = {193--209} 25444} 25445 25446@TechReport{ chen.florian:o-d, 25447 author = {Y. Chen and M. Florian}, 25448 title = {{O}-{D} demand adjustment problem with congestion: Part {I}. Model analysis and 25449 optimality conditions}, 25450 type = {Publication}, 25451 number = {CRT-94-56}, 25452 institution = {Centre de Recherche sur les Transports, Universit\'e de Montr\'eal}, 25453 address = {Montr\'eal, Canada}, 25454 year = {1994} 25455} 25456 25457@Article{ chen.harker:continuation, 25458 author = {B. Chen and P. T. Harker}, 25459 title = {A Continuation Method for Monotone Variational Inequalities}, 25460 journal = {Mathematical Programming}, 25461 volume = {69}, 25462 pages = {237--253}, 25463 year = {1995} 25464} 25465 25466@Article{ chen.harker:non-interior, 25467 author = {B. Chen and P. T. Harker}, 25468 title = {A Non-Interior-Point Continuation Method for Linear Complementarity Problems}, 25469 journal = {SIAM Journal on Matrix Analysis and Applications}, 25470 year = {1993}, 25471 volume = {14}, 25472 pages = {1168--1190} 25473} 25474 25475@Article{ chen.harker:smooth, 25476 author = {B. Chen and P. T. Harker}, 25477 title = {Smooth Approximations to Nonlinear Complementarity Problems}, 25478 journal = {SIAM Journal on Optimization}, 25479 year = {1997}, 25480 volume = {7}, 25481 pages = {403--420} 25482} 25483 25484@Article{ chen.mangasarian:class, 25485 author = {Chunhui Chen and O. L. Mangasarian}, 25486 title = {A Class of Smoothing Functions for Nonlinear and Mixed Complementarity Problems}, 25487 journal = {Computational Optimization and Applications}, 25488 year = {1996}, 25489 volume = {5}, 25490 pages = {97--138} 25491} 25492 25493@Article{ chen.mangasarian:smoothing, 25494 author = {Chunhui Chen and O. L. Mangasarian}, 25495 title = {Smoothing Methods for Convex Inequalities and Linear Complementarity Problems}, 25496 journal = {Mathematical Programming}, 25497 year = {1995}, 25498 volume = {78}, 25499 pages = {51--70} 25500} 25501 25502@Article{ chen.nashed.ea:convergence, 25503 author = {X. Chen and Z. Nashed and L. Qi}, 25504 title = {Convergence of {N}ewton's Method for Singular Smooth and Nonsmooth Equations 25505 using Adaptive Outer Inverses}, 25506 year = {1997}, 25507 journal = {SIAM Journal on Optimization}, 25508 volume = {7}, 25509 pages = {445--462} 25510} 25511 25512@Article{ chen.qi.ea:global, 25513 author = {X. Chen and L. Qi and D. Sun}, 25514 title = {Global and Superlinear Convergence of the Smoothing {N}ewton Method and its 25515 Application to General Box Constrained Variational Inequalities}, 25516 year = {1998}, 25517 journal = {Mathematics of Computation}, 25518 volume = {67}, 25519 pages = {519--540} 25520} 25521 25522@Article{ chen.teboulle:convergence, 25523 author = {G. Chen and M. Teboulle}, 25524 title = {A Convergence Analysis of Proximal-Like Minimization Algorithms Using {B}regman 25525 Functions}, 25526 journal = {SIAM Journal on Optimization}, 25527 year = {1993}, 25528 volume = {3}, 25529 pages = {538--543} 25530} 25531 25532@Article{ chen.ye:homotopy-smoothing, 25533 author = {X.~Chen and Y.~Ye}, 25534 title = {On Homotopy-Smoothing Methods for Variational Inequalities}, 25535 year = {1999}, 25536 journal = {SIAM Journal on Control and Optimization}, 25537 volume = {37}, 25538 pages = {589--616} 25539} 25540 25541@PhDThesis{ chen:forward-backward, 25542 author = {G. H.--G. Chen}, 25543 title = {Forward--Backward Splitting Techniques: Theory and Applications}, 25544 school = {University of Washington}, 25545 year = {1994} 25546} 25547 25548@PhDThesis{ chen:smoothing, 25549 author = {Chunhui Chen}, 25550 title = {Smoothing Methods in Mathematical Programming}, 25551 school = {Computer Sciences Department, University of Wisconsin}, 25552 year = {1995}, 25553 address = {Madison, Wisconsin}, 25554 note = {Available from ftp://ftp.cs.wisc.edu/math-prog/tech-reports/}, 25555 annote = {Mathematical Programming Technical Report 95-12} 25556} 25557 25558@Book{ cheney:introduction, 25559 author = {E. W. Cheney}, 25560 title = {Introduction to Approximation Theory}, 25561 year = {1966}, 25562 publisher = {McGraw--Hill}, 25563 address = {New York} 25564} 25565 25566@Article{ cho.kuterdem.ea:spherical, 25567 author = {P. S. Cho and H. G. Kuterdem and R. J. Marks}, 25568 title = {A spherical dose model for radiosurgery treatment planning}, 25569 journal = {Physics in Medicine and Biology}, 25570 year = {1998}, 25571 volume = {43}, 25572 pages = {3145--3148} 25573} 25574 25575@Article{ cho.lee.ea:optimization, 25576 author = {P. S. Cho and S. Lee and R. J. Marks and S. Oh and S. Sutlief and H. Phillips}, 25577 title = {Optimization of intensity modulated beams with volume constraints using two 25578 methods: cost function minimization and projection onto convex sets}, 25579 journal = {Medical Physics}, 25580 year = {1998}, 25581 volume = {25}, 25582 number = {4}, 25583 pages = {435--443} 25584} 25585 25586@Article{ choi.desarbo.ea:product, 25587 author = {S. C. Choi and W. S. DeSarbo and P. T. Harker}, 25588 title = {Product Positioning Under Price Competition}, 25589 journal = {Management Science}, 25590 year = {1990}, 25591 volume = {36}, 25592 pages = {175--199} 25593} 25594 25595@Article{ chow.mallet-parret.ea:finding, 25596 author = {S. N. Chow and J. Mallet--Parret and J. A. Yorke}, 25597 title = {Finding Zeroes of Maps: Homotopy Methods that are Constructive with Probability 25598 One}, 25599 journal = {Mathematics of Computing}, 25600 year = {1978}, 25601 volume = {32}, 25602 pages = {887--899} 25603} 25604 25605@Article{ christopherson:mathematical, 25606 author = {D. G. Christopherson}, 25607 title = {A new mathematical method for the solution of film lubrication problems}, 25608 journal = {Proceedings of the Institute of Mechanical Engineers}, 25609 volume = {146}, 25610 year = {1941}, 25611 pages = {126--135} 25612} 25613 25614@TechReport{ chun.lee.ea:implementation, 25615 author = {B. J. Chun and S. J. Lee and S. M. Robinson}, 25616 title = {An Implementation of the Bundle Decomposition Algorithm}, 25617 institution = {Department of Industrial Engineering, University of Wisconsin}, 25618 year = {1991}, 25619 address = {Madison, Wisconsin}, 25620 number = {91-6} 25621} 25622 25623@Article{ chung:np-completeness, 25624 author = {S.--J. Chung}, 25625 title = {{NP}-Completeness of the Linear Complementarity Problem}, 25626 journal = {Journal of Optimization Theory and Applications}, 25627 volume = {60}, 25628 year = {1989}, 25629 pages = {393--399} 25630} 25631 25632@Book{ chvatal:linear, 25633 author = {V. Chv\'atal}, 25634 title = {Linear Programming}, 25635 year = {1983}, 25636 publisher = {W. H. Freeman and Company}, 25637 address = {New York} 25638} 25639 25640@Book{ ciarlet:finite, 25641 author = {P. G. Ciarlet}, 25642 title = {The Finite Element Method for Elliptic Problems}, 25643 year = {1978}, 25644 publisher = {North-Holland}, 25645 address = {New York} 25646} 25647 25648@Article{ cinquini.contro:optimal, 25649 author = {C. Cinquini and R. Contro}, 25650 title = {Optimal design of beams discretized by elastic plastic finite element}, 25651 journal = {Computers \& Structures}, 25652 volume = {20}, 25653 year = {1985}, 25654 pages = {475--585} 25655} 25656 25657@Book{ clarke:optimization, 25658 author = {F. H. Clarke}, 25659 title = {Optimization and Nonsmooth Analysis}, 25660 year = {1983}, 25661 publisher = {John Wiley \& Sons}, 25662 address = {New York} 25663} 25664 25665@InProceedings{ cleveland.smith:genetic, 25666 crossref = {schaeffer:third}, 25667 author = {G. A. Cleveland and S. F. Smith}, 25668 title = {Using Genetic Algorithms to Schedule Flow Shop Releases}, 25669 pages = {160--169} 25670} 25671 25672@Book{ cochran:sampling, 25673 author = {W. Cochran}, 25674 title = {Sampling Techniques}, 25675 publisher = {Wiley}, 25676 year = {1977}, 25677 address = {New York}, 25678 edition = {Third} 25679} 25680 25681@Article{ coleman.conn:nonlinear, 25682 author = {T. F. Coleman and A. R. Conn}, 25683 title = {Nonlinear Programming via an Exact Penalty Function Method: Asymptotic Analysis}, 25684 journal = {Mathematical Programming}, 25685 year = {1982}, 25686 volume = {24}, 25687 pages = {123--136} 25688} 25689 25690@Article{ coleman.conn:nonlinear*1, 25691 author = {T. F. Coleman and A. R. Conn}, 25692 title = {Nonlinear Programming via an Exact Penalty Function Method: Global Analysis}, 25693 journal = {Mathematical Programming}, 25694 year = {1982}, 25695 volume = {24}, 25696 pages = {137--161} 25697} 25698 25699@TechReport{ coleman.liu:interior, 25700 author = {T. F. Coleman and J. Liu}, 25701 title = {An interior newton method for quadratic programming}, 25702 institution = {Dept. of Computer Science, Cornell University}, 25703 year = {1993}, 25704 number = {TR 93-1388}, 25705 address = {Ithaca, NY}, 25706 month = oct 25707} 25708 25709@Article{ coleman.more:estimation, 25710 author = {T. F. Coleman and J. J. Mor\'{e}}, 25711 title = {Estimation of Sparse {J}acobian Matrices and Graph Coloring Problems}, 25712 journal = {SIAM Journal on Numerical Analysis}, 25713 year = {1983}, 25714 volume = {20}, 25715 pages = {187--209} 25716} 25717 25718@Manual{ coleman.verma:admat, 25719 author = {T. F. Coleman and A. Verma}, 25720 title = {{ADMAT} User Guide}, 25721 year = {2000} 25722} 25723 25724@TechReport{ colville:comparative, 25725 author = {A. R. Colville}, 25726 title = {A Comparative Study on Nonlinear Programming Codes}, 25727 institution = {IBM New York Scientific Center}, 25728 year = {1968}, 25729 month = jun, 25730 number = {320--2949}, 25731 type = {Technical Report} 25732} 25733 25734@Article{ comi.maier:extremum, 25735 author = {C. Comi and G. Maier}, 25736 title = {Extremum Theorem and Convergence Criterion for an Iterative Solution to the 25737 Finite-Step Problem in Elastoplasticity with Mixed Nonlinear Hardening}, 25738 journal = {European Journal Mechanics A/Solids}, 25739 volume = {9}, 25740 year = {1990}, 25741 pages = {563--585} 25742} 25743 25744@Misc{ condon.dahl.ea:implementing, 25745 author = {T. Condon and H. Dahl and S. Devarajan}, 25746 title = {Implementing a Computable General Equilibrium Model on {GAMS} -- The {C}ameroon 25747 Model}, 25748 year = {1987}, 25749 howpublished = {{DRD} Discussion Paper 290}, 25750 note = {The World Bank, Washington DC} 25751} 25752 25753@Book{ conn.gould.ea:lancelot, 25754 author = {A. R. Conn and N. I. M. Gould and Ph. L. Toint}, 25755 title = {{LANCELOT}: {A} {F}ortran package for Large--Scale Nonlinear Optimization 25756 (Release {A})}, 25757 year = {1992}, 25758 publisher = {Springer Verlag}, 25759 address = {Heidelberg, Berlin}, 25760 series = {Springer Series in Computational Mathematics}, 25761 number = {17} 25762} 25763 25764@Article{ conn.gould.ea:numerical, 25765 author = {A. R. Conn and N. I. M. Gould and Ph. L. Toint}, 25766 title = {Numerical Experiments with the {LANCELOT} Package (Release {A}) for Large-Scale 25767 Nonlinear Optimization}, 25768 journal = {Mathematical Programming}, 25769 year = {1996}, 25770 volume = {75}, 25771 pages = {73--110} 25772} 25773 25774@Book{ cgt, 25775 author = {A. R. Conn and N. I. M. Gould and Ph. L. Toint}, 25776 title = {Trust-Region Methods}, 25777 year = {2000}, 25778 publisher = {SIAM}, 25779 address = {Philadelphia, Pennsylvania} 25780} 25781 25782@InCollection{ conn.toint:algorithm, 25783 author = {A. R. Conn and Ph. L. Toint}, 25784 title = {An Algorithm using Quadratic Interpolation for Unconstrained Derivative Free 25785 Optimization}, 25786 booktitle = {Nonlinear Optimization and Applications}, 25787 editor = {G. Di Pillo and F. Giannessi}, 25788 year = {1996}, 25789 publisher = {Plenum Press}, 25790 address = {New York} 25791} 25792 25793@Article{ conry.seireg:mathematical, 25794 author = {T. F. Conry and A. Seireg}, 25795 title = {A Mathematical Programming Method for Design for Elastic Bodies in Contact}, 25796 journal = {{ASME} Transactions Journal of Applied Mechanics}, 25797 volume = {93}, 25798 year = {1971}, 25799 pages = {387--392} 25800} 25801 25802@Article{ cook.gerards.ea:sensitivity, 25803 author = {W. Cook and A. M. H. Gerards and A. Schrijver and \'{E}. Tardos}, 25804 title = {Sensitivity Results in Integer Linear Programming}, 25805 journal = {Mathematical Programming}, 25806 year = {1986}, 25807 volume = {34}, 25808 pages = {251--264} 25809} 25810 25811@Article{ cook:taxonomy, 25812 author = {S. A. Cook}, 25813 title = {A Taxonomy of Problems with Fast Parallel Algorithms}, 25814 journal = {Information and Control}, 25815 year = {1985}, 25816 volume = {64}, 25817 pages = {2--22} 25818} 25819 25820@Article{ cooper:gradient, 25821 author = {R. E. M. Cooper}, 25822 title = {A gradient method of optimizing external-beam radiotherapy treatment plans}, 25823 journal = {Radiology}, 25824 year = {1978}, 25825 volume = {128}, 25826 pages = {235--243} 25827} 25828 25829@Article{ cormack:problem, 25830 author = {A. M. Cormack}, 25831 title = {A problem in roatation therapy with x-rays}, 25832 journal = {International Journal of Radiation Oncology, Biology and Physics}, 25833 year = {1987}, 25834 volume = {13}, 25835 pages = {623--630} 25836} 25837 25838@Article{ cormack:problem*1, 25839 author = {A. M. Cormack}, 25840 title = {A problem in roatation therapy with x-rays2: dose distributions with an axis of 25841 symmetry}, 25842 journal = {International Journal of Radiation Oncology, Biology and Physics}, 25843 year = {1987}, 25844 volume = {13}, 25845 pages = {1921--1925} 25846} 25847 25848@Article{ cottle.dantzig:complementary, 25849 author = {R. W. Cottle and G. B. Dantzig}, 25850 title = {Complementary Pivot Theory of Mathematical Programming}, 25851 journal = {Linear Algebra and Its Applications}, 25852 year = {1968}, 25853 volume = {1}, 25854 pages = {103--125} 25855} 25856 25857@Article{ cottle.dantzig:generalization, 25858 author = {R. W. Cottle and G. B. Dantzig}, 25859 title = {A Generalization of the Linear Complementarity Problem}, 25860 journal = {Journal of Combinatorial Theory}, 25861 year = {1970}, 25862 volume = {8}, 25863 pages = {79--90} 25864} 25865 25866@Book{ cottle.giannessi.ea:variational, 25867 author = {R. W. Cottle and F. Giannessi and J.--L. Lions}, 25868 title = {Variational Inequalities and Complementarity Problems: Theory and Applications}, 25869 year = {1980}, 25870 publisher = {John Wiley \& Sons}, 25871 address = {New York} 25872} 25873 25874@InCollection{ cottle.goheen:special, 25875 author = {R. W. Cottle and M. S. Goheen}, 25876 title = {A Special Class of Large Quadratic Programs}, 25877 pages = {361--390}, 25878 crossref = {mangasarian.meyer.ea:nonlinear*3} 25879} 25880 25881@Article{ cottle.golub.ea:solution, 25882 author = {R. W. Cottle and G. H. Golub and R. S. Sacher}, 25883 title = {On the Solution of Large Structured Complementarity Problems: The Block 25884 Partitioned Case}, 25885 journal = {Applied Mathematics and Optimization}, 25886 year = {1978}, 25887 volume = {4}, 25888 pages = {347--363} 25889} 25890 25891@Book{ cottle.pang.ea:linear, 25892 author = {R. W. Cottle and J. S. Pang and R. E. Stone}, 25893 title = {The Linear Complementarity Problem}, 25894 year = {1992}, 25895 publisher = {Academic Press}, 25896 address = {Boston} 25897} 25898 25899@Article{ cottle.pang.ea:sufficient, 25900 author = {R. W. Cottle and J. S. Pang and V. Venkateswaran}, 25901 title = {Sufficient Matrices and the Linear Complementarity Problem}, 25902 journal = {Linear Algebra and Its Applications}, 25903 year = {1989}, 25904 volume = {114/115}, 25905 pages = {231--249} 25906} 25907 25908@PhDThesis{ cottle:nonlinear, 25909 author = {R. W. Cottle}, 25910 title = {Nonlinear programs with positively bounded {J}acobians}, 25911 school = {Department of Mathematics, University of California}, 25912 year = {1964}, 25913 address = {Berkeley, California} 25914} 25915 25916@Article{ cottle:nonlinear*1, 25917 author = {R. W. Cottle}, 25918 title = {Nonlinear programs with positively bounded {J}acobians}, 25919 journal = {Journal of the Society for Industrial and Applied Mathematics}, 25920 volume = {14}, 25921 year = {1966}, 25922 pages = {147--158} 25923} 25924 25925@InCollection{ cottle:principal, 25926 author = {R. W. Cottle}, 25927 title = {The principal pivoting method of quadratic programming}, 25928 booktitle = {Mathematics of the Decision Sciences, Part 1}, 25929 publisher = {American Mathematical Society}, 25930 editor = {G. B. Dantzig and Jr. A. F. Veinott}, 25931 address = {Providence, Rhode Island}, 25932 year = {1968}, 25933 pages = {144--162} 25934} 25935 25936@Unpublished{ courant:calculus, 25937 author = {R. Courant}, 25938 title = {Calculus of Variations and Supplementary Notes and Exercises}, 25939 year = {1956}, 25940 note = {Supplementary notes by M. Kruskal and H. Rubin, revised and amended by J. Moser, 25941 New York University} 25942} 25943 25944@Article{ courant:variational, 25945 author = {R. Courant}, 25946 title = {Variational Methods for the Solution of Problems of Equilibrium and Vibration}, 25947 journal = {Bulletin of the American Mathematical Society}, 25948 year = {1943}, 25949 volume = {49}, 25950 pages = {1--23} 25951} 25952 25953@Book{ cristianini.shawe-taylor:introduction, 25954 author = {N. Cristianini and J. Shawe-Taylor}, 25955 title = {An Introduction to Support Vector Machines}, 25956 publisher = {Cambridge University Press}, 25957 address = {Cambridge}, 25958 year = {2000} 25959} 25960 25961@Article{ cromme:strong, 25962 author = {L. Cromme}, 25963 title = {Strong Uniqueness}, 25964 journal = {Numerische Mathematik}, 25965 year = {1978}, 25966 volume = {29}, 25967 pages = {179--193} 25968} 25969 25970@Article{ crowder.johnson.ea:solving, 25971 author = {H. Crowder and E. L. Johnson and M. W. Padberg}, 25972 title = {Solving Large Scale Zero-One Linear Programming Problems}, 25973 journal = {Operations Research}, 25974 year = {1983}, 25975 volume = {31}, 25976 pages = {803--834} 25977} 25978 25979@Article{ cryer.dempster:equivalence, 25980 author = {C. W. Cryer and M. A. H. Dempster}, 25981 title = {Equivalence of Linear Complementarity Problems and Linear Programs in Vector 25982 Lattice {H}ilbert Spaces}, 25983 journal = {SIAM Journal on Control and Optimization}, 25984 year = {1980}, 25985 volume = {18}, 25986 pages = {76--89} 25987} 25988 25989@Article{ cryer:method, 25990 author = {C. W. Cryer}, 25991 title = {The method of {C}hristopherson for solving free boundary problems for infinite 25992 journal bearings by means of finite differences}, 25993 journal = {Mathematics of Computation}, 25994 volume = {25}, 25995 year = {1971}, 25996 pages = {435--553} 25997} 25998 25999@Article{ cryer:solution, 26000 author = {C. W. Cryer}, 26001 title = {The Solution of a Quadratic Programming Problem Using Systematic Overrelaxation}, 26002 journal = {SIAM Journal on Control and Optimization}, 26003 year = {1971}, 26004 volume = {9}, 26005 pages = {385--392} 26006} 26007 26008@Article{ cryer:solution*1, 26009 author = {C. W. Cryer}, 26010 title = {The Solution of a Quadratic Programming Using Systematic Overrelaxation}, 26011 journal = {SIAM Journal on Control}, 26012 year = {1971}, 26013 volume = {9}, 26014 pages = {385--392} 26015} 26016 26017@Manual{ culler:split-c, 26018 author = {D. Culler}, 26019 title = {The Split--{C} Programming Language}, 26020 organization = {Computer Science Department, University of California, Berkeley} 26021} 26022 26023@InProceedings{ cun.denker.ea:optimal, 26024 author = {Y. le Cun and J. S. Denker and S. A. Solla}, 26025 title = {Optimal Brain Damage}, 26026 booktitle = {Advances in Neural Information Processing Systems II {(Denver 1989)}}, 26027 year = {1990}, 26028 editor = {D. S. Touretzky}, 26029 publisher = {Morgan Kaufmann}, 26030 address = {San Mateo, California}, 26031 pages = {598--605} 26032} 26033 26034@TechReport{ czyzyk.mehrotra.ea:pcx, 26035 author = {J. Czyzyk and S. Mehrotra and S. J. Wright}, 26036 title = {{PCx} Users Guide}, 26037 institution = {Optimization Technology Center, Argonne National Laboratory and Northwestern 26038 University}, 26039 year = {1996}, 26040 type = {Technical Report}, 26041 number = {OTC 96/01} 26042} 26043 26044@TechReport{ czyzyk.mesnier.ea:network-enabled, 26045 address = {Argonne, Illinois}, 26046 author = {J. Czyzyk and M. P. Mesnier and J. J. Mor\'e}, 26047 institution = {Argonne National Laboratory}, 26048 number = {MCS-P615-0996}, 26049 title = {The {N}etwork-{E}nabled {O}ptimization {S}erver}, 26050 type = {Preprint}, 26051 year = {1996} 26052} 26053 26054@Article{ czyzyk.wisniewski.ea:optimization, 26055 title = {Optimization Case Studies in the {NEOS} Guide}, 26056 author = {J. Czyzyk and T. Wisniewski and S. J. Wright}, 26057 journal = {SIAM Review}, 26058 volume = {41}, 26059 pages = {148--163}, 26060 year = {1999} 26061} 26062 26063@Article{ dai.laan.ea:simplicial, 26064 author = {Y. Dai and G. van der Laan and A. J. J. Talman and Y. Yamamoto}, 26065 title = {A Simplicial Algorithm for the Nonlinear Stationary Problem on an Unbounded 26066 Polyhedron}, 26067 journal = {SIAM Journal on Optimization}, 26068 year = {1991}, 26069 volume = {1}, 26070 pages = {151--165} 26071} 26072 26073@Article{ dai.talman:linear, 26074 author = {Y. Dai and D. Talman}, 26075 title = {Linear Stationary Point Problems on Unbounded Polyhedra}, 26076 journal = {Mathematics of Operations Research}, 26077 year = {1993}, 26078 pages = {635--644} 26079} 26080 26081@Book{ daniel:approximate, 26082 author = {J. W. Daniel}, 26083 title = {The approximate minimization of functionals}, 26084 year = {1971}, 26085 publisher = {Prentice-Hall, Inc}, 26086 address = {Englewood Cliffs, New Jersey} 26087} 26088 26089@Article{ danskin:theory, 26090 author = {J. M. Danskin}, 26091 title = {The Theory of Min--Max, with Applications}, 26092 journal = {SIAM Journal on Applied Mathematics}, 26093 year = {1964}, 26094 volume = {14}, 26095 pages = {641--664} 26096} 26097 26098@Book{ danskin:theory*1, 26099 author = {J. M. Danskin}, 26100 title = {The Theory of Min--Max}, 26101 year = {1967}, 26102 publisher = {Springer-Verlag}, 26103 address = {New York} 26104} 26105 26106@InCollection{ dantzig.cottle:positive, 26107 author = {G. B. Dantzig and R. W. Cottle}, 26108 title = {Positive (semi-)definite programming}, 26109 booktitle = {Nonlinear Programming}, 26110 publisher = {North-Holland}, 26111 editor = {J. Abadie}, 26112 address = {Amsterdam}, 26113 year = {1967}, 26114 pages = {55--73} 26115} 26116 26117@Article{ dantzig.manne:complementarity, 26118 author = {G. B. Dantzig and A. S. Manne}, 26119 title = {A Complementarity Algorithm for an Optimal Captial Path with Invariant 26120 Proportions}, 26121 journal = {Journal of Economic Theory}, 26122 year = {1974}, 26123 volume = {9}, 26124 pages = {312--323} 26125} 26126 26127@Article{ dantzig.wolfe:decomposition, 26128 author = {G. B. Dantzig and P. Wolfe}, 26129 title = {Decomposition Principle for Linear Programs}, 26130 journal = {Operations Research}, 26131 year = {1960}, 26132 volume = {8}, 26133 pages = {101--111} 26134} 26135 26136@Book{ dantzig:linear, 26137 author = {G. B. Dantzig}, 26138 title = {Linear Programming and Extensions}, 26139 year = {1963}, 26140 publisher = {Princeton University Press}, 26141 address = {Princeton, New Jersey} 26142} 26143 26144@Manual{ dash:xpress-mp, 26145 title = {{XPRESS-MP} User Guide}, 26146 organization = {Dash Associates}, 26147 address = {Blisworth House, Blisworth, Northants, UK}, 26148 note = {http://www.dashopt.com/} 26149} 26150 26151@Book{ davis:handbook, 26152 author = {L. D. Davis}, 26153 title = {The Handbook of Genetic Algorithms}, 26154 year = {1990}, 26155 publisher = {Van Nostrand Reinhold} 26156} 26157 26158@TechReport{ davis:users, 26159 author = {T. A. Davis}, 26160 title = {Users' guide for the unsymmetric-pattern multifrontal Package ({UMFPACK})}, 26161 type = {{Technical Report}}, 26162 year = {1993}, 26163 institution = {Computer and Information Sciences Department, University of Florida}, 26164 address = {Gainesville, Florida} 26165} 26166 26167@TechReport{ dax:computation, 26168 author = {A. Dax}, 26169 title = {The Computation of Descent Directions at Degenerate Points}, 26170 institution = {Hydrological Service of Israel}, 26171 year = {1985}, 26172 type = {Technical Report} 26173} 26174 26175@Article{ dax:note, 26176 author = {A. Dax}, 26177 title = {A Note on Optimality Conditions for the Euclidean Multifacility Location 26178 Problem}, 26179 journal = {Mathematical Programming}, 26180 year = {1986}, 26181 volume = {36}, 26182 pages = {72--80} 26183} 26184 26185@Article{ deasy:multiple, 26186 author = {J. O. Deasy}, 26187 title = {Multiple local minima in radiotherapy optimization problems with dose volume 26188 constraints}, 26189 journal = {Medical Physics}, 26190 year = {1997}, 26191 optvolume = {24}, 26192 optnumber = {7}, 26193 optpages = {1157-1161} 26194} 26195 26196@Article{ deboor.ron:computational, 26197 author = {C. {deBoor} and A. Ron}, 26198 title = {Computational Aspects of Polynomial Interpolation in Several Variables}, 26199 journal = {Mathematics of Computation}, 26200 year = {1992}, 26201 volume = {58}, 26202 pages = {705--727} 26203} 26204 26205@Article{ debremaecker.ferris.ea:compressional, 26206 author = {J.--C. {De~Bremaecker} and M. C. Ferris and D. Ralph}, 26207 title = {Compressional Fractures considered as Contact Problems and Mixed Complementarity 26208 Problems}, 26209 year = {2000}, 26210 key = {82}, 26211 journal = {Engineering Fracture Mechanics}, 26212 volume = {66}, 26213 pages = {287--303} 26214} 26215 26216@Article{ debremaecker.ferris:comparison, 26217 author = {J.--C. {De~Bremaecker} and M. C. Ferris}, 26218 title = {A Comparison of Two Algorithms for Solving Closed Crack Problems}, 26219 year = {2000}, 26220 key = {90}, 26221 url = {ftp://ftp.cs.wisc.edu/math-prog/tech-reports/00-01.ps}, 26222 journal = {Engineering Fracture Mechanics}, 26223 volume = {66}, 26224 pages = {601--605}, 26225 institution = {Computer Sciences Department, University of Wisconsin}, 26226 address = {Madison, Wisconsin}, 26227 number = {00-01} 26228} 26229 26230@Article{ dedonato.maier:mathematical, 26231 author = {O. {De~Donato} and G. Maier}, 26232 title = {Mathematical programming methods for the inelastic analysis of reinforced 26233 concrete frames allowing for limited rotation capacity}, 26234 journal = {International Journal for Numerical Methods in Engineering}, 26235 volume = {4}, 26236 year = {1972}, 26237 pages = {307--329} 26238} 26239 26240@Book{ deimling:nonlinear, 26241 author = {K. Deimling}, 26242 title = {Nonlinear Functional Analysis}, 26243 publisher = {Springer-Verlag}, 26244 year = {1985} 26245} 26246 26247@PhDThesis{ dejong:analysis, 26248 author = {K. A. De~Jong}, 26249 title = {An Analysis of the Behavior of a Class of Genetic Adaptive Systems}, 26250 year = {1975}, 26251 school = {University of Michigan}, 26252 note = {Dissertation Abstracts International 36(10), 5140B} 26253} 26254 26255@Article{ deleone.mangasarian.ea:multi-sweep, 26256 author = {R. {De~Leone} and O. L. Mangasarian and T.-H. Shiau}, 26257 title = {Multi-Sweep Asynchronous Parallel Successive Overelaxation for the Nonsymmetric 26258 Linear Complementarity Problem}, 26259 journal = {Annals of Operations Research}, 26260 year = {1990}, 26261 volume = {22}, 26262 pages = {43--54} 26263} 26264 26265@InCollection{ deleone.mangasarian:serial, 26266 author = {R. {De~Leone} and O. L. Mangasarian}, 26267 title = {Serial and Parallel Solution of Large Scale Linear Programs by Augmented 26268 {L}agrangian Successive Overrelaxation}, 26269 booktitle = {Optimization, Parallel Processing and Applications}, 26270 publisher = {Springer-Verlag}, 26271 year = {1988}, 26272 editor = {A. Kurzhanski and K. Neumann and D. Pallaschke}, 26273 volume = {304}, 26274 series = {Lecture Notes in Economics and Mathematical Systems}, 26275 pages = {103--124}, 26276 address = {Berlin} 26277} 26278 26279@TechReport{ deluca.facchinei.ea:combining, 26280 author = {T. {De~Luca} and F. Facchinei and C. Kanzow}, 26281 title = {Combining Equation-Based Methods for the Solution of Large-Scale Nonlinear 26282 Complementarity Problems: Theory and Numerical Results}, 26283 type = {Preprint}, 26284 institution = {Institute of Applied Mathematics, University of Hamburg}, 26285 year = {1996} 26286} 26287 26288@TechReport{ deluca.facchinei.ea:general, 26289 author = {T. {De~Luca} and F. Facchinei and C. Kanzow}, 26290 title = {A General Framework for Solving Nonlinear Complementarity Problems: Theory and 26291 Numerical Results}, 26292 type = {Preprint}, 26293 institution = {Institute of Applied Mathematics, University of Hamburg}, 26294 year = {1997} 26295} 26296 26297@Article{ deluca.facchinei.ea:semismooth, 26298 author = {T. {De~Luca} and F. Facchinei and C. Kanzow}, 26299 title = {A Semismooth Equation Approach to the Solution of Nonlinear Complementarity 26300 Problems}, 26301 journal = {Mathematical Programming}, 26302 volume = {75}, 26303 pages = {407--439}, 26304 year = {1996} 26305} 26306 26307@Article{ deluca.facchinei.ea:theoretical, 26308 author = {T. {De~Luca} and F. Facchinei and C. Kanzow}, 26309 title = {A Theoretical and Numerical Comparison of some Semismooth Algorithms for 26310 Complementarity Problems}, 26311 year = {1999}, 26312 journal = {Computational Optimization and Applications, forthcoming} 26313} 26314 26315@Article{ demarzo.eaves:computing, 26316 author = {P. M. DeMarzo and B. C. Eaves}, 26317 title = {Computing Equilibria of {GEI} by Relocalization on a Grassmann Manifold}, 26318 journal = {Journal of Mathematical Economics}, 26319 year = {1996}, 26320 volume = {26}, 26321 pages = {479--497} 26322} 26323 26324@Article{ dembo.steihaug:truncated, 26325 author = {R. S. Dembo and T. Steihaug}, 26326 title = {Truncated {N}ewton Method Algorithms for Large--Scale Unconstrained 26327 Optimization}, 26328 journal = {Mathematical Programming}, 26329 year = {1983}, 26330 volume = {26}, 26331 pages = {190--212} 26332} 26333 26334@Article{ dembo:performance, 26335 author = {R. S. Dembo}, 26336 title = {The Performance of {NLPNET}, {A} Large--Scale Nonlinear Network Optimizer}, 26337 journal = {Mathematical Programming Study}, 26338 year = {1986}, 26339 volume = {26}, 26340 pages = {245--248} 26341} 26342 26343@Article{ demoor.vandenberghe.ea:generalized, 26344 author = {B. {De~Moor} and L. Vandenberghe and J. Vandewalle}, 26345 title = {The generalized linear complementarity problem and an algorithm to find all its 26346 solutions}, 26347 journal = {Mathematical Programming}, 26348 volume = {57}, 26349 year = {1992}, 26350 pages = {415--426} 26351} 26352 26353@Book{ demyanov.vasilev:nondifferentiable, 26354 author = {V. F. Dem\'{y}anov and L. V. Vasil\'{e}v}, 26355 title = {Nondifferentiable Optimization}, 26356 publisher = {Optimization Software, Inc.}, 26357 year = {1985}, 26358 address = {New York} 26359} 26360 26361@Book{ dennis.schnabel:numerical, 26362 author = {J. E. Dennis and R. B. Schnabel}, 26363 title = {Numerical Methods for Unconstrained Optimization and Nonlinear Equations}, 26364 year = {1983}, 26365 publisher = {Prentice-Hall, Inc}, 26366 address = {Englewood Cliffs, New Jersey} 26367} 26368 26369@Article{ dennis.torczon:direct, 26370 author = {J. E. Dennis and V. Torczon}, 26371 title = {Direct Search Methods on Parallel Machines}, 26372 journal = {SIAM Journal on Optimization}, 26373 year = {1991}, 26374 volume = {1}, 26375 pages = {448--474} 26376} 26377 26378@TechReport{ depierro.iusem:convergence, 26379 author = {A. R. {De~Pierro} and A. N. Iusem}, 26380 title = {Convergence Properties of Iterative Methods for Symmetric Positive Semidefinite 26381 Linear Complementarity Problems}, 26382 institution = {Instituto de Matematica, Elasticita e Ciencia da Computacao}, 26383 year = {1990}, 26384 address = {Universidade Estadual de Campinas, CP 6065, Campinas, 13081, SP, Brazil} 26385} 26386 26387@Article{ depierro.iusem:relaxed, 26388 author = {A. R. {De~Pierro} and A. N. Iusem}, 26389 title = {A Relaxed Version of {B}regman's Method for Convex Programming}, 26390 journal = {Journal of Optimization Theory and Applications}, 26391 year = {1986}, 26392 volume = {51}, 26393 pages = {421--440} 26394} 26395 26396@Book{ dervis.melo.ea:general, 26397 author = {K. Dervis and J. de Melo and S. Robinson}, 26398 title = {General Equilibrium Models of Development Policy}, 26399 publisher = {Cambridge University Press}, 26400 year = {1982}, 26401 address = {Cambridge, England} 26402} 26403 26404@Article{ deschutter.demoor:minimal, 26405 author = {B. {De~Schutter} and B. {De~Moor}}, 26406 title = {Minimal Realization in the Max Algebra is an Extended Linear Complementarity 26407 Problem}, 26408 journal = {Systems \& Control Letters}, 26409 year = {1995}, 26410 pages = {103--111} 26411} 26412 26413@Article{ desilets.golden.ea:predicting, 26414 author = {L. DeSilets and B. Golden and Q. Wang and R. Kumar}, 26415 title = {Predicting Salinity in the {C}hesapeake {B}ay Using Backpropagation}, 26416 journal = {Computers \& Operations Research}, 26417 year = {1992}, 26418 volume = {19}, 26419 pages = {277--285} 26420} 26421 26422@PhDThesis{ desilva:sensitivity, 26423 author = {A. H. DeSilva}, 26424 title = {Sensitivity Formulas for Nonlinear Factorable Programming and their Application 26425 to the Solution of an Implicitly Defined Optimization Model of {US} Crude Oil 26426 Production}, 26427 school = {George Washington University}, 26428 address = {Washington, D.C.}, 26429 year = {1978} 26430} 26431 26432@TechReport{ dijkstra:cooperating, 26433 author = {E. W. Dijkstra}, 26434 title = {Cooperating Sequential Processes}, 26435 institution = {Technological University}, 26436 year = {1965}, 26437 address = {Eindhoven, The Netherlands}, 26438 number = {EWD--123}, 26439 type = {Technical Report} 26440} 26441 26442@Article{ dikin:iterative, 26443 author = {I. I. Dikin}, 26444 title = {Iterative Solution of Problems of Linear and Quadratic Programming}, 26445 journal = {Soviet Mathematics Doklady}, 26446 year = {1967}, 26447 volume = {8}, 26448 pages = {674--675} 26449} 26450 26451@InCollection{ dipillo.grippo.ea:class, 26452 author = {G. Di~Pillo and L. Grippo and F. Lampariello}, 26453 title = {A Class of Methods for the Solution of Optimization Problems with Inequalities}, 26454 booktitle = {System Modelling and Optimization}, 26455 year = {1981}, 26456 editor = {R. F. Drenick and F. Kozin}, 26457 publisher = {Springer-Verlag}, 26458 address = {Berlin} 26459} 26460 26461@Article{ dipillo.grippo:augmented, 26462 author = {G. Di~Pillo and L. Grippo}, 26463 title = {An Augmented {L}agrangian for Inequality Constraints in Nonlinear Programming 26464 Problems}, 26465 journal = {Journal of Optimization Theory and Applications}, 26466 year = {1982}, 26467 volume = {36}, 26468 pages = {495--519} 26469} 26470 26471@Article{ dipillo.grippo:class, 26472 author = {G. Di~Pillo and L. Grippo}, 26473 title = {A New Class of Augmented {L}agrangians in Nonlinear Programming}, 26474 journal = {SIAM Journal on Control and Optimization}, 26475 year = {1979}, 26476 volume = {17}, 26477 pages = {618--628} 26478} 26479 26480@Article{ dipillo.grippo:continuously, 26481 author = {G. Di~Pillo and L. Grippo}, 26482 title = {A Continuously Differentiable Exact Penalty Function for Nonlinear Programming 26483 Problems with Inequality Constraints}, 26484 journal = {SIAM Journal on Control and Optimization}, 26485 year = {1985}, 26486 volume = {23}, 26487 pages = {72--84} 26488} 26489 26490@Article{ dipillo.grippo:exact, 26491 author = {G. Di~Pillo and L. Grippo}, 26492 title = {An Exact Penalty Method with Global Convergence Properties for Nonlinear 26493 Programming Problems}, 26494 journal = {Mathematical Programming}, 26495 year = {1986}, 26496 volume = {36}, 26497 pages = {1--18} 26498} 26499 26500@TechReport{ dirkse.ferris.ea:gams, 26501 author = {S. P. Dirkse and M. C. Ferris and P. V. Preckel and T. Rutherford}, 26502 title = {The {GAMS} Callable Program Library for Variational and Complementarity Solvers}, 26503 institution = {Computer Sciences Department, University of Wisconsin}, 26504 year = {1994}, 26505 address = {Madison, Wisconsin}, 26506 number = {94-07}, 26507 type = {Mathematical Programming Technical Report}, 26508 url = {ftp: //ftp.cs.wisc.edu/math-prog/tech-reports/94-07.ps}, 26509 key = {25} 26510} 26511 26512@InProceedings{ dirkse.ferris:crash, 26513 crossref = {ferris.pang:complementarity}, 26514 author = {S. P. Dirkse and M. C. Ferris}, 26515 title = {Crash Techniques for Large-Scale Complementarity Problems}, 26516 pages = {40--61}, 26517 url = {ftp: //ftp.cs.wisc.edu/math-prog/tech-reports/95-22.ps}, 26518 key = {52} 26519} 26520 26521@Article{ dirkse.ferris:mcplib, 26522 author = {S. P. Dirkse and M. C. Ferris}, 26523 title = {{MCPLIB}: {A} Collection of Nonlinear Mixed Complementarity Problems}, 26524 journal = {Optimization Methods and Software}, 26525 pages = {319--345}, 26526 volume = {5}, 26527 year = {1995}, 26528 url = {ftp: //ftp.cs.wisc.edu/tech-reports/reports/1994/tr1215.ps}, 26529 key = {36} 26530} 26531 26532@InCollection{ dirkse.ferris:modeling, 26533 author = {S. P. Dirkse and M. C. Ferris}, 26534 title = {Modeling and Solution Environments for {MPEC}: {GAMS} \& {MATLAB}}, 26535 year = {1999}, 26536 pages = {127--148}, 26537 editor = {M. Fukushima and L. Qi}, 26538 booktitle = {Reformulation: Nonsmooth, Piecewise Smooth, Semismooth and Smoothing Methods}, 26539 publisher = {Kluwer Academic Publishers}, 26540 url = {ftp: //ftp.cs.wisc.edu/math-prog/tech-reports/97-09.ps}, 26541 key = {62} 26542} 26543 26544@Article{ dirkse.ferris:path, 26545 author = {S. P. Dirkse and M. C. Ferris}, 26546 title = {The {PATH} Solver: {A} Non-Monotone Stabilization Scheme for Mixed 26547 Complementarity Problems}, 26548 journal = {Optimization Methods and Software}, 26549 pages = {123--156}, 26550 volume = {5}, 26551 year = {1995}, 26552 url = {ftp: //ftp.cs.wisc.edu/tech-reports/reports/1993/tr1179.ps}, 26553 key = {33} 26554} 26555 26556@Article{ dirkse.ferris:pathsearch, 26557 author = {S. P. Dirkse and M. C. Ferris}, 26558 title = {A Pathsearch Damped {N}ewton Method for Computing General Equilibria}, 26559 journal = {Annals of Operations Research}, 26560 vol = {68}, 26561 year = {1996}, 26562 pages = {211--232}, 26563 url = {ftp: //ftp.cs.wisc.edu/math-prog/tech-reports/94-03.ps}, 26564 key = {39} 26565} 26566 26567@InCollection{ dirkse.ferris:traffic, 26568 author = {S. P. Dirkse and M. C. Ferris}, 26569 title = {Traffic Modeling and Variational Inequalities using {GAMS}}, 26570 booktitle = {Operations Research and Decision Aid Methodologies in Traffic and Transportation 26571 Management}, 26572 publisher = {Springer-Verlag}, 26573 year = {1998}, 26574 editor = {Ph. L. Toint and M. Labbe and K. Tanczos and G. Laporte}, 26575 series = {NATO ASI Series F}, 26576 volume = {166}, 26577 pages = {136--163}, 26578 key = {61}, 26579 url = {ftp: //ftp.cs.wisc.edu/math-prog/tech-reports/97-06.ps} 26580} 26581 26582@PhDThesis{ dirkse:robust, 26583 author = {S. P. Dirkse}, 26584 title = {Robust Solution of Mixed Complementarity Problems}, 26585 school = {Computer Sciences Department, University of Wisconsin}, 26586 year = {1994}, 26587 address = {Madison, Wisconsin}, 26588 note = {Available from ftp://ftp.cs.wisc.edu/math-prog/tech-reports/}, 26589 annote = {Mathematical Programming Technical Report 94-12} 26590} 26591 26592@TechReport{ dixon.mills:neural, 26593 author = {L. C. Dixon and D. J. Mills}, 26594 title = {Neural Nets for Massively Parallel Optimisation}, 26595 institution = {Hatfield Polytechnic}, 26596 year = {1992}, 26597 address = {Hatfield, Hertforshire, England}, 26598 number = {Numerical Optimisation Centre Technical Report No. 259} 26599} 26600 26601@Article{ dontchev:local, 26602 author = {A. L. Dontchev}, 26603 title = {Local Convergence of the {N}ewton method for Generalized Equations}, 26604 journal = {C.R. Acad. Sci. Paris Series I}, 26605 year = {1996}, 26606 volume = {332}, 26607 pages = {327--331} 26608} 26609 26610@Article{ douglas.rachford:numerical, 26611 author = {J. Douglas and H. H. Rachford}, 26612 title = {On the Numerical Solution of Heat Conduction Problems in Two and Three Space 26613 Variables}, 26614 journal = {Transactions of the American Mathematical Society}, 26615 year = {1956}, 26616 volume = {82}, 26617 pages = {421--439} 26618} 26619 26620@Article{ drud:conopt, 26621 author = {A. Drud}, 26622 title = {{CONOPT}: {A} {GRG} Code for Large Sparse Dynamic Nonlinear Optimization 26623 Problems}, 26624 journal = {Mathematical Programming}, 26625 year = {1985}, 26626 volume = {31}, 26627 pages = {153--191} 26628} 26629 26630@Article{ dsouza.meyer.ea:mixed, 26631 author = {W. D. D'Souza and R. R. Meyer and M. C. Ferris and B. R. Thomadsen}, 26632 title = {Mixed Integer Programming Models for Prostate Brachytherapy Treatment 26633 Optimization}, 26634 journal = {Medical Physics}, 26635 year = {1999}, 26636 key = {85}, 26637 volume = {26}, 26638 number = {6}, 26639 pages = {1099} 26640} 26641 26642@TechReport{ dsouza.meyer.ea:mixed*1, 26643 author = {W. D. D'Souza and R. R. Meyer and M. C. Ferris and B. R. Thomadsen}, 26644 title = {Mixed Integer Programming Models for Prostate Brachytherapy Treatment 26645 Optimization}, 26646 year = {1999}, 26647 key = {87}, 26648 url = {ftp: //ftp.cs.wisc.edu/math-prog/tech-reports/99-08.ps}, 26649 institution = {Computer Sciences Department, University of Wisconsin}, 26650 address = {Madison, Wisconsin}, 26651 number = {99-08}, 26652 type = {Mathematical Programming Technical Report}, 26653 annote = {Submitted to } 26654} 26655 26656@Article{ dsouza.meyer.ea:iterative, 26657 author = {W. D. D'Souza and R. R. Meyer and B. R. Thomadsen and M. C. Ferris}, 26658 title = {An Iterative Sequential Mixed-Integer Approach to Automated Prostate 26659 Brachytherapy Treatment Optimization}, 26660 year = {2000}, 26661 key = {96}, 26662 journal = {Physics and Medicine in Biology, forthcoming} 26663} 26664 26665@Article{ du.yu.ea:multileaf, 26666 author = {M. N. Du and C. X. Yu and M. Symons and D. Yan and R. Taylor and R. C. Matter and 26667 G. Gustafson and A. Martinez and J. W. Wong}, 26668 title = {A multileaf collimator field prescription preparation system for conventional 26669 radiotherapy}, 26670 journal = {International Journal of Radiation Oncology, Biology and Physics}, 26671 year = {1994}, 26672 volume = {30}, 26673 number = {3}, 26674 pages = {707--714} 26675} 26676 26677@Article{ duda.fossum:pattern, 26678 author = {R. O. Duda and H. Fossum}, 26679 title = {Pattern Classification by Iteratively Determined Linear and Piecewise Linear 26680 Discriminant Functions}, 26681 journal = {IEEE Transactions on Electronic Computers}, 26682 year = {1966}, 26683 volume = {15}, 26684 pages = {220--232} 26685} 26686 26687@Book{ duda.hart:pattern, 26688 author = {R. O. Duda and P. E. Hart}, 26689 title = {Pattern Classification and Scene Analysis}, 26690 year = {1973}, 26691 publisher = {John Wiley \& Sons}, 26692 address = {New York} 26693} 26694 26695@Book{ duff.erisman.ea:direct, 26696 author = {I. S. Duff and A. M. Erisman and J. K. Reid}, 26697 title = {Direct Methods for Sparse Matrices}, 26698 publisher = {Oxford University Press}, 26699 year = {1986}, 26700 address = {Oxford, England} 26701} 26702 26703@InCollection{ duffin:infinite, 26704 author = {R. J. Duffin}, 26705 title = {Infinite Programs}, 26706 booktitle = {Linear Inequalities and Related Systems}, 26707 year = {1975}, 26708 editor = {H. W. Kuhn and A. W. Tucker}, 26709 publisher = {Princeton University Press}, 26710 address = {Princeton, New Jersey}, 26711 pages = {157--170} 26712} 26713 26714@Article{ dunn.sachs:effect, 26715 author = {J. C. Dunn and E. Sachs}, 26716 title = {The Effect of Perturbations on the Convergence Rates of Optimization Algorithms}, 26717 journal = {Applied Mathematics and Optimization}, 26718 year = {1983}, 26719 volume = {10}, 26720 pages = {143--157} 26721} 26722 26723@Article{ dunn:convergence, 26724 author = {J. C. Dunn}, 26725 title = {On the Convergence of Projected Gradient Processes to Singular Critical Points}, 26726 journal = {Journal of Optimization Theory and Applications}, 26727 year = {1987}, 26728 volume = {55}, 26729 pages = {203--216} 26730} 26731 26732@Article{ dunn:global, 26733 author = {J. C. Dunn}, 26734 title = {Global and Asymptotic Convergence Rate Estimates for a Class of Projected 26735 Gradient Processes}, 26736 journal = {SIAM Journal on Control and Optimization}, 26737 year = {1981}, 26738 volume = {19}, 26739 pages = {368--400} 26740} 26741 26742@Article{ dunn:rates, 26743 author = {J. C. Dunn}, 26744 title = {Rates of Convergence for Conditional Gradient Algorithms Near Singular and 26745 Nonsingular Extremals}, 26746 journal = {SIAM Journal on Control and Optimization}, 26747 year = {1979}, 26748 volume = {17}, 26749 pages = {187--211} 26750} 26751 26752@Article{ dupuis.simha:sampling, 26753 author = {P. Dupuis and R. Simha}, 26754 title = {On Sampling-Controlled Stochastic Approximation}, 26755 journal = {{IEEE} Transactions on Automatic Control}, 26756 year = {1991}, 26757 volume = {36}, 26758 pages = {915--924} 26759} 26760 26761@TechReport{ eager.ferris.ea:models, 26762 author = {D. L. Eager and M. C. Ferris and M. K. Vernon}, 26763 title = {Models for Optimized Regional Caching in Heterogeneous Video-On-Demand Systems}, 26764 institution = {Computer Sciences Department, University of Wisconsin}, 26765 year = {1999}, 26766 type = {Technical Report}, 26767 number = {1402}, 26768 address = {Madison, Wisconsin}, 26769 url = {http: //www.cs.wisc.edu/tech-reports/reports/1999/tr1402.ps.Z}, 26770 key = {84} 26771} 26772 26773@InProceedings{ eager.ferris.ea:optimized, 26774 author = {D. L. Eager and M. C. Ferris and M. K. Vernon}, 26775 title = {Optimized Regional Caching for On-Demand Data Delivery}, 26776 year = {1999}, 26777 booktitle = {Multimedia Computing and Networking, Proceedings of {SPIE}}, 26778 volume = {3654}, 26779 address = {Bellingham, Washington}, 26780 url = {ftp://ftp.cs.wisc.edu/math-prog/tech-reports/98-10.ps}, 26781 key = {69}, 26782 pages = {301--316}, 26783 annote = {18 percent acceptance rate} 26784} 26785 26786@Article{ eager.ferris.ea:optimized*1, 26787 author = {D. L. Eager and M. C. Ferris and M. K. Vernon}, 26788 title = {Optimized Caching in Systems with Heterogeneous Client Populations}, 26789 journal = {Performance Evaluation}, 26790 year = {2000}, 26791 key = {72}, 26792 url = {ftp://ftp.cs.wisc.edu/math-prog/tech-reports/98-15.ps}, 26793 volume = {42}, 26794 pages = {163--185} 26795} 26796 26797@InProceedings{ eager.vernon:dynamic, 26798 author = {D. L. Eager and M. K. Vernon}, 26799 title = {Dynamic Skyscraper Broadcasts for Video-On-Demand}, 26800 year = {1998}, 26801 booktitle = {Proceedings of the 4th International Workshop on Multimedia Information Systems 26802 ({MIS '98})}, 26803 pages = {18--32}, 26804 address = {Istanbul, Turkey} 26805} 26806 26807@Article{ eaves.lemke:equivalence, 26808 author = {B. C. Eaves and C. E. Lemke}, 26809 title = {Equivalence of {LCP} and {PLS}}, 26810 journal = {Mathematics of Operations Research}, 26811 year = {1981}, 26812 volume = {6}, 26813 pages = {475--484} 26814} 26815 26816@Article{ eaves.rothblum:relationships, 26817 author = {B. C. Eaves and U. G. Rothblum}, 26818 title = {Relationships of Properties of Piecewise Affine Maps over Ordered Fields}, 26819 journal = {Linear Algebra and Its Applications}, 26820 year = {1990}, 26821 volume = {132}, 26822 pages = {1--63} 26823} 26824 26825@Article{ eaves:basic, 26826 author = {B. C. Eaves}, 26827 title = {On the Basic Theorem of Complementarity}, 26828 journal = {Mathematical Programming}, 26829 year = {1971}, 26830 volume = {1}, 26831 pages = {68--87} 26832} 26833 26834@Article{ eaves:computing, 26835 author = {B. C. Eaves}, 26836 title = {Computing Stationary Points}, 26837 journal = {Mathematical Programming Study}, 26838 year = {1978}, 26839 volume = {7}, 26840 pages = {1--14} 26841} 26842 26843@InCollection{ eaves:computing*1, 26844 author = {B. C. Eaves}, 26845 title = {Computing Stationary Points, Again}, 26846 pages = {391--405}, 26847 crossref = {mangasarian.meyer.ea:nonlinear*3} 26848} 26849 26850@Article{ eaves:homotopies, 26851 author = {B. C. Eaves}, 26852 title = {Homotopies for Computation of Fixed Points}, 26853 journal = {Mathematical Programming}, 26854 year = {1972}, 26855 volume = {3}, 26856 pages = {1--22} 26857} 26858 26859@Article{ eaves:linear, 26860 author = {B. C. Eaves}, 26861 title = {The Linear Complementarity Problem}, 26862 journal = {Management Science}, 26863 year = {1971}, 26864 volume = {17}, 26865 pages = {612--634} 26866} 26867 26868@Article{ eaves:quadratic, 26869 author = {B. C. Eaves}, 26870 title = {On Quadratic Programming}, 26871 journal = {Management Science}, 26872 year = {1971}, 26873 volume = {17}, 26874 pages = {698--711} 26875} 26876 26877@InProceedings{ eaves:short, 26878 author = {B. C. Eaves}, 26879 title = {A Short Course in Solving Equations with {PL} Homotopies}, 26880 booktitle = {Nonlinear Programming}, 26881 organization = {American Mathematical Society}, 26882 year = {1976}, 26883 editor = {R. W. Cottle and C. E. Lemke}, 26884 publisher = {SIAM--AMS Proceedings}, 26885 address = {Providence, RI}, 26886 pages = {73--143} 26887} 26888 26889@InCollection{ ebiefung.kostreva:global, 26890 author = {A. A. Ebiefung and M. M. Kostreva}, 26891 title = {Global Solvability of Generalized Linear Complementarity Problems and a Related 26892 Class of Polynomial Complementarity Problems}, 26893 editors = {C. Floudas and P. Pardalos}, 26894 booktitle = {Recent Advances in Global Optimization}, 26895 publisher = {Princeton University Press}, 26896 pages = {102--124}, 26897 year = {1991} 26898} 26899 26900@TechReport{ ebiefung.kostreva:z-matrices, 26901 author = {A. A. Ebiefung and M. M. Kostreva}, 26902 title = {{Z}--Matrices annd the Generalized Linear Complementarity Problem}, 26903 institution = {Department of Mathematical Sciences, Clemson University}, 26904 year = {1991}, 26905 number = {608}, 26906 address = {Clemson, South Carolina} 26907} 26908 26909@TechReport{ eckstein.bertsekas:alternating, 26910 author = {J. Eckstein and D. P. Bertsekas}, 26911 title = {An Alternating Direction Method for Linear Programming}, 26912 institution = {Harvard Business School}, 26913 year = {1990}, 26914 type = {Working Paper}, 26915 number = {90-063}, 26916 address = {Boston, MA} 26917} 26918 26919@Article{ eckstein.bertsekas:douglas-rachford, 26920 author = {J. Eckstein and D. P. Bertsekas}, 26921 title = {On the {D}ouglas-{R}achford Splitting Method and the Proximal Point Algorithm for 26922 Maximal Monotone Operators}, 26923 journal = {Mathematical Programming}, 26924 year = {1992}, 26925 pages = {293--318}, 26926 volume = {55} 26927} 26928 26929@Article{ eckstein.bertsekas:douglas-rachford*1, 26930 author = {J. Eckstein and D. P. Bertsekas}, 26931 title = {On the {D}ouglas--{R}achford Splitting Method and the Proximal Point Algorithm 26932 for Maximal Monotone Operators}, 26933 journal = {Mathematical Programming}, 26934 year = {1991}, 26935 note = {To appear} 26936} 26937 26938@TechReport{ eckstein.ferris:operator, 26939 author = {J. Eckstein and M. C. Ferris}, 26940 title = {Operator Splitting Methods for Monotone Linear Complementarity Problems}, 26941 institution = {Thinking Machines Corporation}, 26942 year = {1992}, 26943 address = {Cambridge, MA 02142}, 26944 number = {239}, 26945 type = {TMC}, 26946 key = {26} 26947} 26948 26949@Article{ eckstein.ferris:operator*1, 26950 author = {J. Eckstein and M. C. Ferris}, 26951 title = {Operator Splitting Methods for Monotone Affine Variational Inequalities, with a 26952 Parallel Application to Optimal Control}, 26953 volume = {10}, 26954 pages = {218--235}, 26955 year = {1998}, 26956 journal = {INFORMS Journal on Computing}, 26957 url = {ftp: //ftp.cs.wisc.edu/math-prog/tech-reports/94-17.ps}, 26958 key = {44} 26959} 26960 26961@Article{ eckstein.ferris:smooth, 26962 author = {J. Eckstein and M. C. Ferris}, 26963 title = {Smooth Methods of Multipliers for Complementarity Problems}, 26964 key = {58}, 26965 url = {ftp: //ftp.cs.wisc.edu/math-prog/tech-reports/97-01.ps}, 26966 year = {1999}, 26967 journal = {Mathematical Programming}, 26968 volume = {86}, 26969 pages = {65--90} 26970} 26971 26972@InProceedings{ eckstein.hart.ea:resource, 26973 author = {J. Eckstein and W. E. Hart and C. A. Phillips}, 26974 title = {Resource Management in a Parallel Mixed Integer Programming Package}, 26975 booktitle = {Intel Supercomputer Users Group Thirteenth Annual Conference}, 26976 year = {1997}, 26977 note = {www.cs.sandia.gov/ISUG97} 26978} 26979 26980@Article{ eckstein:alternating, 26981 author = {J. Eckstein}, 26982 title = {The Alternating Step Method for Monotropic Programming on the {Connection Machine 26983 CM-2}}, 26984 journal = {ORSA Journal on Computing}, 26985 year = {to appear} 26986} 26987 26988@Article{ eckstein:approximate, 26989 author = {J. Eckstein}, 26990 title = {Approximate Iterations in {B}regman-Function-Based Proximal Algorithms}, 26991 year = {1998}, 26992 journal = {Mathematical Programming}, 26993 volume = {83}, 26994 pages = {113--124} 26995} 26996 26997@Article{ eckstein:communication, 26998 author = {J. Eckstein}, 26999 title = {How Much Communication Does Parallel Branch and Bound Need}, 27000 journal = {{INFORMS} Journal on Computing}, 27001 volume = {9}, 27002 year = {1997}, 27003 pages = {15--29} 27004} 27005 27006@Article{ eckstein:distributed, 27007 author = {J. Eckstein}, 27008 title = {Distributed Versus Centralized Control for Parallel Branch and Bound: {M}ixed 27009 Integer Programming on the {CM}-5}, 27010 journal = {Computational Optimization and Applications}, 27011 volume = {7}, 27012 pages = {199--220}, 27013 year = {1997} 27014} 27015 27016@TechReport{ eckstein:lions-mercier, 27017 author = {J. Eckstein}, 27018 title = {The {L}ions--{M}ercier Splitting Algorithm and the Alternating Direction Method 27019 as instances of the Proximal Point Algorithm}, 27020 institution = {MIT}, 27021 year = {1988}, 27022 address = {Cambridge, Massachusetts}, 27023 number = {LIDS-P-1769} 27024} 27025 27026@Article{ eckstein:nonlinear, 27027 author = {J. Eckstein}, 27028 title = {Nonlinear Proximal Point Algorithms Using {B}regman Functions, with Applications 27029 to Convex Programming}, 27030 journal = {Mathematics of Operations Research}, 27031 year = {1993}, 27032 pages = {202--226}, 27033 volume = {18} 27034} 27035 27036@Article{ eckstein:parallel, 27037 author = {J. Eckstein}, 27038 title = {Parallel Branch-and-Bound Algorithms for General Mixed Integer Programming on the 27039 {CM}-5}, 27040 journal = {SIAM Journal on Optimization}, 27041 volume = {4}, 27042 pages = {794--814}, 27043 year = {1994} 27044} 27045 27046@TechReport{ eckstein:smooth, 27047 author = {J. Eckstein}, 27048 title = {Smooth Methods of Multipliers for Monotone Complementarity Problems}, 27049 institution = {Rutgers Center for Operations Research, Rutgers University}, 27050 address = {New Brunswick, New Jersey}, 27051 year = {1996}, 27052 type = {Research Report}, 27053 number = {27-96} 27054} 27055 27056@PhDThesis{ eckstein:splitting, 27057 author = {J. Eckstein}, 27058 title = {Splitting Methods for Monotone Operators, with Applications to Parallel 27059 Optimization}, 27060 school = {Massachusetts Institute of Technology}, 27061 year = {1989}, 27062 address = {Cambridge, MA}, 27063 note = {Report LIDS-TH-1877, Laboratory for Information and Decision Systems, M.I.T.} 27064} 27065 27066@Article{ eglese:simulated, 27067 author = {R. W. Eglese}, 27068 title = {Simulated Annealing: {A} Tool for Operational Research}, 27069 journal = {European Journal of Operations Research}, 27070 year = {1990}, 27071 volume = {46}, 27072 pages = {271--281} 27073} 27074 27075@Book{ ekeland.temam:convex, 27076 author = {I. Ekeland and R. Temam}, 27077 title = {Convex Analysis and Variational Problems}, 27078 year = {1976}, 27079 publisher = {North--Holland}, 27080 address = {Amsterdam} 27081} 27082 27083@Article{ ekeland:variational, 27084 author = {I. Ekeland}, 27085 title = {On the Variational Principle}, 27086 journal = {Journal of Mathematical Analysis and Applications}, 27087 year = {1974}, 27088 volume = {47}, 27089 pages = {324--353} 27090} 27091 27092@TechReport{ el-bakry.tapia.ea:formulation, 27093 author = {A. S. El-Bakry and R. A. Tapia and T. Tsuchiya and Y. Zhang}, 27094 title = {On the formulation and theory of the primal-dual {N}ewton interior-point method 27095 for nonlinear programming}, 27096 type = {{Technical Report TR92-40}}, 27097 institution = {{Department of Computational and Applied Mathematics, Rice University}}, 27098 year = {1992} 27099} 27100 27101@Article{ eldersveld.saunders:block, 27102 author = {S. K. Eldersveld and M. A. Saunders}, 27103 title = {A Block-{LU} Update for Large--Scale Linear Programming}, 27104 journal = {SIAM Journal on Matrix Analysis and Applications}, 27105 year = {1992}, 27106 volume = {13}, 27107 pages = {191--201} 27108} 27109 27110@Article{ elster.neumaier:grid, 27111 author = {C. Elster and A. Neumaier}, 27112 title = {A Grid Algorithm for Bound Constrained Optimization of Noisy Functions}, 27113 journal = {{IMA} Journal of Numerical Analysis}, 27114 year = {1995}, 27115 volume = {15}, 27116 pages = {585--608} 27117} 27118 27119@Article{ epema.livny.ea:worldwide, 27120 author = {D. H. J. Epema and M. Livny and R. van Dantzig and X. Evers and J. Pruyne}, 27121 title = {A Worldwide Flock of Condors: Load Sharing among Workstation Clusters}, 27122 journal = {Journal on Future Generations of Computer Systems}, 27123 year = {1996}, 27124 volume = {12}, 27125 pages = {53--65} 27126} 27127 27128@Book{ ermoliev.editors:numerical, 27129 author = {Y. Ermoliev and R. J.-B. Wets {(editors)}}, 27130 title = {Numerical Techniques for Stochastic Optimization Problems}, 27131 year = {1988}, 27132 publisher = {Springer-Verlag}, 27133 address = {Berlin} 27134} 27135 27136@TechReport{ evett.spiehler:rule, 27137 author = {I. W. Evett and E. J. Spiehler}, 27138 title = {Rule Induction in Forensic Science}, 27139 institution = {Central Research Establishment, Home Office Forensic Science Service}, 27140 year = {1987}, 27141 address = {Aldermaston, Reading, Berkshire RG7 4PN}, 27142 type = {Technical Report} 27143} 27144 27145@Article{ evtushenko.purtov:sufficient, 27146 author = {Y. G. Evtushenko and V. A. Purtov}, 27147 title = {Sufficient Conditions for a Minimum for Nonlinear Programming Problems}, 27148 journal = {Soviet Mathematics Doklady}, 27149 year = {1984}, 27150 volume = {30}, 27151 pages = {313--316} 27152} 27153 27154@Article{ facchinei.fischer.ea:regularity, 27155 author = {F. Facchinei and A. Fischer and C. Kanzow}, 27156 title = {Regularity Properties of a Semismooth Reformulation of Variational Inequalities}, 27157 journal = {SIAM Journal on Optimization}, 27158 year = {1998}, 27159 volume = {8}, 27160 pages = {850--869} 27161} 27162 27163@Article{ facchinei.fischer.ea:semismooth, 27164 title = {A Semismooth {N}ewton Method for Variational Inequalities: {T}he Case of Box 27165 Constraints}, 27166 author = {Facchinei, Francisco and Fischer, Andreas and Kanzow, Christian}, 27167 journal = {Complementarity and Variational Problems: State of the Art}, 27168 volume = {92}, 27169 pages = {76}, 27170 year = {1997} 27171} 27172 27173@TechReport{ facchinei.fischer.ea:simply, 27174 author = {F. Facchinei and A. Fischer and C. Kanzow and J. -M. Peng}, 27175 title = {A Simply Constrained Optimization Reformulation of {KKT} Systems Arising from 27176 Variational Inequalities}, 27177 institution = {University of Hamburg}, 27178 year = {1996} 27179} 27180 27181@Article{ facchinei.jiang.ea:smoothing, 27182 author = {F. Facchinei and H. Jiang and L. Qi}, 27183 title = {A Smoothing Method for Mathematical Programs with Equilibrium Constraints}, 27184 year = {1999}, 27185 journal = {Mathematical Programming}, 27186 volume = {85}, 27187 pages = {107--134} 27188} 27189 27190@Article{ facchinei.kanzow:nonsmooth, 27191 author = {F. Facchinei and C. Kanzow}, 27192 title = {A Nonsmooth Inexact {N}ewton Method for the solution of Large-Scale Nonlinear 27193 Complementarity Problems}, 27194 year = {1997}, 27195 journal = {Mathematical Programming}, 27196 volume = {76}, 27197 pages = {493--512} 27198} 27199 27200@Article{ facchinei.kanzow:unconstrained, 27201 author = {F. Facchinei and C. Kanzow}, 27202 title = {On Unconstrained and Constrained Stationary Points of the {I}mplicit 27203 {L}agrangian}, 27204 year = {1997}, 27205 journal = {Journal of Optimization Theory and Applications}, 27206 volume = {92}, 27207 pages = {99--115} 27208} 27209 27210@TechReport{ facchinei.pang:total, 27211 author = {F. Facchinei and J. S. Pang}, 27212 title = {Total stability of variational inequalities}, 27213 institution = {Universit\'a di Roma ``La Sapienza'', Dipartimento di Informatica e Sistemistica}, 27214 year = {1988}, 27215 type = {Manuscript}, 27216 address = {Roma, Italy} 27217} 27218 27219@Article{ facchinei.soares:merit, 27220 author = {F. Facchinei and J. Soares}, 27221 title = {A New Merit Function for Nonlinear Complementarity Problems and a Related 27222 Algorithm}, 27223 journal = {SIAM Journal on Optimization}, 27224 year = {1997}, 27225 volume = {7}, 27226 pages = {225--247} 27227} 27228 27229@InCollection{ facchinei.soares:testing, 27230 author = {F. Facchinei and J. Soares}, 27231 title = {Testing a new class of algorithms for nonlinear complementarity problems}, 27232 booktitle = {Variational Inequalities and Network Equilibrium Problems}, 27233 publisher = {Plenum Press}, 27234 address = {New York}, 27235 editor = {F. Giannessi and A. Maugeri}, 27236 year = {1995}, 27237 pages = {69--83} 27238} 27239 27240@InProceedings{ fahlman.lebiere:cascade-correlation, 27241 author = {S. E. Fahlman and C. Lebiere}, 27242 title = {The cascade-correlation learning architecture}, 27243 booktitle = {Advances in Neural Information Processing Systems II {(Denver 1989)}}, 27244 year = {1990}, 27245 editor = {D. S. Touretzky}, 27246 publisher = {Morgan Kaufmann}, 27247 address = {San Mateo, California}, 27248 pages = {524--532} 27249} 27250 27251@InProceedings{ fang.geiser.ea:software, 27252 author = {G. Fang and B. Geiser and T. R. Mackie}, 27253 title = {Software system for {UW}/{GE} tomotherapy prototype}, 27254 booktitle = {Proceedings of the XII International Conference on the Use of Computers in 27255 Radiation Therapy, Salt Lake City}, 27256 year = {1997}, 27257 editor = {D. D. Leavitt and G. Starkshall}, 27258 publisher = {Medical Physics Publishing}, 27259 address = {St. Louis, Missouri}, 27260 pages = {332--334} 27261} 27262 27263@Book{ fang.puthenpura:linear, 27264 author = {S.--C. Fang and S. Puthenpura}, 27265 title = {Linear Optimization and Extensions}, 27266 year = {1993}, 27267 publisher = {Prentice-Hall, Inc}, 27268 address = {Englewood Cliffs, New Jersey} 27269} 27270 27271@Article{ fayard.plateau:algorithm, 27272 author = {D. Fayard and G. Plateau}, 27273 title = {An Algorithm for the Solution of the 0--1 Knapsack Problem}, 27274 journal = {Computing}, 27275 year = {1982}, 27276 volume = {28}, 27277 pages = {269--287} 27278} 27279 27280@Book{ feller:introduction, 27281 author = {W. Feller}, 27282 title = {An Introduction to Probability Theory and its Applications}, 27283 publisher = {John Wiley \& Sons}, 27284 year = {1968}, 27285 address = {New York} 27286} 27287 27288@Article{ ferris.fourer.ea:expressing, 27289 author = {M. C. Ferris and R. Fourer and D. M. Gay}, 27290 title = {Expressing Complementarity Problems and Communicating them to Solvers}, 27291 journal = {SIAM Journal on Optimization}, 27292 volume = {9}, 27293 pages = {991--1009}, 27294 year = {1999}, 27295 url = {ftp://ftp.cs.wisc.edu/math-prog/tech-reports/98-02.ps}, 27296 key = {65}, 27297 institution = {Computer Sciences Department, University of Wisconsin}, 27298 address = {Madison, Wisconsin}, 27299 number = {98-02}, 27300 type = {Mathematical Programming Technical Report} 27301} 27302 27303@TechReport{ ferris.horn:nlp2mcp, 27304 author = {M. C. Ferris and J. D. Horn}, 27305 title = {{NLP2MCP}: Automatic conversion of nonlinear programs into mixed complementarity 27306 problems}, 27307 year = {1998}, 27308 institution = {Computer Sciences Department, University of Wisconsin}, 27309 note = {In preparation} 27310} 27311 27312@Article{ ferris.horn:partitioning, 27313 author = {M. C. Ferris and J. D. Horn}, 27314 title = {Partitioning Mathematical Programs for Parallel Solution}, 27315 year = {1998}, 27316 volume = {80}, 27317 pages = {35--62}, 27318 url = {ftp: //ftp.cs.wisc.edu/math-prog/tech-reports/tr1232.ps}, 27319 journal = {Mathematical Programming}, 27320 key = {40} 27321} 27322 27323@Article{ ferris.kanzow.ea:feasible, 27324 author = {M. C. Ferris and C. Kanzow and T. S. Munson}, 27325 title = {Feasible Descent Algorithms for Mixed Complementarity Problems}, 27326 year = {1999}, 27327 journal = {Mathematical Programming}, 27328 volume = {86}, 27329 pages = {475--497}, 27330 url = {ftp://ftp.cs.wisc.edu/math-prog/tech-reports/98-04.ps}, 27331 key = {67} 27332} 27333 27334@InCollection{ ferris.kanzow:complementarity, 27335 author = {M. C. Ferris and C. Kanzow}, 27336 title = {Complementarity and Related Problems: {A} Survey}, 27337 booktitle = {Handbook of Applied Optimization, forthcoming}, 27338 key = {74}, 27339 publisher = {Oxford University Press}, 27340 year = {2000}, 27341 editor = {P. M. Pardalos and M. G. C. Resende}, 27342 url = {ftp://ftp.cs.wisc.edu/math-prog/tech-reports/98-17.ps}, 27343 institution = {Computer Sciences Department, University of Wisconsin}, 27344 address = {Madison, Wisconsin}, 27345 number = {98-17}, 27346 type = {Mathematical Programming Technical Report} 27347} 27348 27349@Article{ ferris.lucidi.ea:nonmonotone, 27350 author = {M. C. Ferris and S. Lucidi and M. Roma}, 27351 title = {Nonmonotone Curvilinear Stabilization Techniques for Unconstrained Optimization}, 27352 journal = {Computational Optimization and Applications}, 27353 volume = {6}, 27354 pages = {117--136}, 27355 year = {1996}, 27356 url = {ftp: //ftp.cs.wisc.edu/math-prog/tech-reports/94-16.ps}, 27357 key = {43} 27358} 27359 27360@TechReport{ ferris.lucidi:globally, 27361 author = {M. C. Ferris and S. Lucidi}, 27362 title = {Globally Convergent Methods for Nonlinear Equations}, 27363 institution = {Computer Sciences Department, University of Wisconsin}, 27364 year = {1991}, 27365 address = {Madison, Wisconsin}, 27366 number = {1030}, 27367 url = {ftp: //ftp.cs.wisc.edu/tech-reports/reports/1991/tr1030.ps}, 27368 key = {21} 27369} 27370 27371@Article{ ferris.lucidi:nonmonotone, 27372 author = {M. C. Ferris and S. Lucidi}, 27373 title = {Nonmonotone Stabilization Methods for Nonlinear Equations}, 27374 journal = {Journal of Optimization Theory and Applications}, 27375 year = {1994}, 27376 volume = {81}, 27377 pages = {53--71}, 27378 key = {30} 27379} 27380 27381@Article{ ferris.mangasarian:breast, 27382 author = {M. C. Ferris and O. L. Mangasarian}, 27383 title = {Breast Cancer Diagnosis via Linear Programming}, 27384 key = {50}, 27385 journal = {{IEEE} Computational Science and Engineering}, 27386 year = {1995}, 27387 volume = {2}, 27388 pages = {70--71} 27389} 27390 27391@Article{ ferris.mangasarian:error, 27392 author = {M. C. Ferris and O. L. Mangasarian}, 27393 title = {Error Bounds and Strong Upper Semicontinuity for Monotone Affine Variational 27394 Inequalities}, 27395 journal = {Annals of Operations Research}, 27396 year = {1993}, 27397 volume = {47}, 27398 pages = {293--305}, 27399 url = {ftp://ftp.cs.wisc.edu/tech-reports/reports/1991/tr1056a.ps}, 27400 key = {24} 27401} 27402 27403@Article{ ferris.mangasarian:finite, 27404 author = {M. C. Ferris and O. L. Mangasarian}, 27405 title = {Finite Perturbation of Convex Programs}, 27406 journal = {Applied Mathematics and Optimization}, 27407 year = {1991}, 27408 volume = {23}, 27409 pages = {263--273}, 27410 key = {08} 27411} 27412 27413@Book{ ferris.mangasarian:linear, 27414 author = {M. C. Ferris and O. L. Mangasarian}, 27415 title = {Linear Programming via {MATLAB}}, 27416 publisher = {in preparation}, 27417 year = {1995}, 27418 address = {Madison, Wisconsin} 27419} 27420 27421@Article{ ferris.mangasarian:minimum, 27422 author = {M. C. Ferris and O. L. Mangasarian}, 27423 title = {Minimum Principle Sufficiency}, 27424 journal = {Mathematical Programming}, 27425 year = {1992}, 27426 volume = {57}, 27427 pages = {1--14}, 27428 key = {11} 27429} 27430 27431@Article{ ferris.mangasarian:parallel, 27432 author = {M. C. Ferris and O. L. Mangasarian}, 27433 title = {Parallel Constraint Distribution}, 27434 journal = {SIAM Journal on Optimization}, 27435 year = {1991}, 27436 volume = {1}, 27437 pages = {487--500}, 27438 url = {ftp://ftp.cs.wisc.edu/tech-reports/reports/1990/tr971a.ps}, 27439 key = {18} 27440} 27441 27442@Article{ ferris.mangasarian:parallel*1, 27443 author = {M. C. Ferris and O. L. Mangasarian}, 27444 title = {Parallel Variable Distribution}, 27445 journal = {SIAM Journal on Optimization}, 27446 year = {1994}, 27447 volume = {4}, 27448 pages = {815--832}, 27449 url = {ftp://ftp.cs.wisc.edu/tech-reports/reports/1993/tr1175.ps}, 27450 key = {31} 27451} 27452 27453@Article{ ferris.meeraus.ea:computing, 27454 title = {Computing {W}ardropian Equilibrium in a Complementarity Framework}, 27455 author = {M. C. Ferris and A. Meeraus and T. F. Rutherford}, 27456 journal = {Optimization Methods and Software}, 27457 year = {1999}, 27458 volume = {10}, 27459 pages = {669--685}, 27460 url = {ftp://ftp.cs.wisc.edu/math-prog/tech-reports/95-03.ps}, 27461 key = {45} 27462} 27463 27464@Article{ ferris.mesnier.ea:neos, 27465 author = {M. C. Ferris and M. P. Mesnier and J. Mor\'{e}}, 27466 title = {{NEOS} and {C}ondor: Solving Nonlinear Optimization Problems over the 27467 {I}nternet}, 27468 year = {2000}, 27469 journal = {{ACM} Transactions on Mathematical Software}, 27470 key = {54}, 27471 volume = {26}, 27472 pages = {1--18}, 27473 url = {ftp://ftp.cs.wisc.edu/math-prog/tech-reports/96-08.ps}, 27474 institution = {Computer Sciences Department, University of Wisconsin}, 27475 address = {Madison, Wisconsin}, 27476 number = {96-08}, 27477 type = {Mathematical Programming Technical Report}, 27478 note = {Also available as ANL/MCS-P708-0398, Mathematics and Computer Science Division, 27479 Argonne National Laboratory}, 27480 annote = {Revised version of: The {NEOS} System for Complementarity Problems: {PATH}, 27481 1996} 27482} 27483 27484@InCollection{ ferris.meyer:models, 27485 author = {M. C. Ferris and R. R. Meyer}, 27486 title = {Models and Solution for On-Demand Data Delivery Problems}, 27487 url = {ftp://ftp.cs.wisc.edu/math-prog/tech-reports/99-04.ps}, 27488 key = {80}, 27489 booktitle = {Approximation and Complexity in Numerical Optimization: Continuous and Discrete 27490 Problems}, 27491 editor = {P. M. Pardalos}, 27492 series = {Nonconvex Optimization and its Applications}, 27493 volume = {42}, 27494 address = {Dordrect}, 27495 year = {2000}, 27496 pages = {175--188}, 27497 publisher = {Kluwer}, 27498 type = {Mathematical Programming Technical Report}, 27499 institution = {Computer Sciences Department, University of Wisconsin}, 27500 number = {99-04} 27501} 27502 27503@InProceedings{ ferris.munson.ea:homotopy, 27504 author = {M. C. Ferris and T. S. Munson and D. Ralph}, 27505 title = {A Homotopy Method for Mixed Complementarity Problems based on the {PATH} Solver}, 27506 booktitle = {Numerical Analysis 1999}, 27507 key = {88}, 27508 year = {2000}, 27509 editor = {D. F. Griffiths and G. A. Watson}, 27510 series = {Research Notes in Mathematics}, 27511 url = {ftp://ftp.cs.wisc.edu/math-prog/tech-reports/99-09.ps}, 27512 address = {London}, 27513 pages = {143--167}, 27514 publisher = {Chapman and Hall}, 27515 institution = {Computer Sciences Department, University of Wisconsin}, 27516 number = {99-09}, 27517 type = {Mathematical Programming Technical Report} 27518} 27519 27520@TechReport{ ferris.munson.ea:practical, 27521 author = {M. C. Ferris and T. S. Munson and K. Sinapiromsaran}, 27522 title = {A Practical Approach to Sample-Path Simulation Optimization}, 27523 type = {Data Mining Institute Technical Report}, 27524 institution = {Computer Sciences Department, University of Wisconsin}, 27525 address = {Madison, Wisconsin}, 27526 year = {2000}, 27527 url = {ftp://ftp.cs.wisc.edu/pub/dmi/tech-reports/00-03.ps}, 27528 number = {00-03}, 27529 key = {92}, 27530 annote = {To appear in WSC 2000} 27531} 27532 27533@InCollection{ ferris.munson:case, 27534 author = {M. C. Ferris and T. S. Munson}, 27535 title = {Case Studies in Complementarity: Improving Model Formulation}, 27536 booktitle = {Ill--Posed Variational Problems and Regularization Techniques}, 27537 key = {73}, 27538 pages = {79--98}, 27539 publisher = {Springer Verlag}, 27540 year = {1999}, 27541 editor = {M. Th\'{e}ra and R. Tichatschke}, 27542 number = {477}, 27543 series = {Lecture Notes in Economics and Mathematical Systems}, 27544 address = {Berlin}, 27545 url = {ftp://ftp.cs.wisc.edu/math-prog/tech-reports/98-16.ps}, 27546 type = {Mathematical Programming Technical Report}, 27547 institution = {Computer Sciences Department, University of Wisconsin} 27548} 27549 27550@Article{ ferris.munson:complementarity, 27551 author = {M. C. Ferris and T. S. Munson}, 27552 title = {Complementarity Problems in {GAMS} and the {PATH} Solver}, 27553 year = {2000}, 27554 volume = {24}, 27555 pages = {165--188}, 27556 journal = {Journal of Economic Dynamics and Control}, 27557 url = {ftp://ftp.cs.wisc.edu/math-prog/tech-reports/98-12.ps}, 27558 key = {70}, 27559 type = {Mathematical Programming Technical Report}, 27560 institution = {Computer Sciences Department, University of Wisconsin}, 27561 address = {Madison, Wisconsin}, 27562 number = {98-12} 27563} 27564 27565@Misc{ ferris.munson:condor, 27566 author = {M. C. Ferris and T. S. Munson}, 27567 title = {Condor Modeling Language Interface}, 27568 organization = {Computer Sciences Department, University of Wisconsin}, 27569 address = {Madison, Wisconsin}, 27570 note = {ftp://ftp.cs.wisc.edu/math-prog/condor} 27571} 27572 27573@Manual{ ferris.munson:gams, 27574 author = {M. C. Ferris and T. S. Munson}, 27575 title = {{GAMS}/{PATH} User Guide: Version 4.3}, 27576 organization = {Department of Computer Sciences, University of Wisconsin, Madison} 27577} 27578 27579@Article{ ferris.munson:interfaces, 27580 author = {M. C. Ferris and T. S. Munson}, 27581 title = {Interfaces to {PATH} 3.0: Design, Implementation and Usage}, 27582 journal = {Computational Optimization and Applications}, 27583 volume = {12}, 27584 pages = {207--227}, 27585 year = {1999}, 27586 url = {ftp://ftp.cs.wisc.edu/math-prog/tech-reports/97-12.ps}, 27587 key = {63}, 27588 institution = {Computer Sciences Department, University of Wisconsin}, 27589 address = {Madison, Wisconsin}, 27590 number = {97-12}, 27591 type = {Mathematical Programming Technical Report} 27592} 27593 27594@TechReport{ ferris.munson:interior, 27595 author = {M. C. Ferris and T. S. Munson}, 27596 title = {Interior Point Methods for Massive Support Vector Machines}, 27597 institution = {Computer Sciences Department, University of Wisconsin}, 27598 year = {2000}, 27599 key = {94}, 27600 type = {Data Mining Institute Technical Report}, 27601 number = {00-05}, 27602 url = {ftp://ftp.cs.wisc.edu/pub/dmi/tech-reports/00-05.ps}, 27603 address = {Madison, Wisconsin}, 27604 annote = {Submitted to SIOPT} 27605} 27606 27607@Article{ ferris.munson:linear, 27608 author = {M. C. Ferris and T. S. Munson}, 27609 title = {Linear Programming for Emergency Broadcast Systems}, 27610 year = {1999}, 27611 journal = {{SIAG/OPT} Newsletter}, 27612 volume = {10}, 27613 pages = {6--8}, 27614 url = {ftp://ftp.cs.wisc.edu/math-prog/tech-reports/98-20.ps}, 27615 key = {76}, 27616 type = {Mathematical Programming Technical Report}, 27617 institution = {Computer Sciences Department, University of Wisconsin}, 27618 address = {Madison, Wisconsin}, 27619 number = {98-20} 27620} 27621 27622@Article{ ferris.munson:modeling, 27623 author = {M. C. Ferris and T. S. Munson}, 27624 title = {Modeling Languages and {C}ondor: Metacomputing for Optimization}, 27625 year = {2000}, 27626 journal = {Mathematical Programming}, 27627 volume = {88}, 27628 pages = {487--506}, 27629 url = {ftp://ftp.cs.wisc.edu/math-prog/tech-reports/98-13.ps}, 27630 key = {71}, 27631 type = {Mathematical Programming Technical Report}, 27632 institution = {Computer Sciences Department, University of Wisconsin}, 27633 address = {Madison, Wisconsin}, 27634 number = {98-13} 27635} 27636 27637@TechReport{ ferris.munson:preprocessing, 27638 author = {M. C. Ferris and T. S. Munson}, 27639 title = {Preprocessing Complementarity Problems}, 27640 type = {Mathematical Programming Technical Report}, 27641 institution = {Computer Sciences Department, University of Wisconsin}, 27642 address = {Madison, Wisconsin}, 27643 year = {1999}, 27644 url = {ftp://ftp.cs.wisc.edu/math-prog/tech-reports/99-07.ps}, 27645 number = {99-07}, 27646 key = {86}, 27647 annote = {Submitted to ICCP 99} 27648} 27649 27650@TechReport{ ferris.munson:semismooth, 27651 author = {M. C. Ferris and T. S. Munson}, 27652 title = {Semismooth Support Vector Machines}, 27653 institution = {Computer Sciences Department, University of Wisconsin}, 27654 year = {2000}, 27655 key = {97}, 27656 type = {Data Mining Institute Technical Report}, 27657 number = {00-09}, 27658 url = {ftp://ftp.cs.wisc.edu/pub/dmi/tech-reports/00-09.ps}, 27659 address = {Madison, Wisconsin}, 27660 annote = {Submitted to Math Prog B} 27661} 27662 27663@Article{ ferris.pang:engineering, 27664 author = {M. C. Ferris and J. S. Pang}, 27665 title = {Engineering and Economic Applications of Complementarity Problems}, 27666 year = {1997}, 27667 journal = {SIAM Review}, 27668 volume = {39}, 27669 pages = {669--713}, 27670 url = {http: //www.siam.org/journals/sirev/39-4/28596.html}, 27671 key = {46} 27672} 27673 27674@Article{ ferris.pang:nondegenerate, 27675 author = {M. C. Ferris and J. S. Pang}, 27676 title = {Nondegenerate Solutions and Related Concepts in Affine Variational Inequalities}, 27677 journal = {SIAM Journal on Control and Optimization}, 27678 year = {1996}, 27679 volume = {34}, 27680 pages = {244--263}, 27681 url = {ftp://ftp.cs.wisc.edu/tech-reports/reports/1994/tr1203.ps}, 27682 key = {35} 27683} 27684 27685@Article{ ferris.philpott:affine, 27686 author = {M. C. Ferris and A. B. Philpott}, 27687 title = {On Affine Scaling and Semi--Infinite Programming}, 27688 journal = {Mathematical Programming}, 27689 year = {1992}, 27690 volume = {56}, 27691 pages = {361--364}, 27692 key = {15} 27693} 27694 27695@Article{ ferris.philpott:interior, 27696 author = {M. C. Ferris and A. B. Philpott}, 27697 title = {An Interior Point Algorithm for Semi--Infinite Linear Programming}, 27698 journal = {Mathematical Programming}, 27699 year = {1989}, 27700 volume = {43}, 27701 pages = {257--276}, 27702 key = {04} 27703} 27704 27705@Article{ ferris.philpott:performance, 27706 author = {M. C. Ferris and A. B. Philpott}, 27707 title = {On the Performance of {K}armarkar's Algorithm}, 27708 journal = {Journal of the Operational Research Society}, 27709 year = {1988}, 27710 volume = {39}, 27711 pages = {257--270}, 27712 key = {03} 27713} 27714 27715@InCollection{ ferris.ralph:projected, 27716 author = {M. C. Ferris and D. Ralph}, 27717 title = {Projected Gradient Methods for Nonlinear Complementarity Problems via Normal 27718 Maps}, 27719 booktitle = {Recent Advances in Nonsmooth Optimization}, 27720 publisher = {World Scientific Publishers}, 27721 year = {1995}, 27722 pages = {57--87}, 27723 editor = {D. Du and L. Qi and R. Womersley}, 27724 url = {ftp://ftp.cs.wisc.edu/math-prog/tech-reports/94-08.ps}, 27725 key = {41} 27726} 27727 27728@Article{ ferris.ruszczynski:robust, 27729 author = {M. C. Ferris and A. Ruszczy{\'{n}}ski}, 27730 title = {Robust Path Choice and Vehicle Guidance in Networks with Failures}, 27731 year = {2000}, 27732 journal = {Networks}, 27733 volume = {35}, 27734 pages = {181--194}, 27735 url = {ftp://ftp.cs.wisc.edu/math-prog/tech-reports/97-04.ps}, 27736 key = {60} 27737} 27738 27739@InCollection{ ferris.rutherford:accessing, 27740 author = {M. C. Ferris and T. F. Rutherford}, 27741 title = {Accessing Realistic Complementarity Problems within {Matlab}}, 27742 booktitle = {Nonlinear Optimization and Applications}, 27743 key = {48}, 27744 url = {ftp://ftp.cs.wisc.edu/math-prog/tech-reports/95-10.ps}, 27745 editor = {G. Di Pillo and F. Giannessi}, 27746 year = {1996}, 27747 pages = {141--153}, 27748 publisher = {Plenum Press}, 27749 address = {New York} 27750} 27751 27752@InCollection{ ferris.shepard:optimizing, 27753 author = {M. C. Ferris and D. M. Shepard}, 27754 title = {Optimization of Gamma Knife Radiosurgery}, 27755 booktitle = {Discrete Mathematical Problems with Medical Applications, forthcoming}, 27756 editor = {D.-Z. Du and P. Pardolas and J. Wang}, 27757 publisher = {AMS}, 27758 year = {2000}, 27759 optseries = {DIMACS}, 27760 url = {ftp://ftp.cs.wisc.edu/pub/dmi/tech-reports/00-01.ps}, 27761 key = {91}, 27762 type = {Data Mining Institute Technical Report}, 27763 institution = {Computer Sciences Department, University of Wisconsin}, 27764 address = {Madison, Wisconsin}, 27765 number = {00-01} 27766} 27767 27768@InCollection{ ferris.sinapiromsaran:formulating, 27769 author = {M. C. Ferris and K. Sinapiromsaran}, 27770 title = {Formulating and Solving Nonlinear Programs as Mixed Complementarity Problems}, 27771 booktitle = {Optimization}, 27772 key = {77}, 27773 publisher = {Springer-Verlag}, 27774 year = {2000}, 27775 editor = {V.H. Nguyen and J. J. Strodiot and P. Tossings}, 27776 volume = {481}, 27777 series = {Lecture Notes in Economics and Mathematical Systems}, 27778 url = {ftp://ftp.cs.wisc.edu/math-prog/tech-reports/98-21.ps}, 27779 type = {Mathematical Programming Technical Report}, 27780 institution = {Computer Sciences Department, University of Wisconsin}, 27781 address = {Madison, Wisconsin}, 27782 number = {98-21} 27783} 27784 27785@Article{ ferris.tin-loi:limit, 27786 author = {M. C. Ferris and F. Tin-Loi}, 27787 title = {Limit Analysis of Frictional Block Assemblies as a Mathematical Program with 27788 Complementarity Constraints}, 27789 year = {2001}, 27790 url = {ftp://ftp.cs.wisc.edu/math-prog/tech-reports/99-01.ps}, 27791 key = {78}, 27792 journal = {International Journal of Mechanical Sciences}, 27793 pages = {209--224}, 27794 volume = {43}, 27795 type = {Mathematical Programming Technical Report}, 27796 institution = {Computer Sciences Department, University of Wisconsin}, 27797 address = {Madison, Wisconsin}, 27798 number = {99-01} 27799} 27800 27801@Article{ ferris.tin-loi:nonlinear, 27802 author = {M. C. Ferris and F. Tin-Loi}, 27803 title = {Nonlinear Programming Approach for a Class of Inverse Problems in 27804 Elastoplasticity}, 27805 year = {1998}, 27806 key = {64}, 27807 volume = {6}, 27808 pages = {857--870}, 27809 journal = {Structural Engineering and Mechanics} 27810} 27811 27812@Article{ ferris.tin-loi:solution, 27813 author = {M. C. Ferris and F. Tin-Loi}, 27814 title = {On the Solution of a Minimum Weight Elastoplastic Problem involving Displacement 27815 and Complementarity Constraints}, 27816 year = {1999}, 27817 journal = {Computer Methods in Applied Mechanics and Engineering}, 27818 volume = {174}, 27819 pages = {107--120}, 27820 url = {ftp://ftp.cs.wisc.edu/math-prog/tech-reports/minwt.ps}, 27821 key = {66} 27822} 27823 27824@Article{ ferris.vlach:scheduling, 27825 author = {M. C. Ferris and M. Vlach}, 27826 title = {Scheduling with Earliness and Tardiness Penalties}, 27827 journal = {Naval Research Logistics Quarterly}, 27828 year = {1992}, 27829 volume = {39}, 27830 pages = {229--245}, 27831 key = {13} 27832} 27833 27834@TechReport{ ferris.zavriev:linear, 27835 author = {M. C. Ferris and S. K Zavriev}, 27836 title = {The Linear Convergence of a Successive Linear Programming Algorithm}, 27837 institution = {Computer Sciences Department, University of Wisconsin}, 27838 year = {1996}, 27839 key = {56}, 27840 address = {Madison, Wisconsin}, 27841 type = {Mathematical Programming Technical Report}, 27842 number = {96--12}, 27843 url = {ftp://ftp.cs.wisc.edu/math-prog/tech-reports/96-12.ps} 27844} 27845 27846@Article{ ferris:finite, 27847 author = {M. C. Ferris}, 27848 title = {Finite Termination of the Proximal Point Algorithm}, 27849 journal = {Mathematical Programming}, 27850 year = {1991}, 27851 volume = {50}, 27852 pages = {359--366}, 27853 key = {06} 27854} 27855 27856@Article{ ferris:iterative, 27857 author = {M. C. Ferris}, 27858 title = {Iterative Linear Programming Solution of Convex Programs}, 27859 journal = {Journal of Optimization Theory and Applications}, 27860 year = {1990}, 27861 volume = {65}, 27862 pages = {53--65}, 27863 key = {07} 27864} 27865 27866@Article{ ferris:linear, 27867 author = {M. C. Ferris}, 27868 title = {The Linear Complementarity Problem}, 27869 journal = {Bulletin of the American Mathematical Society}, 27870 year = {1993}, 27871 volume = {28}, 27872 pages = {169--175}, 27873 key = {27} 27874} 27875 27876@MastersThesis{ ferris:linear*1, 27877 author = {M. C. Ferris}, 27878 title = {Linear Programming and Minimum Weight Design -- {A} Comparison of Methods for 27879 Solving a Class of Structural Optimization Problems}, 27880 year = {1985}, 27881 school = {University of Cambridge}, 27882 address = {England}, 27883 key = {01} 27884} 27885 27886@TechReport{ ferris:matlab, 27887 author = {M. C. Ferris}, 27888 title = {{MATLAB} and {GAMS}: Interfacing Optimization and Visualization Software}, 27889 institution = {Computer Sciences Department, University of Wisconsin}, 27890 year = {1998}, 27891 address = {Madison, Wisconsin}, 27892 type = {Mathematical Programming Technical Report}, 27893 url = {ftp://ftp.cs.wisc.edu/math-prog/tech-reports/98-19.ps}, 27894 number = {98-19}, 27895 key = {75} 27896} 27897 27898@Article{ ferris:parallel, 27899 author = {M. C. Ferris}, 27900 title = {Parallel Constraint Distribution for Convex Quadratic Programs}, 27901 journal = {Mathematics of Operations Research}, 27902 year = {1994}, 27903 volume = {19}, 27904 pages = {645--658}, 27905 url = {ftp://ftp.cs.wisc.edu/tech-reports/reports/1991/tr1009a.ps}, 27906 key = {20} 27907} 27908 27909@TechReport{ ferris:parallel*1, 27910 author = {M. C. Ferris}, 27911 title = {Parallel Solution of Extremely Large Knapsack Problems}, 27912 institution = {Computer Sciences Department, University of Wisconsin}, 27913 year = {1989}, 27914 address = {Madison, Wisconsin}, 27915 number = {842}, 27916 key = {09} 27917} 27918 27919@PhDThesis{ ferris:weak, 27920 author = {M. C. Ferris}, 27921 title = {Weak Sharp Minima and Penalty Functions in Mathematical Programming}, 27922 year = {1988}, 27923 school = {University of Cambridge}, 27924 address = {England}, 27925 key = {02} 27926} 27927 27928@TechReport{ ferris:weak*1, 27929 author = {M. C. Ferris}, 27930 title = {Weak Sharp Minima and Penalty Functions in Mathematical Programming}, 27931 institution = {Computer Sciences Department, University of Wisconsin}, 27932 year = {1988}, 27933 address = {Madison, Wisconsin}, 27934 number = {779}, 27935 key = {05} 27936} 27937 27938@Book{ fiacco.mccormick:nonlinear, 27939 author = {A. V. Fiacco and G. P. McCormick}, 27940 title = {Nonlinear Programming: Sequential Unconstrained Minimization Techniques}, 27941 year = {1968}, 27942 publisher = {John Wiley \& Sons}, 27943 address = {New York}, 27944 note = {SIAM Classics in Applied Mathematics 4, SIAM, Philadelphia, 1990} 27945} 27946 27947@Book{ fiacco:introduction, 27948 author = {A. V. Fiacco}, 27949 title = {Introduction to Sensitivity and Stability Analysis in Nonlinear Programming}, 27950 year = {1983}, 27951 publisher = {Academic Press}, 27952 address = {New York} 27953} 27954 27955@Article{ fiedler.ptak:matrices, 27956 author = {M. Fiedler and V. Pt\'{a}k}, 27957 title = {On matrices with nonpositive off-diagonal elements and positive principal 27958 minors}, 27959 journal = {Czechoslovak Mathematics Journal}, 27960 volume = {12}, 27961 pages = {382--400}, 27962 year = {1962} 27963} 27964 27965@Article{ fischer.kanzow:finite, 27966 author = {A. Fischer and C. Kanzow}, 27967 title = {On Finite Termination of an Iterative Method for Linear Complementarity 27968 Problems}, 27969 journal = {Mathematical Programming}, 27970 volume = {74}, 27971 pages = {279--292}, 27972 year = {1996} 27973} 27974 27975@TechReport{ fischer:constrained, 27976 author = {A. Fischer}, 27977 title = {A New Constrained Optimization Reformulation for Complementarity Problems}, 27978 institution = {Institute of Numerical Mathematics, Technical University of Dresden}, 27979 year = {1995}, 27980 type = {Technical Report}, 27981 number = {MATH-NM-10-1995}, 27982 address = {Dresden} 27983} 27984 27985@Article{ fischer:local, 27986 author = {A. Fischer}, 27987 title = {On the local superlinear convergence of a {N}ewton-type method for {LCP} under 27988 weak conditions}, 27989 journal = {Optimization Methods and Software}, 27990 year = {1995}, 27991 volume = {6}, 27992 pages = {83--107} 27993} 27994 27995@InCollection{ fischer:ncp-function, 27996 author = {A. Fischer}, 27997 title = {An {NCP}--Function and its Use for the Solution of Complementarity Problems}, 27998 booktitle = {Recent Advances in Nonsmooth Optimization}, 27999 publisher = {World Scientific Publishers}, 28000 editor = {D. Z. Du and L. Qi and R. S. Womersley}, 28001 year = {1995}, 28002 pages = {88--105} 28003} 28004 28005@Article{ fischer:newton-type, 28006 author = {A. Fischer}, 28007 title = {A {N}ewton-Type Method for Positive Semidefinite Linear Complementarity 28008 Problems}, 28009 journal = {Journal of Optimization Theory and Applications}, 28010 year = {1995}, 28011 volume = {86}, 28012 pages = {585--608} 28013} 28014 28015@Article{ fischer:solution, 28016 author = {A. Fischer}, 28017 title = {Solution of Monotone Complementarity Problems with Locally {L}ipschitzian 28018 Functions}, 28019 year = {1997}, 28020 journal = {Mathematical Programming}, 28021 pages = {513--532} 28022} 28023 28024@Article{ fischer:special, 28025 author = {A. Fischer}, 28026 title = {A Special {N}ewton--Type Optimization Method}, 28027 journal = {Optimization}, 28028 year = {1992}, 28029 volume = {24}, 28030 pages = {269--284} 28031} 28032 28033@Article{ fisher:use, 28034 author = {R. A. Fisher}, 28035 title = {The Use of Multiple Measurements in Taxonomic Problems}, 28036 journal = {Annual Eugenics}, 28037 year = {1936}, 28038 volume = {7}, 28039 number = {Part II}, 28040 pages = {179--188} 28041} 28042 28043@Book{ fishman:principles, 28044 author = {G. Fishman}, 28045 title = {Principles of Discrete Event Simulation}, 28046 publisher = {Wiley}, 28047 address = {New York, NY}, 28048 year = {1978} 28049} 28050 28051@Article{ fitchard.aldridge.ea:registration, 28052 author = {E. E. Fitchard and J. S. Aldridge and P. J. Reckwerdt and T. R. Mackie}, 28053 title = {Registration of Synthetic Tomographic Projection Data Sets Using 28054 Cross-Correlation}, 28055 journal = {Physics in Medicine and Biology}, 28056 year = {1998}, 28057 volume = {43}, 28058 pages = {1645--1657} 28059} 28060 28061@Article{ fletcher.matthews:stable, 28062 author = {R. Fletcher and S. P. J. Matthews}, 28063 title = {Stable Modifications of Explicit {LU} Factors for Simplex Updates}, 28064 journal = {Mathematical Programming}, 28065 year = {1984}, 28066 volume = {30}, 28067 pages = {267--284} 28068} 28069 28070@TechReport{ fletcher.maza:nonlinear, 28071 author = {R. Fletcher and E. Sainz de la Maza}, 28072 title = {Nonlinear Programming and Nonsmooth Optimization by Successive Linear 28073 Programming}, 28074 institution = {Department of Mathematical Sciences}, 28075 year = {1987}, 28076 address = {The University, Dundee, Scotland}, 28077 number = {NA/100}, 28078 type = {Numerical Analysis Report} 28079} 28080 28081@InCollection{ fletcher:class, 28082 author = {R. Fletcher}, 28083 title = {A Class of Methods for Nonlinear Programming with Termination and Convergence 28084 Properties}, 28085 booktitle = {Integer and Nonlinear Programming}, 28086 year = {1970}, 28087 editor = {J. Abadie}, 28088 publisher = {North--Holland}, 28089 address = {Amsterdam}, 28090 pages = {157--173} 28091} 28092 28093@Article{ fletcher:exact, 28094 author = {R. Fletcher}, 28095 title = {An Exact Penalty Function for Nonlinear Programming with Inequalities}, 28096 journal = {Mathematical Programming}, 28097 year = {1973}, 28098 volume = {5}, 28099 pages = {129--150} 28100} 28101 28102@Article{ fletcher:generalized, 28103 author = {R. Fletcher}, 28104 title = {Generalized Inverse Methods for the Best Least Squares Solution of Non--Linear 28105 Equations}, 28106 journal = {The Computer Journal}, 28107 year = {1968}, 28108 volume = {10}, 28109 pages = {392--399} 28110} 28111 28112@InProceedings{ fletcher:penalty, 28113 crossref = {bachem.grotschel.ea:mathematical}, 28114 author = {R. Fletcher}, 28115 title = {Penalty Functions}, 28116 pages = {87--114} 28117} 28118 28119@Book{ fletcher:practical, 28120 author = {R. Fletcher}, 28121 title = {Practical Methods of Optimization}, 28122 year = {1981}, 28123 publisher = {John Wiley \& Sons}, 28124 address = {Chichester}, 28125 volume = {1} 28126} 28127 28128@Book{ fletcher:practical*1, 28129 author = {R. Fletcher}, 28130 title = {Practical Methods of Optimization}, 28131 year = {1981}, 28132 publisher = {John Wiley \& Sons}, 28133 address = {Chichester}, 28134 volume = {2} 28135} 28136 28137@Book{ fletcher:practical*2, 28138 author = {R. Fletcher}, 28139 title = {Practical Methods of Optimization}, 28140 year = {1987}, 28141 publisher = {John Wiley \& Sons}, 28142 address = {New York}, 28143 edition = {second} 28144} 28145 28146@Unpublished{ fletcher:recent, 28147 author = {R. Fletcher}, 28148 title = {Recent Developments in Nonlinear Programming}, 28149 note = {Presentation at SOR 96, Braunchweig, Germany}, 28150 year = {1996} 28151} 28152 28153@InCollection{ fletcher:second, 28154 author = {R. Fletcher}, 28155 title = {Second Order Correction for Nondifferentiable Optimization}, 28156 booktitle = {Numerical Analysis}, 28157 year = {1982}, 28158 editor = {G. A. Watson}, 28159 publisher = {Springer-Verlag}, 28160 address = {Berlin}, 28161 pages = {85--114} 28162} 28163 28164@InCollection{ florian:mathematical, 28165 author = {M. Florian}, 28166 title = {Mathematical programming applications in national, regional, and urban planning}, 28167 editors = {M. Iri and K. Tanabe}, 28168 booktitle = {Mathematical Programming: Recent Developments and Applications}, 28169 publisher = {Kluwer Academic Publishers}, 28170 address = {Tokyo}, 28171 year = {1989} 28172} 28173 28174@Article{ florian:nonlinear, 28175 author = {M. Florian}, 28176 title = {Nonlinear Cost Network Models in Transportation Analysis}, 28177 journal = {Mathematical Programming Study}, 28178 year = {1986}, 28179 volume = {26}, 28180 pages = {167--196} 28181} 28182 28183@Article{ flynn:computer, 28184 author = {M.~J. Flynn}, 28185 title = {Some Computer Organizations and their Effectiveness}, 28186 journal = {IEEE Transactions on Computers}, 28187 year = {1972}, 28188 volume = {C-21}, 28189 pages = {948--960} 28190} 28191 28192@InProceedings{ fogarty:varying, 28193 crossref = {schaeffer:third}, 28194 author = {T. C. Fogarty}, 28195 title = {Varying the Probability of Mutation in the Genetic Algorithm}, 28196 pages = {422--427} 28197} 28198 28199@Article{ forrest.goldfarb:steepest-edge, 28200 author = {J. J. Forrest and D. Goldfarb}, 28201 title = {Steepest--Edge Simplex Algorithms for Linear Programming}, 28202 journal = {Mathematical Programming}, 28203 year = {1992}, 28204 volume = {57}, 28205 pages = {341--374} 28206} 28207 28208@Article{ forrest.tomlin:updating, 28209 author = {J. J. H. Forrest and J. A. Tomlin}, 28210 title = {Updating Triangular Factors of the Basis to Maintain Sparsity in the Product Form 28211 Simplex Method}, 28212 journal = {Mathematical Programming}, 28213 year = {1972}, 28214 volume = {2}, 28215 pages = {263--278} 28216} 28217 28218@TechReport{ forsgren.gill.ea:computing, 28219 author = {A. Forsgren and P. E. Gill and W. Murray}, 28220 title = {Computing Modified {N}ewton Directions using a Partial {C}holesky Factorization}, 28221 institution = {Department of Mathematics, Royal Institute of Technology}, 28222 year = {1993}, 28223 number = {TRITA-MAT-1993-9}, 28224 address = {Stockholm, Sweden} 28225} 28226 28227@TechReport{ forsgren.gill:primal-dual, 28228 author = {A. Forsgren and P. E. Gill}, 28229 title = {Primal-Dual Interior Methods for Nonconvex Nonlinear Programming}, 28230 institution = {Department of Mathematics, University of California}, 28231 year = {1996}, 28232 type = {Report NA}, 28233 number = {96-3}, 28234 address = {San Diego} 28235} 28236 28237@InCollection{ fortin.glowinski:decomposition-coordination, 28238 author = {M. Fortin and R. Glowinski}, 28239 title = {On Decomposition-Coordination Methods Using an Augmented Lagrangian}, 28240 booktitle = {Augmented Lagrangian methods: Applications to the Solution of Boundary Value 28241 Problems}, 28242 publisher = {North-Holland}, 28243 year = {1983}, 28244 editor = {M. Fortin and R. Glowinski}, 28245 address = {Amsterdam} 28246} 28247 28248@Misc{ foster.kesselman:globus, 28249 author = {I. Foster and C. Kesselman}, 28250 title = {The Globus Project}, 28251 howpublished = {www.globus.org} 28252} 28253 28254@Article{ foster.kesselman:globus*1, 28255 author = {I. Foster and C. Kesselman}, 28256 title = {Globus: A Metacomputing Infrastructure Toolkit}, 28257 journal = {International Journal of Supercomputer Applications}, 28258 volume = {11}, 28259 pages = {115--128}, 28260 year = {1997} 28261} 28262 28263@Book{ foster.kesselman:grid, 28264 editor = {I. Foster and C. Kesselman}, 28265 title = {The Grid: Blueprint for a Future Computing Infrastructure}, 28266 publisher = {Morgan Kaufmann Publishers}, 28267 year = {1999} 28268} 28269 28270@Book{ fourer.gay.ea:ampl, 28271 author = {R. Fourer and D. M. Gay and B. W. Kernighan}, 28272 title = {{AMPL}: {A} Modeling Language for Mathematical Programming}, 28273 year = {1993}, 28274 publisher = {Duxbury Press} 28275} 28276 28277@Article{ fourer.gay.ea:modeling, 28278 author = {R. Fourer and D. M. Gay and B. W. Kernighan}, 28279 title = {A Modeling Language for Mathematical Programming}, 28280 journal = {Management Science}, 28281 year = {1990}, 28282 volume = {36}, 28283 pages = {519--554} 28284} 28285 28286@Article{ fraass:development, 28287 author = {A. Fraass}, 28288 title = {The development of conformal radiation therapy}, 28289 journal = {Medical Physics}, 28290 year = {1995}, 28291 volume = {22}, 28292 number = {11}, 28293 pages = {1911--1921} 28294} 28295 28296@TechReport{ fraley:algorithms, 28297 author = {C. Fraley}, 28298 title = {Algorithms for Nonlinear Least Squares}, 28299 institution = {Stanford University}, 28300 year = {1988}, 28301 number = {{SOL} 88.16}, 28302 type = {Technical Report} 28303} 28304 28305@InCollection{ francois.mcdonald.ea:uruguay, 28306 author = {J. F. Francois and B. McDonald and H. Nordstrom}, 28307 title = {The {U}ruguay Round: {A} Numerically Based Qualitative Assessment}, 28308 booktitle = {The {U}ruguay Round and the Developing Economies}, 28309 address = {New York}, 28310 editors = {W. Martin and L. A. Winters}, 28311 publisher = {Cambridge University Press} 28312} 28313 28314@InCollection{ francois.mcdonald.ea:uruguay*1, 28315 author = {J. F. Francois and B. McDonald and H. Nordstrom}, 28316 title = {The {U}ruguay Round: {A} Global Analysis}, 28317 booktitle = {Challenges and Opportunities for East Asian Trade}, 28318 address = {Cambridge}, 28319 editors = {D. Robertson}, 28320 publisher = {Cambridge University Press} 28321} 28322 28323@Article{ frank.wolfe:algorithm, 28324 author = {M. Frank and P. Wolfe}, 28325 title = {An Algorithm for Quadratic Programming}, 28326 journal = {Naval Research Logistics Quarterly}, 28327 year = {1956}, 28328 volume = {3}, 28329 pages = {95--110} 28330} 28331 28332@Article{ freund.nachtigal:qmrpack, 28333 author = {R. W. Freund and N. M. Nachtigal}, 28334 title = {{QMRPACK}: {A} Package of {QMR} Algorithms}, 28335 journal = {{ACM} Transactions on Mathematical Software}, 28336 year = {1996}, 28337 volume = {22}, 28338 pages = {46--77} 28339} 28340 28341@InProceedings{ freund.schapire:experiments, 28342 author = {Y. Freund and R. E. Schapire}, 28343 title = {Experiments with a New Boosting Algorithm}, 28344 booktitle = {Machine Learning: Proceedings of the Thirteenth National Conference}, 28345 pages = {148--156}, 28346 year = {1996}, 28347 editor = {L. Saitta}, 28348 publisher = {Morgan Kaufmann} 28349} 28350 28351@Unpublished{ freund.todd:barrier, 28352 author = {Robert M. Freund and Michael J. Todd}, 28353 title = {Barrier functions and interior-point algorithms for linear programming with 28354 zero-, one-, or two-sided bounds on the variables}, 28355 year = {1992}, 28356 month = jul 28357} 28358 28359@Article{ friedman.chernina:iterative, 28360 author = {V. M. Friedman and V. S. Chernina}, 28361 title = {Iterative Methods Applied to the Solution of Contact Problems Between Bodies}, 28362 note = {In Russian}, 28363 journal = {Mekhanika Tvergodo Tela Academia Nauk SSSR}, 28364 volume = {1}, 28365 pages = {116--120}, 28366 year = {1967} 28367} 28368 28369@Article{ friesz.bernstein.ea:day-to-day, 28370 author = {T. L. Friesz and D. Bernstein and N. J. Mehta and R. L. Tobin and S. 28371 Ganjalizadeh}, 28372 title = {Day-to-day Dynamic Network Disequilibria and Idealized Traveller Information 28373 Systems}, 28374 journal = {Operations Research}, 28375 year = {1994}, 28376 volume = {42}, 28377 pages = {1120--1136} 28378} 28379 28380@Article{ friesz.tobin.ea:nonlinear, 28381 author = {T. L. Friesz and R. L. Tobin and T. E. Smith and P. T. Harker}, 28382 title = {A Nonlinear Complementarity Formulation and Solution Procedure for the General 28383 Derived Demand Network Equilibrium Problem}, 28384 journal = {Journal of Regional Science}, 28385 year = {1983}, 28386 volume = {23}, 28387 pages = {337--359} 28388} 28389 28390@Article{ friesz:network, 28391 author = {T. L. Friesz}, 28392 title = {Network Equilibrium, Design and Aggregation}, 28393 journal = {Transportation Research}, 28394 volume = {19A}, 28395 year = {1985}, 28396 pages = {413--427} 28397} 28398 28399@Unpublished{ frisch:logarithmic, 28400 author = {K. R. Frisch}, 28401 title = {The Logarithmic Potential Method of Convex Programming}, 28402 year = {1955}, 28403 note = {Unpublished manuscript, University Institute of Economics, Oslo} 28404} 28405 28406@Book{ fukunaga:statistical, 28407 author = {K. Fukunaga}, 28408 title = {Statistical Pattern Recognition}, 28409 year = {1990}, 28410 publisher = {Academic Press}, 28411 address = {New York} 28412} 28413 28414@Article{ fukushima.luo.ea:globally, 28415 author = {M. Fukushima and Z.--Q. Luo and J. S. Pang}, 28416 title = {A Globally Convergent Sequential Quadratic Programming Algorithm for Mathematical 28417 Programs with Linear Complementarity Constraints}, 28418 journal = {Computational Optimization and Applications}, 28419 year = {1998}, 28420 volume = {10}, 28421 pages = {5--34} 28422} 28423 28424@Article{ fukushima:equivalent, 28425 author = {M. Fukushima}, 28426 title = {Equivalent Differentiable Optimization Problems and Descent Methods for 28427 Asymmetric Variational Inequality Problems}, 28428 journal = {Mathematical Programming}, 28429 year = {1992}, 28430 volume = {53}, 28431 pages = {99--110} 28432} 28433 28434@Article{ fukushima:primal, 28435 author = {M. Fukushima}, 28436 title = {The Primal {D}ouglas-{R}achford Splitting Algorithm for a Class of Monotone 28437 Mappings with Application to the Traffic Equilibrium Problem}, 28438 journal = {Mathematical Programming}, 28439 year = {1996}, 28440 volume = {72}, 28441 pages = {1--15} 28442} 28443 28444@Article{ gabay.mercier:dual, 28445 author = {D. Gabay and B. Mercier}, 28446 title = {A Dual Algorithm for the Solution of Nonlinear Variational Inequalities via 28447 Finite Element Approximations}, 28448 journal = {Computational Mathematics and Applications}, 28449 year = {1976}, 28450 volume = {2}, 28451 pages = {17--48} 28452} 28453 28454@InCollection{ gabay:applications, 28455 author = {D. Gabay}, 28456 title = {Applications of the Method of Multipliers to Variational Inequalities}, 28457 booktitle = {Augmented {L}agrangian Methods: Applications to the Solution of Boundary Value 28458 Problems}, 28459 publisher = {North-Holland}, 28460 year = {1983}, 28461 editor = {M. Fortin and R. Glowinski}, 28462 address = {Amsterdam} 28463} 28464 28465@Unpublished{ gabriel.bernstein:path, 28466 author = {S. A. Gabriel and D. Berstein}, 28467 title = {A Path Generation Method for the Nonadditive, Asymmetric, Elastic Traffic 28468 Equilibrium Problem}, 28469 note = {Draft, 1995} 28470} 28471 28472@TechReport{ gabriel.kydes:nonlinear, 28473 author = {S. A. Gabriel and A. S. Kydes}, 28474 title = {A Nonlinear Complementarity Approach for Solving the National Energy Modeling 28475 System}, 28476 institution = {Mathematics and Computer Science Division, Argonne National Laboratory}, 28477 year = {1995}, 28478 type = {Preprint}, 28479 number = {MCS-P504-0395}, 28480 address = {Argonne, Illinois}, 28481 month = mar 28482} 28483 28484@InProceedings{ gabriel.more:smoothing, 28485 crossref = {ferris.pang:complementarity}, 28486 author = {S. A. Gabriel and J. J. Mor\'{e}}, 28487 title = {Smoothing of Mixed Complementarity Problems} 28488} 28489 28490@Article{ gabriel.pang:inexact, 28491 author = {S. A. Gabriel and J. S. Pang}, 28492 title = {An Inexact {NE/SQP} Method for Solving the Nonlinear Complementarity Problem}, 28493 journal = {Computational Optimization and Applications}, 28494 year = {1992}, 28495 volume = {1}, 28496 pages = {67--91} 28497} 28498 28499@InCollection{ gabriel.pang:trust, 28500 author = {S. A. Gabriel and J. S. Pang}, 28501 title = {A Trust Region Method for Constrained Nonsmooth Equations}, 28502 booktitle = {Large--Scale Optimization: State of the Art}, 28503 publisher = {Kluwer Academic Publishers}, 28504 year = {1994}, 28505 editor = {W. W. Hager and D. W. Hearn and P. M. Pardalos}, 28506 pages = {159--186} 28507} 28508 28509@PhDThesis{ gabriel:algorithms, 28510 author = {S. A. Gabriel}, 28511 title = {Algorithms for the Nonlinear Complementarity Problem: The {NE}/{SQP} Method and 28512 Extensions}, 28513 school = {The Johns Hopkins University}, 28514 year = {1992}, 28515 address = {Baltimore, Maryland} 28516} 28517 28518@Article{ gafni.bertsekas:two-metric, 28519 author = {E. M. Gafni and D. P. Bertsekas}, 28520 title = {Two-Metric Projection Methods for Constrained Optimization}, 28521 journal = {SIAM Journal on Control and Optimization}, 28522 year = {1984}, 28523 volume = {22}, 28524 pages = {936--964} 28525} 28526 28527@InProceedings{ gaivoronski:convergence, 28528 author = {A. A. Gaivoronski}, 28529 title = {Convergence of Parallel Backpropagation for Neural Networks}, 28530 booktitle = {SIAM Journal on Optimization}, 28531 year = {1994}, 28532 note = {Proceedings of Symposium on Parallel Optimization 3, Madison July 7-9, 1993, 28533 submitted} 28534} 28535 28536@Misc{ gaivoronski:private, 28537 author = {A. A. Gaivoronski}, 28538 title = {Private Communication}, 28539 year = {1992}, 28540 month = nov, 28541 address = {ITALTEL, Milan} 28542} 28543 28544@Book{ gale:theory, 28545 author = {D. Gale}, 28546 title = {The Theory of Linear Economic Models}, 28547 year = {1960}, 28548 publisher = {McGraw-Hill Book Company}, 28549 address = {New York} 28550} 28551 28552@Book{ gallant:neural, 28553 author = {S. I. Gallant}, 28554 title = {Neural Network Learning and Expert Systems}, 28555 year = {1993}, 28556 publisher = {MIT Press}, 28557 address = {Cambridge, Massachusetts} 28558} 28559 28560@InProceedings{ ganti.gehrke.ea:framework, 28561 author = {V. Ganti and J. Gehrke and R. Ramakrishnan}, 28562 title = {A Framework for Measuring Changes in Data Characteristics}, 28563 booktitle = {Proceedings of the Eighteenth ACM SIGACT-SIGMOD-SIGART Symposium on Principles of 28564 Database Systems, May 31 - June 2, 1999, Philadelphia, Pennsylvania}, 28565 publisher = {ACM Press}, 28566 year = {1999}, 28567 isbn = {1-58113-062-7}, 28568 pages = {126--137} 28569} 28570 28571@Book{ ganz:gamma, 28572 author = {J. C. Ganz}, 28573 title = {Gamma Knife Surgery}, 28574 publisher = {Springer-Verlag Wien}, 28575 year = {1997}, 28576 address = {Austria} 28577} 28578 28579@TechReport{ gao:nonlinear, 28580 author = {Y. Gao}, 28581 title = {Nonlinear Complementarity Problems in Large Deformed Beam Subject to Unilateral 28582 Conditions}, 28583 type = {Manuscript}, 28584 institution = {Department of Mathematics, Virginia Polytechnic Institute and State University}, 28585 month = oct, 28586 year = {1994} 28587} 28588 28589@Article{ garcia-palomares.mangasarian:superlinearly, 28590 author = {U. M. {Garcia--Palomares} and O. L. Mangasarian}, 28591 title = {Superlinearly Convergent {Q}uasi--{N}ewton Algorithms for Nonlinearly Constrained 28592 Optimization Problems}, 28593 journal = {Mathematical Programming}, 28594 year = {1976}, 28595 volume = {11}, 28596 pages = {1--13} 28597} 28598 28599@Article{ garcia-palomares.restuccia:global, 28600 author = {U. M. {Garcia--Palomares} and A. Restuccia}, 28601 title = {A Global Quadratic Algorithm for Solving a System of Mixed Equations}, 28602 journal = {Mathematical Programming}, 28603 year = {1981}, 28604 volume = {21}, 28605 pages = {290--300} 28606} 28607 28608@InProceedings{ garcia-palomares:superlinearly, 28609 author = {U. M. {Garcia--Palomares}}, 28610 title = {Superlinearly Convergent Algorithms for Linearly Constrained Optimization}, 28611 crossref = {mangasarian.meyer.ea:nonlinear*2}, 28612 pages = {101--119} 28613} 28614 28615@Article{ garcia.gould:theorem, 28616 author = {C. B. Garcia and F. J. Gould}, 28617 title = {A Theorem on Homotopy Paths}, 28618 journal = {Mathematics of Operations Research}, 28619 year = {1978}, 28620 volume = {3}, 28621 pages = {282--289} 28622} 28623 28624@Book{ garcia.zangwill:pathways, 28625 author = {C. B. Garcia and W. I. Zangwill}, 28626 title = {Pathways to Solutions, Fixed Points, and Equilibria}, 28627 year = {1981}, 28628 publisher = {Prentice-Hall, Inc}, 28629 address = {Englewood Cliffs, New Jersey} 28630} 28631 28632@Book{ garey.johnson:computers, 28633 author = {M. R. Garey and D. S. Johnson}, 28634 title = {Computers and Intractability, {A} Guide to the Theory of {NP}--Completeness}, 28635 year = {1979}, 28636 publisher = {W.H. Freeman and Company}, 28637 address = {San Francisco} 28638} 28639 28640@Article{ garey.tarjan.ea:one-processor, 28641 author = {M. R. Garey and R. E. Tarjan and G. T. Wilfong}, 28642 title = {One--Processor Scheduling with Symmetric Earliness and Tardiness Penalties}, 28643 journal = {Mathematics of Operations Research}, 28644 year = {1988}, 28645 volume = {13}, 28646 pages = {330--348} 28647} 28648 28649@Book{ garfinkel.nemhauser:integer, 28650 author = {R. S. Garfinkel and G. L. Nemhauser}, 28651 title = {Integer Programming}, 28652 year = {1972}, 28653 publisher = {John Wiley \& Sons}, 28654 address = {New York} 28655} 28656 28657@Book{ gass:linear, 28658 author = {S. Gass}, 28659 title = {Linear Programming Methods and Applications}, 28660 edition = {Fifth}, 28661 publisher = {Boyd and Fraser Publishing Company}, 28662 address = {Danvers, Massachusetts}, 28663 year = {1985} 28664} 28665 28666@InProceedings{ gay:combining, 28667 author = {D. M. Gay}, 28668 title = {On Combining the Schemes of {R}eid and {S}aunders for Sparse {LP} Bases}, 28669 booktitle = {Sparse Matrix Proceedings 1978}, 28670 editor = {I. S. Duff and G. W. Stewart}, 28671 year = {1978}, 28672 organization = {SIAM}, 28673 address = {Philadelphia, Pennsylvania}, 28674 pages = {313--334} 28675} 28676 28677@Article{ gay:electronic, 28678 author = {D. M. Gay}, 28679 title = {Electronic Mail Distribution of Linear Programming Test Problems}, 28680 journal = {{COAL} Newsletter}, 28681 year = {1985}, 28682 volume = {13}, 28683 pages = {10--12} 28684} 28685 28686@TechReport{ gay:hooking, 28687 author = {D. M. Gay}, 28688 title = {Hooking Your Solver to {AMPL}}, 28689 year = {1997}, 28690 institution = {Bell Laboratories}, 28691 address = {Murray Hill, New Jersey}, 28692 note = {Revised 1994, 1997} 28693} 28694 28695@Article{ gay:variant, 28696 author = {D. Gay}, 28697 title = {A Variant of {K}armarkar's Linear Programming Algorithm for Problems in Standard 28698 Form}, 28699 journal = {Mathematical Programming}, 28700 year = {1987}, 28701 volume = {37}, 28702 pages = {81--90} 28703} 28704 28705@Article{ geiger.kanzow:resolution, 28706 author = {C. Geiger and C. Kanzow}, 28707 title = {On the Resolution of Monotone Complementarity Problems}, 28708 journal = {Computational Optimization and Applications}, 28709 volume = {5}, 28710 year = {1996}, 28711 pages = {155--173} 28712} 28713 28714@Book{ geist.beguelin.ea:pvm, 28715 author = {G. A. Geist and A. L. Beguelin and J. J. Dongarra and W. Jiang and R. Manchek and 28716 V. S. Sunderam}, 28717 title = {{PVM}: Parallel Virtual Machine}, 28718 publisher = {MIT Press}, 28719 address = {Cambridge, Massachusetts}, 28720 year = {1994} 28721} 28722 28723@Article{ gendron.crainic:parallel, 28724 author = {B. Gendron and T. G. Crainic}, 28725 title = {Parallel Branch-and-Bound Algorithms: Survey and Synthesis}, 28726 journal = {Operations Research}, 28727 year = {1994}, 28728 volume = {42}, 28729 pages = {1042--1060} 28730} 28731 28732@Article{ george:automatic, 28733 author = {A. George}, 28734 title = {An automatic one-way dissection algorithm for irregular finite-element problems}, 28735 journal = {SIAM Journal on Numerical Analysis}, 28736 vol = {17}, 28737 pages = {740--751}, 28738 year = {1980} 28739} 28740 28741@InProceedings{ georges-schleuter:asparagos, 28742 crossref = {schaeffer:third}, 28743 author = {M. Georges--Schleuter}, 28744 title = {Asparagos: An Asynchronous Parallel Genetic Algorithm}, 28745 pages = {416--421} 28746} 28747 28748@Article{ georgiou:comments, 28749 author = {G. M. Georgiou}, 28750 title = {Comments On Hidden Nodes in Neural Nets}, 28751 journal = {IEEE Transactions on Circuits and Systems}, 28752 year = {1991}, 28753 volume = {38}, 28754 pages = {1410} 28755} 28756 28757@TechReport{ gertz.linderoth.ea:object-oriented, 28758 author = {M. Gertz and J. Linderoth and S. Wright}, 28759 title = {Object-Oriented Software for Linear Complementarity and Quadratic Programming}, 28760 institution = {MCS Division, Argonne National Laboratory}, 28761 year = {in preparation} 28762} 28763 28764@Article{ ghellinck.vial:polynomial, 28765 author = {G. de Ghellinck and J.--Ph. Vial}, 28766 title = {A Polynomial {N}ewton Method for Linear Programming}, 28767 journal = {Algorithmica}, 28768 year = {1986}, 28769 volume = {1}, 28770 pages = {425--453} 28771} 28772 28773@InCollection{ gilbert.ng:predicting, 28774 author = {J. R. Gilbert and E. Ng}, 28775 title = {Predicting Structure in Nonsymmetric Sparse Matrix Factorizations}, 28776 year = {1993}, 28777 booktitle = {Graph Theory and Sparse Matrix Computation}, 28778 editor = {A. George and J. Gilbert and J. Liu}, 28779 publisher = {Springer-Verlag} 28780} 28781 28782@Article{ gilbert-lemarechal, 28783 author = {J. C. Gilbert and C. Lemarechal}, 28784 title = {Some Numerical Experiments with Variable-Storage Quasi-Newton Algorithms}, 28785 journal = {Mathematical Programming}, 28786 year = {1989}, 28787 volume = {45}, 28788 pages = {407--434} 28789} 28790 28791@Article{ gill.murray.ea:computing, 28792 author = {P. E. Gill and W. Murray and M. A. Saunders and M. H. Wright}, 28793 title = {Computing Forward-Difference Intervals for Numerical Optimization}, 28794 journal = {SIAM Journal on Scientific and Statistical Computing}, 28795 year = {1983}, 28796 volume = {4}, 28797 pages = {310--321} 28798} 28799 28800@Article{ gill.murray.ea:maintaining, 28801 author = {P. E. Gill and W. Murray and M. A. Saunders and M. H. Wright}, 28802 title = {Maintaining {LU} Factors of a General Sparse Matrix}, 28803 year = {1987}, 28804 journal = {Linear Algebra and Its Applications}, 28805 volume = {88/89}, 28806 pages = {239--270} 28807} 28808 28809@Book{ gill.murray.ea:practical, 28810 author = {P. E. Gill and W. Murray and M. H. Wright}, 28811 title = {Practical Optimization}, 28812 year = {1981}, 28813 publisher = {Academic Press}, 28814 address = {London} 28815} 28816 28817@Article{ gill.murray.ea:practical*1, 28818 author = {P. E. Gill and W. Murray and M. A. Saunders and M. H. Wright}, 28819 title = {A Practical Anti-Cycling Procedure for Linearly Constrained Optimization}, 28820 journal = {Mathematical Programming}, 28821 year = {1989}, 28822 volume = {45}, 28823 pages = {437--474} 28824} 28825 28826@Article{ gill.murray.ea:projected, 28827 author = {P. E. Gill and W. Murray and M. A. Saunders and J. A. Tomlin and M. H. Wright}, 28828 title = {On Projected {N}ewton Barrier Methods for Linear Programming and an Equivalence 28829 to {K}armarkar's Projective Method}, 28830 journal = {Mathematical Programming}, 28831 year = {1986}, 28832 volume = {36}, 28833 pages = {183--209} 28834} 28835 28836@Article{ gill.murray:newton-type, 28837 author = {P. E. Gill and W. Murray}, 28838 title = {{N}ewton--Type Methods for Unconstrained and Linearly Constrained Optimization}, 28839 journal = {Mathematical Programming}, 28840 year = {1974}, 28841 volume = {7}, 28842 pages = {311--350} 28843} 28844 28845@InProceedings{ gill.murray:nonlinear, 28846 author = {P. E. Gill and W. Murray}, 28847 title = {Nonlinear Least Squares and Nonlinearly Constrained Optimization}, 28848 booktitle = {Numerical Analysis, Dundee 1975}, 28849 year = {1976}, 28850 editor = {G. A. Watson}, 28851 publisher = {Springer-Verlag}, 28852 address = {Berlin}, 28853 note = {Lecture Notes in Mathematics 506} 28854} 28855 28856@Book{ ginsburgh.waelbroeck:activity, 28857 author = {V. Ginsburgh and J. Waelbroeck}, 28858 title = {Activity Analysis and General Equilibrium Modelling}, 28859 publisher = {North--Holland}, 28860 year = {1981}, 28861 address = {Amsterdam} 28862} 28863 28864@Article{ glad.goldstein:errors, 28865 author = {T. Glad and A. Goldstein}, 28866 title = {Optimization of Functions Whose Values are Subject to Small Errors}, 28867 journal = {BIT}, 28868 year = {1977}, 28869 volume = {17}, 28870 pages = {160--169} 28871} 28872 28873@Article{ glad.polak:multiplier, 28874 author = {T. Glad and E. Polak}, 28875 title = {A Multiplier Method with Automatic Limitation of Penalty Growth}, 28876 journal = {Mathematical Programming}, 28877 year = {1979}, 28878 volume = {17}, 28879 pages = {140--155} 28880} 28881 28882@Book{ glashoff.gustafson:linear, 28883 author = {K. Glashoff and S.--\AA. Gustafson}, 28884 title = {Linear Optimization and Approximation}, 28885 year = {1983}, 28886 publisher = {Springer-Verlag}, 28887 address = {New York} 28888} 28889 28890@Article{ glover:improved, 28891 author = {F. Glover}, 28892 title = {Improved Linear Programming Models for Discriminant Analysis}, 28893 journal = {Decision Sciences}, 28894 year = {1990}, 28895 volume = {21}, 28896 pages = {771--785} 28897} 28898 28899@Book{ glasserman:gradient, 28900 author = {P. Glasserman}, 28901 title = {Gradient Estimation via Perturbation Analysis}, 28902 publisher = {Kluwer}, 28903 year = {1991}, 28904 address = {Norwell, MA} 28905} 28906 28907@Article{ glover:tabu, 28908 author = {F. Glover}, 28909 title = {Tabu Search -- Part 1}, 28910 journal = {ORSA Journal on Computing}, 28911 year = {1989}, 28912 volume = {1}, 28913 pages = {190--206} 28914} 28915 28916@Article{ glowinski.marroco:sur, 28917 author = {R. Glowinski and A. Marroco}, 28918 title = {Sur l'Approximation, par Elements d'Ordre un, et la Resolution, par 28919 Penalisation-Dualit\'{e}, d'une Classe de Problemes de {D}irichlet non Lineares}, 28920 journal = {Revue Fran\c{c}aise d'Automatique, Informatique, et Recherche Operationelle}, 28921 year = {1975}, 28922 volume = {9(R-2)}, 28923 pages = {41--76} 28924} 28925 28926@TechReport{ goeleven.nguyen:convergence, 28927 author = {D. Goeleven and V. H. Nguyen}, 28928 title = {On the Convergence of the Parallel Constraint Distribution Algorithm}, 28929 institution = {Department of Mathematics, Facultes Universitaires de Namur}, 28930 year = {1992}, 28931 address = {B-5000 Namur, Belgium} 28932} 28933 28934@Book{ goldberg:genetic, 28935 author = {D. E. Goldberg}, 28936 title = {Genetic Algorithms in Search, Optimization and Machine Learning}, 28937 year = {1989}, 28938 publisher = {Addison-Wesley}, 28939 address = {Reading MA} 28940} 28941 28942@Article{ golden.skiscim:simulated, 28943 author = {B. L. Golden and C. C. Skiscim}, 28944 title = {Using Simulated Annealing to Solve Routing and Location Problems}, 28945 journal = {Naval Research Logistics Quarterly}, 28946 year = {1989}, 28947 volume = {33}, 28948 pages = {261--279} 28949} 28950 28951@Article{ goldfarb.reid:practical, 28952 author = {D. Goldfarb and J. K. Reid}, 28953 title = {A Practical Steepest--Edge Simplex Algorithm}, 28954 journal = {Mathematical Programming}, 28955 year = {1977}, 28956 volume = {12}, 28957 pages = {361--371} 28958} 28959 28960@InProceedings{ goldman.tucker:theory, 28961 author = {A. J. Goldman and A. W. Tucker}, 28962 title = {Theory of Linear Programming}, 28963 booktitle = {Linear Inequalities and Related Systems}, 28964 year = {1956}, 28965 editor = {H. W. Kuhn and A. W. Tucker}, 28966 publisher = {Princeton University Press}, 28967 address = {Princeton, New Jersey}, 28968 pages = {53--97} 28969} 28970 28971@Book{ goldstein:constructive, 28972 author = {A. A. Goldstein}, 28973 title = {Constructive Real Analysis}, 28974 year = {1967}, 28975 publisher = {Harper and Row}, 28976 address = {New York} 28977} 28978 28979@Article{ golshtein:block, 28980 author = {Ye. G. Golshtein}, 28981 title = {The Block Method of Convex Programming}, 28982 journal = {Soviet Mathematics Doklady}, 28983 year = {1986}, 28984 volume = {33}, 28985 pages = {584--587} 28986} 28987 28988@Article{ golshtein:general, 28989 author = {Ye. G. Golshtein}, 28990 title = {A General Approach to Decomposition of Optimization Systems}, 28991 journal = {Soviet Journal of Computer and Systems Sciences}, 28992 year = {1987}, 28993 volume = {3}, 28994 pages = {105--114} 28995} 28996 28997@Article{ golub.kahan:calculating, 28998 author = {G. H. Golub and W. Kahan}, 28999 title = {Calculating the Singular Values and Pseudoinverse of a Matrix}, 29000 journal = {SIAM Journal on Numerical Analysis}, 29001 year = {1965}, 29002 volume = {2}, 29003 pages = {205--224} 29004} 29005 29006@Book{ golub.vanloan:matrix, 29007 author = {G. H. Golub and C. F. {Van Loan}}, 29008 title = {Matrix Computations}, 29009 year = {1996}, 29010 publisher = {The John Hopkins University Press}, 29011 address = {Baltimore, Maryland}, 29012 edition = {Third} 29013} 29014 29015@TechReport{ gomez.barron:exponential, 29016 author = {S. Gom\'{e}z and C. Barr\'{o}n}, 29017 title = {The Exponential Tunneling Method}, 29018 institution = {Universidad Nacional Autonoma de Mexico}, 29019 year = {1991}, 29020 type = {Serie Reportes de Investigacion}, 29021 number = {3}, 29022 address = {Mexico} 29023} 29024 29025@Article{ gondzio:multiple, 29026 author = {J. Gondzio}, 29027 title = {Multiple Centrality Corrections in a Primal-Dual Method for Linear Programming}, 29028 journal = {Computational Optimization and Applications}, 29029 year = {1996}, 29030 volume = {6}, 29031 pages = {137--156} 29032} 29033 29034@TechReport{ gonzaga:algorithm, 29035 author = {C. C. Gonzaga}, 29036 title = {An Algorithm for Solving Linear Programming Problems in {O}($n^3${L}) 29037 operations}, 29038 institution = {Electronics Research Laboratory, University of California}, 29039 year = {1987}, 29040 address = {Berkeley, California}, 29041 number = {UCB/ERL M87/10}, 29042 type = {Memorandum} 29043} 29044 29045@Article{ gould.tolle:necessary, 29046 author = {F. J. Gould and J. W. Tolle}, 29047 title = {A Necessary and Sufficient Qualification for Constrained Optimization}, 29048 journal = {SIAM Journal on Applied Mathematics}, 29049 year = {1971}, 29050 volume = {20}, 29051 pages = {164--172} 29052} 29053 29054@InProceedings{ goux.kulkarni.ea:enabling, 29055 author = {J.-P. Goux and S. Kulkarni and J. Linderoth and M. E. Yoder}, 29056 title = {An Enabling Framework for Master-Worker Applications on the Computational Grid}, 29057 booktitle = {Proceedings of the Ninth {IEEE} International Symposium on High Performance 29058 Distributed Computing}, 29059 year = {2000} 29060} 29061 29062@Article{ gowda.pang:basic, 29063 author = {M. S. Gowda and J. S. Pang}, 29064 title = {The Basic Theorem of Complementarity Revisited}, 29065 journal = {Mathematical Programming}, 29066 year = {1993}, 29067 volume = {58}, 29068 pages = {161--178} 29069} 29070 29071@Article{ gowda.pang:boundedness, 29072 author = {M. S. Gowda and J. S. Pang}, 29073 title = {On the Boundedness and Stability of Solutions to the Affine Variational 29074 Inequality Problem}, 29075 journal = {SIAM Journal on Control and Optimization}, 29076 year = {1994}, 29077 volume = {32}, 29078 pages = {421--441} 29079} 29080 29081@Article{ gowda.pang:stability, 29082 author = {M. S. Gowda and J. S. Pang}, 29083 title = {Stability analysis of variational inequalities and nonlinear complementarity 29084 problems, via the mixed linear complementarity problem and degree theory}, 29085 journal = {Mathematics of Operations Research}, 29086 year = {1994}, 29087 volume = {19}, 29088 pages = {831--879} 29089} 29090 29091@Article{ gowda.sznajder:generalizations, 29092 author = {M. S. Gowda and R. Sznajder}, 29093 title = {Generalizations of ${P}_0$-- and ${P}$-- properties; Extended Vertical and 29094 Horizontal {LCP}s}, 29095 journal = {Linear Algebra and Its Applications}, 29096 year = {1995}, 29097 volume = {223/224}, 29098 pages = {695--715} 29099} 29100 29101@Article{ gowda.sznajder:generalized, 29102 author = {M. S. Gowda and R. Sznajder}, 29103 title = {The Generalized Order Linear Complementarity Problem}, 29104 journal = {SIAM Journal on Matrix Analysis and Applications}, 29105 year = {1994} 29106} 29107 29108@Article{ gowda:analysis, 29109 author = {M. S. Gowda}, 29110 title = {An Analysis of Zero Set and Global Error Bound Properties of a Piecewise Affine 29111 Function via its Recession Function}, 29112 journal = {SIAM Journal on Matrix Analysis and Applications}, 29113 year = {1996}, 29114 volume = {17}, 29115 pages = {594--609} 29116} 29117 29118@Article{ gowda:applications, 29119 author = {M. S. Gowda}, 29120 title = {Applications of Degree Theory to Linear Complementarity Problems}, 29121 journal = {Mathematics of Operations Research}, 29122 year = {1993}, 29123 volume = {18}, 29124 pages = {868--879} 29125} 29126 29127@Article{ grant.woo:clinical, 29128 author = {W. I. Grant and S. Y. Woo}, 29129 title = {Clinical and Financial Issues for Intensity Modulated Radiation Therapy 29130 Delivery}, 29131 journal = {Seminars in Radiation Oncology}, 29132 year = {1999}, 29133 volume = {9}, 29134 pages = {99--107} 29135} 29136 29137@Article{ greenberg.hegerich:branch, 29138 author = {H. Greenberg and R. L. Hegerich}, 29139 title = {A Branch Search Algorithm for the Knapsack Problem}, 29140 journal = {Management Science}, 29141 year = {1970}, 29142 volume = {16}, 29143 pages = {327--332} 29144} 29145 29146@InCollection{ grefenstette:incorporating, 29147 crossref = {davis:genetic}, 29148 author = {J. J. Grefenstette}, 29149 title = {Incorporating Problem Specific Knowledge into Genetic Algorithms} 29150} 29151 29152@Book{ griewank.corliss:automatic, 29153 editor = {A. Griewank and G. F. Corliss}, 29154 title = {Automatic Differentiation of Algorithms: Theory, Implementation and Application}, 29155 publisher = {SIAM}, 29156 year = {1991}, 29157 address = {Philadelphia, Pennsylvania} 29158} 29159 29160@Article{ griewank.juedes.ea:adol-c, 29161 author = {A. Griewank and D. Juedes and J. Utke}, 29162 title = {{ADOL}-{C}: {A} Package for the Automatic Differentiation of Algorithms Written 29163 in {C}/{C}++}, 29164 journal = {{ACM} Transactions on Mathematical Software}, 29165 year = {1996}, 29166 volume = {22}, 29167 pages = {131--167} 29168} 29169 29170@Article{ griffith.stewart:nonlinear, 29171 author = {R. E. Griffith and R. A. Stewart}, 29172 title = {A Nonlinear Programming Technique for the Optimization of Continuous Processing 29173 Systems}, 29174 journal = {Management Science}, 29175 year = {1961}, 29176 volume = {7}, 29177 pages = {379--392} 29178} 29179 29180@Article{ grinold:mathematical, 29181 author = {R. C. Grinold}, 29182 title = {Mathematical Methods for {PA}ttern Classification}, 29183 journal = {Management Science}, 29184 year = {1972}, 29185 volume = {19}, 29186 pages = {272--289} 29187} 29188 29189@Article{ grippo.lampariello.ea:class, 29190 author = {L. Grippo and F. Lampariello and S. Lucidi}, 29191 title = {A Class of Nonmonotone Stabilization Methods in Unconstrained Optimization}, 29192 journal = {Numerische Mathematik}, 29193 year = {1991}, 29194 volume = {59}, 29195 pages = {779--805} 29196} 29197 29198@Article{ grippo.lampariello.ea:global, 29199 author = {L. Grippo and F. Lampariello and S. Lucidi}, 29200 title = {Global Convergence and Stabilization of Unconstrained Minimization Methods 29201 Without Derivatives}, 29202 journal = {Journal of Optimization Theory and Applications}, 29203 year = {1988}, 29204 volume = {56}, 29205 pages = {385--406} 29206} 29207 29208@Article{ grippo.lampariello.ea:nonmonotone, 29209 author = {L. Grippo and F. Lampariello and S. Lucidi}, 29210 title = {A Nonmonotone Line Search Technique for {N}ewton's Method}, 29211 journal = {SIAM Journal on Numerical Analysis}, 29212 year = {1986}, 29213 volume = {23}, 29214 pages = {707--716} 29215} 29216 29217@Misc{ grippo:private, 29218 author = {L. Grippo}, 29219 title = {Private Communication}, 29220 year = {1992}, 29221 address = {Universita degli Studi di Roma ``La Sapienza'',Roma} 29222} 29223 29224@Article{ grotschel.lovasz.ea:ellipsoid, 29225 author = {M. Gr{\"{o}}tschel and L. Lov\'{a}sz and A. Schrijver}, 29226 title = {The Ellipsoid Method and its Consequences in Combinatorial Optimization}, 29227 journal = {Combinatorica}, 29228 year = {1981}, 29229 volume = {1}, 29230 pages = {169--197} 29231} 29232 29233@Article{ guignard:generalized, 29234 author = {M. Guignard}, 29235 title = {Generalized {K}uhn--{T}ucker conditions for Mathematical Programming in a 29236 {B}anach Space}, 29237 journal = {SIAM Journal on Control and Optimization}, 29238 year = {1969}, 29239 volume = {7}, 29240 pages = {232--241} 29241} 29242 29243@Article{ guler.ye:convergence, 29244 author = {O. G{\"{u}}ler and Y. Ye}, 29245 title = {Convergence Behavior of Interior--Point Algorithms}, 29246 journal = {Mathematical Programming}, 29247 year = {1993}, 29248 volume = {60}, 29249 pages = {215--228} 29250} 29251 29252@Article{ guler:existence, 29253 author = {O. G{\"{u}}ler}, 29254 title = {Existence of Interior Points and Interior Paths in Nonlinear Monotone 29255 Complementarity Problems}, 29256 journal = {Mathematics of Operations Research}, 29257 year = {1993}, 29258 volume = {18}, 29259 pages = {128--147} 29260} 29261 29262@Article{ guler:generalized, 29263 author = {O. G{\"{u}}ler}, 29264 title = {Generalized Linear Complementarity Problems}, 29265 journal = {Mathematics of Operations Research}, 29266 year = {1995}, 29267 volume = {20}, 29268 pages = {441--448} 29269} 29270 29271@Article{ gupta.sen:minimizing, 29272 author = {S. Gupta and T. Sen}, 29273 title = {Minimizing the Range of Lateness on a Single Machine}, 29274 journal = {Journal of the Operational Research Society}, 29275 year = {1984}, 29276 volume = {35}, 29277 pages = {853--857} 29278} 29279 29280@InCollection{ gustafson:numerical, 29281 author = {S.-\AA. Gustafson}, 29282 title = {On Numerical Analysis in Semi-Infinite Programming}, 29283 booktitle = {Semi-Infinite Programming}, 29284 year = {1979}, 29285 editor = {R. Hettich}, 29286 publisher = {Springer-Verlag}, 29287 address = {Berlin} 29288} 29289 29290@Article{ gustafsson.lind.ea:simultaneous, 29291 author = {A. Gustafsson and B. K. Lind and R. Svensson and A. Brahme}, 29292 title = {Simultaneous optimization of dynamic multileaf collimation and scanning patterns 29293 or compensation filters using a generalized pencil beam algorithm}, 29294 journal = {Medical Physics}, 29295 year = {1995}, 29296 volume = {22}, 29297 number = {7}, 29298 pages = {1141--1156} 29299} 29300 29301@PhDThesis{ ha:decomposition, 29302 author = {C. D. Ha}, 29303 title = {Decomposition Methods for Structured Convex Programming}, 29304 year = {1980}, 29305 school = {Department of Industrial Engineering, University of Wisconsin--Madison} 29306} 29307 29308@TechReport{ haakonsen.mathiesen:toward, 29309 author = {L. Haakonsen and L. Mathiesen}, 29310 title = {Toward a more comprehensive cost measure for {CO2}-reductions}, 29311 institution = {NHH, Bergen}, 29312 year = {1995}, 29313 type = {Discussion Paper}, 29314 number = {3/95} 29315} 29316 29317@Article{ haaland.norman.ea:vemod, 29318 author = {J. Haaland and V. Norman and T. Rutherford and T. Wergeland}, 29319 title = {{VEMOD}: {A} {R}icardo--{H}eckscher--{O}hlin--{J}ones Model of World Trade}, 29320 journal = {Scandinavian Journal of Economics}, 29321 year = {1987} 29322} 29323 29324@Article{ haarhoff.buys:method, 29325 author = {P. C. Haarhoff and J. D. Buys}, 29326 title = {A New Method for the Optimization of a Nonlinear Function Subject to Nonlinear 29327 Constraints}, 29328 journal = {Computer Journal}, 29329 year = {1970}, 29330 volume = {12}, 29331 pages = {178--184} 29332} 29333 29334@Article{ habetler.kostreva:direct, 29335 author = {G. J. Habetler and M. M. Kostreva}, 29336 title = {On a direct algorithm for nonlinear complementarity problems}, 29337 journal = {SIAM Journal on Control and Optimization}, 29338 volume = {16}, 29339 year = {1978}, 29340 pages = {504--511} 29341} 29342 29343@Book{ hadamard:cauchys, 29344 author = {J. Hadamard}, 29345 title = {Cauchy's Problem in Linear Partial Differential Equations}, 29346 year = {1923}, 29347 publisher = {Yale University Press} 29348} 29349 29350@Article{ haddock.mittenthal:simulation, 29351 author = {J. Haddock and J. Mittenthal}, 29352 title = {Simulation optimization using simulated annealing}, 29353 journal = {Comput. Ind. Eng.}, 29354 year = {1992}, 29355 volume = {22}, 29356 pages = {387--395} 29357} 29358 29359@TechReport{ hamala:general, 29360 author = {M. Hamala}, 29361 title = {A General Approach to Interior Point Methods with Linear Parameter for 29362 Mathematical Programming}, 29363 institution = {Royal Institute of Technology}, 29364 year = {1978}, 29365 number = {1978--20}, 29366 type = {Department of Mathematics Paper TRITA--MAT} 29367} 29368 29369@Article{ han.mangasarian:dual, 29370 author = {S.--P. Han and O. L. Mangasarian}, 29371 title = {A Dual Differentiable Exact Penalty Function}, 29372 journal = {Mathematical Programming}, 29373 year = {1983}, 29374 volume = {25}, 29375 pages = {293--301} 29376} 29377 29378@Article{ han.mangasarian:exact, 29379 author = {S.--P. Han and O. L. Mangasarian}, 29380 title = {Exact Penalty Functions in Nonlinear Programming}, 29381 journal = {Mathematical Programming}, 29382 year = {1979}, 29383 volume = {17}, 29384 pages = {251--269} 29385} 29386 29387@Article{ han.pang.ea:globally, 29388 author = {S.--P. Han and J. S. Pang and N. Rangaraj}, 29389 title = {Globally Convergent {N}ewton Methods for Nonsmooth Equations}, 29390 journal = {Mathematics of Operations Research}, 29391 year = {1992}, 29392 volume = {17}, 29393 pages = {586--607} 29394} 29395 29396@Article{ han:decomposition, 29397 author = {S.--P. Han}, 29398 title = {A Decomposition Method and its Application to Convex Programming}, 29399 journal = {Mathematics of Operations Research}, 29400 year = {1989}, 29401 volume = {14}, 29402 pages = {237--248} 29403} 29404 29405@Article{ han:globally, 29406 author = {S.--P. Han}, 29407 title = {A Globally Convergent Method for Nonlinear Programming}, 29408 journal = {Journal of Optimization Theory and Applications}, 29409 year = {1977}, 29410 volume = {22}, 29411 pages = {297--309} 29412} 29413 29414@Article{ han:superlinearly, 29415 author = {S.--P. Han}, 29416 title = {Superlinearly Convergent Variable Metric Algorithms for General Nonlinear 29417 Programming Problems}, 29418 journal = {Mathematical Programming}, 29419 year = {1976}, 29420 volume = {11}, 29421 pages = {263--282} 29422} 29423 29424@Article{ hansen.koopmans:definition, 29425 author = {T. Hansen and T. C. Koopmans}, 29426 title = {On the Definition and Computation of a Capital Stock Invariant Under 29427 Optimization}, 29428 journal = {Journal of Economic Theory}, 29429 year = {1972}, 29430 volume = {5}, 29431 pages = {487--523} 29432} 29433 29434@InCollection{ harker.pang:damped, 29435 author = {P. T. Harker and J. S. Pang}, 29436 title = {A Damped {N}ewton Method for the Linear Complementarity Problem}, 29437 booktitle = {Computational Solution of Nonlinear Systems of Equations}, 29438 publisher = {AMS}, 29439 year = {1990}, 29440 editor = {E. L. Allgower and K. Georg}, 29441 number = {26}, 29442 series = {Lectures on Applied Mathematics}, 29443 address = {Providence, Rhode Island}, 29444 pages = {265--284} 29445} 29446 29447@Article{ harker.pang:existence, 29448 author = {P. T. Harker and J. S. Pang}, 29449 title = {Existence of Optimal Solutions to Mathematical Programs with Equilibrium 29450 Constraints}, 29451 journal = {Operations Research Letters}, 29452 year = {1988}, 29453 volume = {7}, 29454 pages = {61--64} 29455} 29456 29457@Article{ harker.pang:finite-dimensional, 29458 author = {P. T. Harker and J. S. Pang}, 29459 title = {Finite--dimensional variational inequality and nonlinear complementarity 29460 problems: {A} survey of theory, algorithms and applications}, 29461 journal = {Mathematical Programming}, 29462 year = {1990}, 29463 volume = {48}, 29464 pages = {161--220} 29465} 29466 29467@Article{ harker.xiao:newtons, 29468 author = {P. T. Harker and B. Xiao}, 29469 title = {{N}ewton's Method for the Nonlinear Complementarity Problem: {A} 29470 {B}--Differentiable Equation Approach}, 29471 journal = {Mathematical Programming}, 29472 year = {1990}, 29473 volume = {48}, 29474 pages = {339--358} 29475} 29476 29477@Article{ harker:accelerating, 29478 author = {P. T. Harker}, 29479 title = {Accelerating the Convergence of the Diagonalization and Projection Algorithms for 29480 Finite--Dimensional Variational Inequalities}, 29481 journal = {Mathematical Programming}, 29482 year = {1988}, 29483 volume = {41}, 29484 pages = {29--50} 29485} 29486 29487@Article{ harker:generalized, 29488 author = {P. T. Harker}, 29489 title = {Generalized {N}ash Games and Quasi-Variational Inequalities}, 29490 journal = {European Journal of Operations Research}, 29491 volume = {54}, 29492 pages = {81--94}, 29493 year = {1987} 29494} 29495 29496@Book{ harker:lectures, 29497 author = {P. T. Harker}, 29498 title = {Lectures on Computation of Equilibria with Equation--Based Methods}, 29499 publisher = {CORE Foundation, Louvain--la--Neuve, Universit\'{e} Catholique de Louvain}, 29500 year = {1993}, 29501 series = {CORE Lecture Series} 29502} 29503 29504@Article{ harris:pivot, 29505 author = {P. M. J. Harris}, 29506 title = {Pivot Selection Methods of the {D}evex {LP} Code}, 29507 journal = {Mathematical Programming}, 29508 year = {1973}, 29509 volume = {5}, 29510 pages = {1--28} 29511} 29512 29513@InCollection{ harrison.kristrom:carbon, 29514 author = {G. W. Harrison and B. Kristrom}, 29515 title = {Carbon Emissions and the Economic Costs of Transport Policy in {S}weden}, 29516 booktitle = {Environment and Transport in Economic Modelling}, 29517 publisher = {Kluwer Academic Publishers}, 29518 year = {1997}, 29519 editor = {R. Roson and K. A. Small}, 29520 address = {Amsterdam} 29521} 29522 29523@Article{ harrison.rutherford.ea:increased, 29524 author = {G. W. Harrison and T. F. Rutherford and D. G. Tarr}, 29525 title = {Increased Competition and Completion of the Market in the {E}uropean {U}nion}, 29526 journal = {Journal of Economic Integration}, 29527 year = {1996}, 29528 volume = {11}, 29529 pages = {332--365} 29530} 29531 29532@Article{ harrison.rutherford.ea:liberalizing, 29533 author = {G. W. Harrison and T. F. Rutherford and I. Wooton}, 29534 title = {Liberalizing Agriculture in the {E}uropean {U}nion}, 29535 journal = {Journal of Policy Modeling}, 29536 year = {1995}, 29537 volume = {17} 29538} 29539 29540@Article{ harrison.rutherford.ea:quantifying, 29541 author = {G. W. Harrison and T. F. Rutherford and D. Tarr}, 29542 title = {Quantifying the {U}ruguay Round}, 29543 journal = {Finance and Development}, 29544 year = {1995}, 29545 volume = {32}, 29546 pages = {38--41} 29547} 29548 29549@InProceedings{ harrison.rutherford.ea:quantifying*1, 29550 author = {G. W. Harrison and T. F. Rutherford and D. G. Tarr}, 29551 title = {Quantifying the {U}ruguay Round}, 29552 year = {1996}, 29553 booktitle = {The {U}ruguay Round and the Developing Economies}, 29554 address = {New York}, 29555 editors = {W. Martin and L. A. Winters}, 29556 publisher = {Cambridge University Press} 29557} 29558 29559@Article{ harrison.rutherford.ea:quantifying*2, 29560 author = {G. W. Harrison and T. F. Rutherford and D. Tarr}, 29561 title = {Quantifying the {U}ruguay Round}, 29562 journal = {The Economic Journal}, 29563 year = {1997}, 29564 volume = {107}, 29565 pages = {1405--1430} 29566} 29567 29568@Article{ harrison.rutherford.ea:trade, 29569 author = {G. W. Harrison and T. F. Rutherford and D. G. Tarr}, 29570 title = {Trade Reform in the Partially Liberalized Economy of {T}urkey}, 29571 journal = {The World Bank Economic Review}, 29572 year = {1993}, 29573 volume = {7}, 29574 pages = {191--217} 29575} 29576 29577@Article{ hartman.stampacchia:nonlinear, 29578 author = {P. Hartman and G. Stampacchia}, 29579 title = {On some nonlinear differential-functional equations}, 29580 journal = {Acta Mathematica}, 29581 year = {1966}, 29582 volume = {115}, 29583 pages = {271--310} 29584} 29585 29586@Book{ harvey:forecasting, 29587 author = {Andrew C. Harvey}, 29588 title = {Forecasting, Structural Time Series Models and the {K}alman Filter}, 29589 publisher = {Cambridge University Press}, 29590 address = {New York, NY}, 29591 year = {1989} 29592} 29593 29594@Article{ haurie.marcotte:relationship, 29595 author = {A. Haurie and P. Marcotte}, 29596 title = {On the Relationship between {N}ash--{C}ournot and {W}ardrop Equilibria}, 29597 journal = {Networks}, 29598 year = {1985}, 29599 volume = {15}, 29600 pages = {295--308} 29601} 29602 29603@Article{ hearn.lawphongpanich.ea:restricted, 29604 author = {D. W. Hearn and S. Lawphongpanich and J. A. Ventura}, 29605 title = {Restricted Simplicial Decomposition: Computation and Extensions}, 29606 journal = {Mathematical Programming Study}, 29607 year = {1987}, 29608 volume = {31}, 29609 pages = {99--118} 29610} 29611 29612@Article{ hearn:gap, 29613 author = {D. W. Hearn}, 29614 title = {The Gap Function of a Convex Program}, 29615 journal = {Operations Research Letters}, 29616 year = {1982}, 29617 volume = {1}, 29618 pages = {67--71} 29619} 29620 29621@Article{ hedlund.gustavsson:design, 29622 author = {P. Hedlund and A. Gustavsson}, 29623 title = {Design and Evaluation of Modified Simplex Methods having Enhanced Convergence 29624 Ability}, 29625 journal = {Analytica Chimica Acta}, 29626 year = {1992}, 29627 volume = {259}, 29628 pages = {243--256} 29629} 29630 29631@Article{ helgason.kennington.ea:parallelization, 29632 author = {R. V. Helgason and J. L. Kennington and H. A. Zaki}, 29633 title = {A Parallelization of the Simplex Method}, 29634 journal = {Annals of Operations Research}, 29635 year = {1988}, 29636 volume = {14}, 29637 pages = {17--40} 29638} 29639 29640@Article{ helgason.kennington.ea:polynomially, 29641 author = {Richard Helgason and James Kennington and H. Lall}, 29642 title = {A Polynomially Bounded Algorithm for Singly Constrained Quadratic Programs}, 29643 journal = {Mathematical Programming}, 29644 year = {1980}, 29645 volume = {18}, 29646 pages = {338--343} 29647} 29648 29649@Book{ henderson.quandt:microeconomic, 29650 author = {J. M. Henderson and R. E. Quandt}, 29651 title = {Microeconomic Theory}, 29652 publisher = {McGraw--Hill}, 29653 address = {New York}, 29654 year = {1980}, 29655 edition = {Third} 29656} 29657 29658@TechReport{ hendrickson.leland:chaco, 29659 author = {B. Hendrickson and R. Leland}, 29660 title = {The {C}haco User's Guide: Version 2}, 29661 institution = {Sandia National Laboratories}, 29662 type = {Technical Report}, 29663 number = {SAND94-2692}, 29664 address = {Albuquerque, New Mexico}, 29665 year = {1994} 29666} 29667 29668@InProceedings{ hendrickson.leland:multilevel, 29669 author = {B. Hendrickson and R. Leland}, 29670 title = {A Multilevel Algorithm for Partitioning Graphs}, 29671 booktitle = {Proceedings of Supercomputing '95}, 29672 year = {1995} 29673} 29674 29675@Book{ hertz.krogh.ea:introduction, 29676 author = {J. Hertz and A. Krogh and R. G. Palmer}, 29677 title = {Introduction to the Theory of Neural Computation}, 29678 year = {1991}, 29679 publisher = {Addison-Wesley}, 29680 address = {Redwood City, California} 29681} 29682 29683@Article{ hertz.werra:tabu, 29684 author = {A. Hertz and D. de Werra}, 29685 title = {Using {T}abu Search techniques for Graph Coloring}, 29686 journal = {Computing}, 29687 year = {1987}, 29688 volume = {29}, 29689 pages = {345--351} 29690} 29691 29692@InCollection{ hettich:review, 29693 author = {R. Hettich}, 29694 title = {A Review of Numerical Methods for Semi-Infinite Optimization}, 29695 booktitle = {Semi-Infinite Programming and Applications}, 29696 year = {1983}, 29697 editor = {A. V. Fiacco and K. O. Kortanek}, 29698 publisher = {Springer-Verlag}, 29699 address = {Berlin} 29700} 29701 29702@Article{ highleyman:note, 29703 author = {W. H. Highleyman}, 29704 title = {A Note on Linear Separation}, 29705 journal = {IRE Transactions on Electronic Computers}, 29706 year = {1961}, 29707 volume = {10}, 29708 pages = {777--778} 29709} 29710 29711@Article{ hildreth:quadratic, 29712 author = {C. Hildreth}, 29713 title = {A Quadratic Programming Procedure}, 29714 journal = {Naval Research Logistics Quarterly}, 29715 year = {1957}, 29716 volume = {4}, 29717 pages = {79--85}, 29718 note = {Erratum, p. 361} 29719} 29720 29721@Book{ himmelblau:applied, 29722 author = {D. M. Himmelblau}, 29723 title = {Applied Nonlinear Programming}, 29724 year = {1972}, 29725 publisher = {McGraw--Hill}, 29726 address = {New York} 29727} 29728 29729@Book{ hiriart-urruty.lemarechal:convex, 29730 author = {Jean-Baptiste Hiriart-Urruty and Claude Lemar\'{e}chal}, 29731 title = {Convex Analysis and Minimization Algorithms {I}}, 29732 year = {1993}, 29733 publisher = {Springer Verlag}, 29734 address = {Berlin}, 29735 volume = {305}, 29736 series = {Grundlehren der mathematischen Wissenschaften} 29737} 29738 29739@TechReport{ hironaka:introduction, 29740 author = {H. Hironaka}, 29741 title = {Introduction to real-analytic sets and real-analytic maps}, 29742 institution = {Instituto Matematico ``L. Tonelli'', Universit\`a di Pisa}, 29743 year = {1973}, 29744 type = {Technical Report}, 29745 address = {Pisa, Italy} 29746} 29747 29748@Article{ ho.lee.ea:decomposition, 29749 author = {J. K. Ho and T. C. Lee and R. P. Sundarraj}, 29750 title = {Decomposition of Linear Programs Using Parallel Computation}, 29751 journal = {Mathematical Programming}, 29752 year = {1988}, 29753 volume = {42}, 29754 pages = {391--405} 29755} 29756 29757@Article{ ho.loute:computational, 29758 author = {J. K. Ho and E. Loute}, 29759 title = {Computational Experience with Advanced Implementation of Decomposition Algorithms 29760 for Linear Programming}, 29761 journal = {Mathematical Programming}, 29762 year = {1983}, 29763 volume = {27}, 29764 pages = {283--290} 29765} 29766 29767@Book{ hock.schittkowski:test, 29768 author = {W. Hock and K. Schittkowski}, 29769 title = {Test Examples for Nonlinear Programming Codes}, 29770 volume = {187}, 29771 series = {Lecture Notes in Economics and Mathematical Systems}, 29772 year = {1981}, 29773 publisher = {Springer Verlag}, 29774 address = {Berlin, Germany} 29775} 29776 29777@Book{ hockney.jesshope:parallel, 29778 author = {R. W. Hockney and C. R. Jesshope}, 29779 title = {Parallel Computers 2}, 29780 publisher = {Adam Hilger}, 29781 year = {1988}, 29782 address = {Bristol} 29783} 29784 29785@Article{ hoffman:approximate, 29786 author = {A. J. Hoffman}, 29787 title = {On Approximate Solutions of Systems of Linear Inequalities}, 29788 journal = {Journal of Research of the National Bureau of Standards}, 29789 year = {1952}, 29790 volume = {49}, 29791 pages = {263--265} 29792} 29793 29794@Article{ hogan:comments, 29795 author = {W. W. Hogan}, 29796 title = {Comments on Manne and Richels: `{CO2} Emission Limits: An Economic Cost Analysis 29797 for the {USA}}, 29798 journal = {The Energy Journal}, 29799 year = {1990}, 29800 volume = {11}, 29801 pages = {75--84} 29802} 29803 29804@Article{ hogan:energy, 29805 author = {W. W. Hogan}, 29806 title = {Energy Policy Models for {P}roject {I}ndependence}, 29807 journal = {Computers \& Operations Research}, 29808 year = {1975}, 29809 volume = {2}, 29810 pages = {251--271} 29811} 29812 29813@Book{ holland:adaptation, 29814 author = {J. Holland}, 29815 title = {Adaptation in Natural and Artificial Systems}, 29816 year = {1975}, 29817 publisher = {The University of Michigan Press}, 29818 address = {Ann Arbor, Michigan} 29819} 29820 29821@Article{ holmes.mackie:comparison, 29822 author = {T. Holmes and T. R. Mackie}, 29823 title = {A comparison of three inverse treatment planning algorithms}, 29824 journal = {Physics in Medicine and Biology}, 29825 year = {1994}, 29826 volume = {39}, 29827 number = {1}, 29828 pages = {91--106} 29829} 29830 29831@Article{ holmes.mackie:filtered, 29832 author = {T. Holmes and T. R. Mackie}, 29833 title = {A filtered backprojection dose calculation method for inverse treatment 29834 planning}, 29835 journal = {Medical Physics}, 29836 year = {1994}, 29837 volume = {21}, 29838 number = {2}, 29839 pages = {303--313} 29840} 29841 29842@Article{ hooke.jeeves:direct, 29843 author = {R. Hooke and T. A. Jeeves}, 29844 title = {Direct Search Solution of Numerical and Statistical Problems}, 29845 journal = {Journal of Associated Computing Machinery}, 29846 year = {1961}, 29847 volume = {8}, 29848 pages = {212--229} 29849} 29850 29851@Article{ hoppe.mittelmann:multi-grid, 29852 author = {R. H. W. Hoppe and H. D. Mittelmann}, 29853 title = {A Multi-grid Continuation Strategy for Parameter-dependent Variational 29854 Inequalities}, 29855 journal = {Journal of Computational and Applied Mathematics}, 29856 year = {1989}, 29857 volume = {26}, 29858 pages = {35--46} 29859} 29860 29861@Book{ horn.johnson:matrix, 29862 author = {R. A. Horn and C. R. Johnson}, 29863 title = {Matrix Anaysis}, 29864 publisher = {Cambridge University Press}, 29865 year = {1985}, 29866 address = {Cambridge, England} 29867} 29868 29869@Article{ hornik.stinchcombe.ea:multilayer, 29870 author = {K. Hornik and M. Stinchcombe and H. White}, 29871 title = {Multilayer Feedforward Networks are Universal Approximators}, 29872 journal = {Neural Networks}, 29873 year = {1989}, 29874 volume = {2}, 29875 pages = {359--366} 29876} 29877 29878@Article{ horowitz.sahni:computing, 29879 author = {E. Horowitz and S. Sahni}, 29880 title = {Computing Partitions with Applications to the Knapsack Problem}, 29881 journal = {jacm}, 29882 year = {1974}, 29883 volume = {21}, 29884 pages = {277--292} 29885} 29886 29887@Article{ hristov.fallone:continuous, 29888 author = {D. H. Hristov and B. G. Fallone}, 29889 title = {A continuous penalty function method for inverse treatment planning}, 29890 journal = {Medical Physics}, 29891 year = {1998}, 29892 volume = {25}, 29893 number = {2}, 29894 pages = {208--223} 29895} 29896 29897@Article{ hu.cheng.ea:numerical, 29898 author = {Y. Hu and H. S. Cheng and T. Arai and Y. Kobayashi and S. Aoyama}, 29899 title = {Numerical simulation of piston ring in mixed lubrication---a nonaxisymmetrical 29900 analysis}, 29901 journal = {Transactions of the {ASME}}, 29902 volume = {116}, 29903 year = {1994}, 29904 pages = {470--478} 29905} 29906 29907@InProceedings{ hua.sheu:skyscraper, 29908 author = {K. A. Hua and S. Sheu}, 29909 title = {Skyscraper Broadcasting: {A} New Broadcasting System for Metropolitan 29910 Video-On-Demand Systems}, 29911 year = {1997}, 29912 booktitle = {Proceedings of the {ACM SIGCOMM'97} Conference}, 29913 address = {Cannes, France}, 29914 pages = {89--100} 29915} 29916 29917@Article{ huang.pang:option, 29918 author = {J. Huang and J. S. Pang}, 29919 title = {Option Pricing and Linear Complementarity}, 29920 journal = {Journal of Computational Finance}, 29921 volume = {2}, 29922 year = {1998}, 29923 pages = {31--60} 29924} 29925 29926@InCollection{ huard:resolution, 29927 author = {P. Huard}, 29928 title = {Resolution of Mathematical Programming with Nonlinear Constraints by the Method 29929 of Centers}, 29930 booktitle = {Nonlinear Programming}, 29931 year = {1967}, 29932 editor = {J. Abadie}, 29933 publisher = {North--Holland}, 29934 address = {Amsterdam}, 29935 pages = {207--219} 29936} 29937 29938@Book{ huber:robust, 29939 author = {P. J. Huber}, 29940 title = {Robust Statistics}, 29941 year = {1981}, 29942 publisher = {John Wiley}, 29943 address = {New York} 29944} 29945 29946@Book{ hudson:piecewise, 29947 author = {J. F. P. Hudson}, 29948 title = {Piecewise Linear Topology}, 29949 publisher = {Benjamin}, 29950 address = {New York}, 29951 year = {1969} 29952} 29953 29954@InCollection{ hunter.markusen.ea:north, 29955 author = {L. Hunter and J. R. Markusen and T. F. Rutherford}, 29956 title = {{N}orth {A}merican free trade and the production of finished automobiles}, 29957 booktitle = {Modeling North American Economic Integration}, 29958 publisher = {Kluwer Academic Publishers}, 29959 year = {1995}, 29960 editor = {T. Kehoe and P. Kehoe}, 29961 pages = {117--130} 29962} 29963 29964@Article{ ibarra.kim:fast, 29965 author = {O. H. Ibarra and C. E. Kim}, 29966 title = {Fast Approximation Algorithms for the Knapsack and Sum of Subset Problems}, 29967 journal = {jacm}, 29968 year = {1975}, 29969 volume = {22}, 29970 pages = {463--468} 29971} 29972 29973@Article{ ijiri:fundamental, 29974 author = {Y. Ijiri}, 29975 title = {Fundamental Queries in Aggregation Theory}, 29976 journal = {Journal of the American Statistical Association}, 29977 year = {1971}, 29978 volume = {66}, 29979 pages = {766--782} 29980} 29981 29982@Article{ ingargiola.korsh:reduction, 29983 author = {G. P. Ingargiola and J. F. Korsh}, 29984 title = {A Reduction Algorithm for the Zero--One Single Knapsack Problem}, 29985 journal = {Management Science}, 29986 year = {1973}, 29987 volume = {20}, 29988 pages = {460--463} 29989} 29990 29991@Article{ ioffe:variational, 29992 author = {A. D. Ioffe}, 29993 title = {Variational Analysis of a Composite Function: {A} Formula for the Lower 29994 Second--Order Directional Derivative}, 29995 journal = {Journal of Mathematical Analysis and its Applications}, 29996 year = {1993} 29997} 29998 29999@Article{ iri.imai:multiplicative, 30000 author = {M. Iri and H. Imai}, 30001 title = {A Multiplicative Barrier Function Method for Linear Programming}, 30002 journal = {Algorithmica}, 30003 year = {1986}, 30004 volume = {1}, 30005 pages = {455--482} 30006} 30007 30008@Article{ isac.goeleven:implicit, 30009 author = {G. Isac and D. Goeleven}, 30010 title = {The Implicit General Order Complementarity Problem, Models and Iterative 30011 Methods}, 30012 journal = {Annals of Operations Research}, 30013 year = {1993} 30014} 30015 30016@Article{ isac.kostreva:generalized, 30017 author = {G. Isac and M. M. Kostreva}, 30018 title = {The Generalized Order Complementarity Problem}, 30019 journal = {Journal of Optimization Theory and Applications}, 30020 volume = {19}, 30021 pages = {227--232}, 30022 year = {1991} 30023} 30024 30025@Book{ isac:complementarity, 30026 author = {G. Isac}, 30027 title = {Complementarity Problems}, 30028 publisher = {Springer-Verlag}, 30029 year = {1992}, 30030 series = {Lecture Notes in Mathematics}, 30031 address = {New York} 30032} 30033 30034@Article{ iusem.svaiter:variant, 30035 author = {A. N. Iusem and B. F. Svaiter}, 30036 title = {A Variant of {K}orpelevich's Method for Variational Inequalities with a New 30037 Search Strategy}, 30038 journal = {Optimization}, 30039 year = {1997}, 30040 volume = {42}, 30041 pages = {309--321} 30042} 30043 30044@Article{ iusem:convergence, 30045 author = {A. N. Iusem}, 30046 title = {On the Convergence of Iterative Methods for Symmetric Linear Complementarity 30047 Problems}, 30048 journal = {Mathematical Programming}, 30049 year = {1993}, 30050 volume = {59}, 30051 pages = {33--48} 30052} 30053 30054@Article{ jackson.kutcher.ea:probability, 30055 author = {A. Jackson and G. J. Kutcher and E. D. Yorke}, 30056 title = {Probability of Radiation-Induced Complications for Normal Tissues with Parallel 30057 Architecture subject to Non-Uniform Irradiation}, 30058 journal = {Medical Physics}, 30059 year = {1993}, 30060 volume = {20}, 30061 pages = {613--625} 30062} 30063 30064@Article{ jackson:optimization, 30065 author = {A. Jackson and X. H. Wang and R. Mohan}, 30066 title = {Optimization of Conformal Treatment Planning and Quadratic Dose Objectives 30067 (abstract)}, 30068 journal = {Medical Physics}, 30069 year = {1994}, 30070 volume = {21}, 30071 pages = {1006} 30072} 30073 30074@TechReport{ jackson:scheduling, 30075 author = {J. R. Jackson}, 30076 title = {Scheduling a Production Line to Minimize Maximum Tardiness}, 30077 institution = {University of California}, 30078 year = {1955}, 30079 address = {Los Angeles}, 30080 number = {43}, 30081 type = {Research Report} 30082} 30083 30084@Article{ jansen.roos.ea:polynomiality, 30085 author = {B. Jansen and C. Roos and T. Terlaky and A. Yoshise}, 30086 title = {Polynomiality of Primal-Dual Affine Scaling Algorithms for Nonlinear 30087 Complementarity Problems}, 30088 journal = {Mathematical Programming}, 30089 volume = {78}, 30090 pages = {315--346}, 30091 year = {1997} 30092} 30093 30094@Article{ jiang.fukushima.ea:trust, 30095 author = {H. Jiang and M. Fukushima and L. Qi and D. Sun}, 30096 title = {A Trust Region Method for Solving Generalized Complementarity Problems}, 30097 journal = {SIAM Journal on Optimization}, 30098 volume = {8}, 30099 pages = {140--157}, 30100 year = {1998} 30101} 30102 30103@Article{ jiang.qi:nonsmooth, 30104 author = {H. Jiang and L. Qi}, 30105 title = {A New Nonsmooth Equations Approach to Nonlinear Complementarity Problems}, 30106 journal = {SIAM Journal on Control and Optimization}, 30107 volume = {35}, 30108 pages = {178--193}, 30109 year = {1997} 30110} 30111 30112@TechReport{ jiang.ralph:qpecgen, 30113 author = {H. Jiang and D. Ralph}, 30114 title = {{QPECgen}, a {MATLAB} Generator for Mathematical Programs with Quadratic 30115 Objectives and Affine Variational Inequality Constraints}, 30116 year = {1997}, 30117 institution = {Department of Mathematics and Statistics, The University of Melbourne}, 30118 address = {Australia} 30119} 30120 30121@TechReport{ jiang.ralph:smooth, 30122 author = {H. Jiang and D. Ralph}, 30123 title = {Smooth {SQP} methods for Mathematical Programs with Nonlinear Complementarity 30124 Constraints}, 30125 year = {1997}, 30126 institution = {Department of Mathematics and Statistics, The University of Melbourne}, 30127 address = {Australia} 30128} 30129 30130@Article{ jiang:unconstrained, 30131 author = {H. Jiang}, 30132 title = {Unconstrained Minimization Approaches to Nonlinear Complementarity Problems}, 30133 journal = {Journal of Global Optimization, forthcoming}, 30134 year = {1997} 30135} 30136 30137@Article{ jittorntrum.osborne:strong, 30138 author = {K. Jittorntrum and M. R. Osborne}, 30139 title = {Strong uniqueness and second order convergence in nonlinear discrete 30140 approximation}, 30141 journal = {Numerische Mathematik}, 30142 year = {1980}, 30143 volume = {34}, 30144 pages = {439--455} 30145} 30146 30147@InProceedings{ jog.suh.ea:effects, 30148 crossref = {schaeffer:third}, 30149 author = {P. Jog and J. Y. Suh and D. Van Gucht}, 30150 title = {The Effects of Population Size, Heuristic Crossover and Local Improvement on a 30151 Genetic Algorithm for the Travelling Salesman Problem}, 30152 pages = {110--115} 30153} 30154 30155@Article{ jog.suh.ea:parallel, 30156 author = {P. Jog and J. Y. Suh and D. Van Gucht}, 30157 title = {Parallel Genetic Algorithms Applied to the Travelling Salesman Problem}, 30158 journal = {SIAM Journal on Optimization}, 30159 year = {1991}, 30160 volume = {1} 30161} 30162 30163@Article{ johansson.klarbring:rigid, 30164 author = {L. Johansson and A. Klarbring}, 30165 title = {The Rigid Punch Problem with Friction using Variational Inequalities and Linear 30166 Complementarity}, 30167 journal = {Mechanics of Structures \& Machines}, 30168 volume = {20}, 30169 pages = {293--319}, 30170 year = {1992} 30171} 30172 30173@Article{ johnson.aragon.ea:optimization, 30174 author = {D. S. Johnson and C. R. Aragon and L. A. McGeoch and C. Schevon}, 30175 title = {Optimization by Simulated Annealing: An Experimental Evaluation; Part {I}, Graph 30176 Partitioning}, 30177 journal = {Operations Research}, 30178 year = {1989}, 30179 volume = {37}, 30180 pages = {865--892} 30181} 30182 30183@Article{ johnson:optimally, 30184 author = {R. Johnson}, 30185 title = {Optimally Balancing Large Assembly Lines with {FABLE}}, 30186 journal = {Management Science}, 30187 year = {1988}, 30188 volume = {34}, 30189 pages = {240--253} 30190} 30191 30192@Article{ johnsson:solving, 30193 author = {S. L. Johnsson}, 30194 title = {Solving Tridiagonal Systems on Ensemble Architectures}, 30195 journal = {SIAM Journal on Scientific and Statistical Computing}, 30196 year = {1987}, 30197 volume = {8}, 30198 pages = {475--489} 30199} 30200 30201@Article{ jorgenson.wilcoxen:reducing, 30202 author = {D. W. Jorgenson and P. J. Wilcoxen}, 30203 title = {Reducing {US} Carbon Emissions: An Econometric General Equilibrium Assessment}, 30204 journal = {Resource and Energy Economics}, 30205 year = {1993}, 30206 volume = {15}, 30207 pages = {7--25} 30208} 30209 30210@TechReport{ josephy:hogans, 30211 author = {N. H. Josephy}, 30212 title = {Hogan's {PIES} Example and {L}emke's Algorithm}, 30213 institution = {Mathematics Research Center, University of Wisconsin--Madison}, 30214 year = {1979}, 30215 address = {Madison, Wisconsin}, 30216 number = {1972}, 30217 type = {Technical Summary Report} 30218} 30219 30220@TechReport{ josephy:newton, 30221 author = {N. H. Josephy}, 30222 title = {A {N}ewton Method for the {PIES} Energy Model}, 30223 institution = {Mathematics Research Center, University of Wisconsin--Madison}, 30224 year = {1979}, 30225 address = {Madison, Wisconsin}, 30226 number = {1971}, 30227 type = {Technical Summary Report} 30228} 30229 30230@PhDThesis{ josephy:newtons, 30231 author = {N. H. Josephy}, 30232 title = {{N}ewton's Method for Generalized Equations and the {PIES} Energy Model}, 30233 year = {1979}, 30234 school = {Department of Industrial Engineering, University of Wisconsin--Madison} 30235} 30236 30237@TechReport{ josephy:newtons*1, 30238 author = {N. H. Josephy}, 30239 title = {{N}ewton's Method for Generalized Equations}, 30240 institution = {Mathematics Research Center, University of Wisconsin}, 30241 year = {1979}, 30242 address = {Madison, Wisconsin}, 30243 number = {1965}, 30244 type = {Technical Summary Report} 30245} 30246 30247@TechReport{ josephy:quasi-newton, 30248 author = {N. H. Josephy}, 30249 title = {Quasi--{N}ewton Methods for Generalized Equations}, 30250 institution = {Mathematics Research Center, University of Wisconsin}, 30251 year = {1979}, 30252 address = {Madison, Wisconsin}, 30253 number = {1966}, 30254 type = {Technical Summary Report} 30255} 30256 30257@PhDThesis{ kabbadj:methodes, 30258 author = {S. Kabbadj}, 30259 title = {Methodes Proximales Entropiques}, 30260 school = {Universit\'{e} de Montpellier II -- Sciences et Techniques du Languedoc}, 30261 year = {1994}, 30262 type = {Doctoral Thesis} 30263} 30264 30265@Book{ kall.wallace:stochastic, 30266 author = {P. Kall and S. W. Wallace}, 30267 title = {Stochastic Programming}, 30268 publisher = {John Wiley \& Sons}, 30269 year = {1994}, 30270 address = {Chichester} 30271} 30272 30273@Article{ kallman.agren.ea:tumor, 30274 author = {P. Kallman and A. Agren and A. Brahme}, 30275 title = {Tumor and Normal Tissue Responses to Fractionated Non-Uniform Dose Delivery}, 30276 journal = {International Journal of Radiation Biology}, 30277 year = {1992}, 30278 volume = {62}, 30279 pages = {249--262} 30280} 30281 30282@Misc{ kalvelagen:gams, 30283 author = {Erwin Kalvelagen}, 30284 title = {The {GAMS} {I/O} Library}, 30285 howpublished = {mimeo, GAMS Development Corporation}, 30286 year = {1992}, 30287 note = {Preliminary Version} 30288} 30289 30290@Article{ kaneko:complete, 30291 author = {I. Kaneko}, 30292 title = {Complete solution of a class of elastic-plastic structures}, 30293 journal = {Computer Methods in Applied Mechanics and Engineering}, 30294 volume = {21}, 30295 year = {1980}, 30296 pages = {193--209} 30297} 30298 30299@Article{ kaneko:mathematical, 30300 author = {I. Kaneko}, 30301 title = {A mathematical programming method for the inelastic analysis of reinforced 30302 concrete frames}, 30303 journal = {International Journal for Numerical Methods in Engineering}, 30304 volume = {11}, 30305 year = {1977}, 30306 pages = {1137--1154} 30307} 30308 30309@Article{ kaneko:piecewise, 30310 author = {I. Kaneko}, 30311 title = {Piecewise linear elastic-plastic analysis}, 30312 journal = {International Journal for Numerical Methods in Engineering}, 30313 volume = {14}, 30314 year = {1979}, 30315 pages = {757--767} 30316} 30317 30318@Article{ kanet:minimizing, 30319 author = {J. J. Kanet}, 30320 title = {Minimizing the Average Deviation of Job Completion Times about a Common Due 30321 Date}, 30322 journal = {Naval Research Logistics Quarterly}, 30323 year = {1981}, 30324 volume = {28}, 30325 pages = {643--651} 30326} 30327 30328@Article{ kantorovich:mathematical, 30329 author = {L. V. Kantorovich}, 30330 title = {Mathematical Methods in the Organization and Planning of Production}, 30331 journal = {Management Science}, 30332 year = {1960}, 30333 volume = {6}, 30334 pages = {366--422}, 30335 note = {English translation, Russian version 1939} 30336} 30337 30338@Article{ kanzow.fukushima:equivalence, 30339 author = {C. Kanzow and M. Fukushima}, 30340 title = {Equivalence of the Generalized Complementarity Problem to Differentiable 30341 Unconstrained Minimization}, 30342 journal = {Journal of Optimization Theory and Applications}, 30343 year = {1996}, 30344 volume = {90}, 30345 pages = {581--603} 30346} 30347 30348@Article{ kanzow.fukushima:theoretical, 30349 author = {C. Kanzow and M. Fukushima}, 30350 title = {Theoretical and Numerical Investigation of the {D}-gap function for 30351 Box-Constrained Variational Inequalities}, 30352 journal = {Mathematical Programming}, 30353 year = {1998}, 30354 volume = {83}, 30355 pages = {55--88} 30356} 30357 30358@Article{ kanzow.jiang:continuation, 30359 author = {C. Kanzow and H. Jiang}, 30360 title = {A Continuation Method for (Strongly) Monotone Variational Inequalities}, 30361 journal = {Mathematical Programming}, 30362 year = {1998}, 30363 volume = {81}, 30364 pages = {103--125} 30365} 30366 30367@Article{ kanzow.kleinmichel:class, 30368 author = {C. Kanzow and H. Kleinmichel}, 30369 title = {A Class of {N}ewton-Type Methods for Equality and Inequality Constrained 30370 Optimization}, 30371 journal = {Optimization Methods and Software}, 30372 year = {1995}, 30373 volume = {5}, 30374 pages = {173--198} 30375} 30376 30377@Article{ kanzow.kleinmichel:new, 30378 author = {C. Kanzow and H. Kleinmichel}, 30379 title = {A New Class of Semismooth {N}ewton-Type Methods for Nonlinear Complementarity 30380 Problems}, 30381 journal = {Computational Optimization and Applications}, 30382 volume = {11}, 30383 pages = {227--251}, 30384 year = {1998} 30385} 30386 30387@Article{ kanzow.pieper:jacobian, 30388 author = {C. Kanzow and H. Pieper}, 30389 title = {Jacobian Smoothing Methods for Nonlinear Complementarity Problems}, 30390 journal = {SIAM Journal on Optimization}, 30391 year = {1999}, 30392 volume = {9}, 30393 pages = {342--373} 30394} 30395 30396@Article{ kanzow.qi:qp-free, 30397 author = {C. Kanzow and H. -D. Qi}, 30398 title = {A {QP}-free constrained {N}ewton-type method for variational inequality 30399 problems}, 30400 journal = {Mathematical Programming}, 30401 year = {1999}, 30402 volume = {85}, 30403 pages = {81--106} 30404} 30405 30406@Article{ kanzow.yamashita.ea:ncp-functions, 30407 author = {C. Kanzow and N. Yamashita and M. Fukushima}, 30408 title = {New {NCP}-functions and their properties}, 30409 journal = {Journal of Optimization Theory and Applications}, 30410 year = {1997}, 30411 volume = {94}, 30412 pages = {115--135} 30413} 30414 30415@TechReport{ kanzow.zupke:inexact, 30416 author = {C. Kanzow and M. Zupke}, 30417 title = {Inexact Trust-Region Methods for Nonlinear Complementarity Problems}, 30418 year = {1997}, 30419 institution = {Institute of Applied Mathematics, University of Hamburg}, 30420 type = {Preprint}, 30421 number = {127}, 30422 address = {Hamburg, Germany} 30423} 30424 30425@Article{ kanzow:approach, 30426 author = {C. Kanzow}, 30427 title = {A New Approach to Continuation Methods for Complementarity Problems with Uniform 30428 {P}-Functions}, 30429 journal = {Operations Research Letters}, 30430 volume = {20}, 30431 year = {1997}, 30432 pages = {85--92} 30433} 30434 30435@Article{ kanzow:equation-based, 30436 author = {C. Kanzow}, 30437 title = {Some Equation--Based Methods for the Nonlinear Complementarity Problem}, 30438 journal = {Optimization Methods and Software}, 30439 year = {1994}, 30440 volume = {3}, 30441 pages = {327--340} 30442} 30443 30444@Article{ kanzow:global, 30445 author = {C. Kanzow}, 30446 title = {Global Convergence Properties of Some Iterative Methods for Linear 30447 Complementarity Problems}, 30448 journal = {SIAM Journal on Optimization}, 30449 year = {1996}, 30450 volume = {6}, 30451 pages = {326--341} 30452} 30453 30454@Article{ kanzow:inexact, 30455 author = {C. Kanzow}, 30456 title = {An Inexact {QP}--based method for nonlinear complementarity problems}, 30457 journal = {Numerische Mathematik, forthcoming}, 30458 year = {1999} 30459} 30460 30461@Article{ kanzow:noninterior, 30462 author = {C. Kanzow}, 30463 title = {Some Noninterior Continuation Methods for Linear Complementarity Problems}, 30464 journal = {SIAM Journal on Matrix Analysis and Applications}, 30465 volume = {17}, 30466 pages = {851--868}, 30467 year = {1996} 30468} 30469 30470@Article{ kanzow:nonlinear, 30471 author = {C. Kanzow}, 30472 title = {Nonlinear Complementarity as Unconstrained Optimization}, 30473 journal = {Journal of Optimization Theory and Applications}, 30474 year = {1996}, 30475 volume = {88}, 30476 pages = {139--155} 30477} 30478 30479@TechReport{ kanzow:semismooth, 30480 author = {C. Kanzow}, 30481 title = {Semismooth {N}ewton-Type Methods for the Solution of Nonlinear Complementarity 30482 Problems}, 30483 institution = {Institute of Applied Mathematics, University of Hamburg}, 30484 year = {1997}, 30485 type = {Preprint}, 30486 address = {Hamburg, Germany} 30487} 30488 30489@TechReport{ kanzow:tools, 30490 annote = {This should be replaced by kanzow:noninterior}, 30491 author = {C. Kanzow}, 30492 title = {Some Tools Allowing Interior--Point Methods to Become Noninterior}, 30493 institution = {Institute of Applied Mathematics, University of Hamburg}, 30494 year = {1994}, 30495 address = {Germany} 30496} 30497 30498@Article{ kaplan.meier:nonparametric, 30499 author = {E. L. Kaplan and P. Meier}, 30500 title = {Nonparametric Estimation from Incomplete Observations}, 30501 journal = {J. Am. Stat. Assoc.}, 30502 year = {1958}, 30503 volume = {53}, 30504 pages = {457--481} 30505} 30506 30507@Article{ karamardian:complementarity, 30508 author = {S. Karamardian}, 30509 title = {The Complementarity Problem}, 30510 journal = {Mathematical Programming}, 30511 year = {1972}, 30512 volume = {2}, 30513 pages = {107--129} 30514} 30515 30516@Article{ karamardian:complementarity*1, 30517 author = {S. Karamardian}, 30518 title = {Complementarity Problems over {C}ones with Monotone and Pseudomonotone Maps}, 30519 journal = {Journal of Optimization Theory and Applications}, 30520 year = {1976}, 30521 volume = {18}, 30522 pages = {445--454} 30523} 30524 30525@Article{ karamardian:generalized, 30526 author = {S. Karamardian}, 30527 title = {Generalized Complementarity Problem}, 30528 journal = {Journal of Optimization Theory and Applications}, 30529 year = {1971}, 30530 volume = {8}, 30531 pages = {161--167} 30532} 30533 30534@Article{ karmarkar.karp.ea:probabilistic, 30535 author = {N. Karmarkar and R. M. Karp and G. S. Lueker and A. M. Odlyzko}, 30536 title = {Probabilistic Analysis of Optimum Partitioning}, 30537 journal = {Journal of Applied Probability}, 30538 year = {1986}, 30539 volume = {23}, 30540 pages = {626--645} 30541} 30542 30543@Article{ karmarkar:polynomial, 30544 author = {N. Karmarkar}, 30545 title = {A New Polynomial Time Algorithm for Linear Programming}, 30546 journal = {Combinatorica}, 30547 year = {1984}, 30548 volume = {4}, 30549 pages = {373--395} 30550} 30551 30552@Unpublished{ karp:probabilistic, 30553 author = {R. M. Karp}, 30554 title = {Probabilistic Analysis of Algorithms}, 30555 note = {(Lecture Notes)} 30556} 30557 30558@InCollection{ karp:reducibility, 30559 author = {R. M. Karp}, 30560 title = {Reducibility among Combinatorial Problems}, 30561 booktitle = {Complexity of Computer Computations}, 30562 year = {1972}, 30563 editor = {R. E. Miller and J. W. Thatcher}, 30564 publisher = {Plenum Press}, 30565 address = {New York}, 30566 pages = {85--103} 30567} 30568 30569@MastersThesis{ karush:minima, 30570 author = {W. Karush}, 30571 title = {Minima of Functions of Several Variables with Inequalities as Side Conditions}, 30572 year = {1939}, 30573 school = {Department of Mathematics, University of Chicago} 30574} 30575 30576@TechReport{ karypis.kumar:metis, 30577 author = {G. Karypis and V. Kumar}, 30578 title = {{METIS}: Unstructured Graph Partitioning and Sparse Matrix Ordering System, 30579 Version 2.0}, 30580 institution = {University of Minnesota, Department of Computer Science}, 30581 type = {Technical Report}, 30582 address = {Minnesota}, 30583 year = {1995} 30584} 30585 30586@TechReport{ karypis.kumar:multilevel, 30587 author = {G. Karypis and V. Kumar}, 30588 title = {Multilevel k-way Partitioning Scheme for Irregular Graphs}, 30589 institution = {University of Minnesota, Department of Computer Science}, 30590 type = {Technical Report}, 30591 number = {95-064}, 30592 address = {Minnesota}, 30593 year = {1995} 30594} 30595 30596@Article{ katukani:generalization, 30597 author = {S. Katukani}, 30598 title = {A Generalization of {B}rouwer's Fixed Point Theorem}, 30599 journal = {Duke Mathematical Journal}, 30600 year = {1941}, 30601 volume = {8}, 30602 pages = {457--459} 30603} 30604 30605@Article{ keifer.wolfowitz:stochastic, 30606 author = {J. Keifer and J. Wolfowitz}, 30607 title = {Stochastic Estimation of the Maximum of a Regression Function}, 30608 journal = {Annals of Mathematical Statistics}, 30609 year = {1952}, 30610 volume = {23}, 30611 pages = {462--466} 30612} 30613 30614@InCollection{ kellog.li.ea:method, 30615 author = {R. B. Kellog and T. Y. Li and J. A. Yorke}, 30616 title = {A Method of Continuation for Calculating a {B}rouwer Fixed Point}, 30617 booktitle = {Computing Fixed Points with Applications}, 30618 year = {1977}, 30619 editor = {S. Karamardian}, 30620 publisher = {Academic Press}, 30621 pages = {133--147} 30622} 30623 30624@Book{ kennington.helgason:algorithms, 30625 author = {J. L. Kennington and R. V. Helgason}, 30626 title = {Algorithms for Network Programming}, 30627 year = {1980}, 30628 publisher = {John Wiley \& Sons}, 30629 address = {New York} 30630} 30631 30632@Article{ kernighan.lin:efficient, 30633 author = {B. W. Kernighan and S. Lin}, 30634 title = {An Efficient Heuristic Procedure for Partitioning Graphs}, 30635 journal = {The Bell System Technical Journal}, 30636 pages = {291--307}, 30637 volume = {29}, 30638 year = {1970} 30639} 30640 30641@Article{ khachian:polynomial, 30642 author = {L. G. Khachian}, 30643 title = {A Polynomial Algorithm for Linear Programming}, 30644 journal = {Soviet Mathematics Doklady}, 30645 year = {1979}, 30646 volume = {20}, 30647 pages = {191--194} 30648} 30649 30650@Article{ khobotov:modification, 30651 author = {E. N. Khobotov}, 30652 title = {A Modification of the Extragradient Method for the Solution of Variational 30653 Inequalities and some Optimization Problems}, 30654 journal = {Zhurnal Vychislitel'noi Matematiki i Matematicheskoi Fiziki}, 30655 year = {1987}, 30656 volume = {27}, 30657 pages = {1462--1473} 30658} 30659 30660@Book{ khuri.cornell:response, 30661 author = {A. I. Khuri and J. A. Cornell}, 30662 title = {Response Surfaces: Designs and Analyses}, 30663 publisher = {Marcel Dekker}, 30664 year = {1987}, 30665 address = {New York} 30666} 30667 30668@Article{ kibardin:decomposition, 30669 author = {V. M. Kibardin}, 30670 title = {Decomposition into Functions in the Minimization Problems}, 30671 journal = {Automation and Remote Control}, 30672 year = {1980}, 30673 volume = {40}, 30674 pages = {1311--1323} 30675} 30676 30677@TechReport{ king:sposl, 30678 author = {A. J. King}, 30679 title = {{SP/OSL} Version 1.0 Stochastic Programming Interface Library User's Guide}, 30680 institution = {IBM T.J. Watson Research Center}, 30681 year = {1994}, 30682 number = {RC 19757}, 30683 address = {Yorktown Heights, New York} 30684} 30685 30686@Article{ kirkpatrick.gelatt.ea:optimization, 30687 author = {S. Kirkpatrick and C. D. Gelatt and M. P. {Vecchi Jr.}}, 30688 title = {Optimization by Simulated Annealing}, 30689 journal = {Science}, 30690 year = {1983}, 30691 volume = {220}, 30692 pages = {671--680} 30693} 30694 30695@Book{ kiwiel:methods, 30696 author = {K. C. Kiwiel}, 30697 title = {Methods of Descent for Nondifferentiable Optimization}, 30698 year = {1985}, 30699 publisher = {Springer-Verlag}, 30700 address = {Berlin}, 30701 series = {Lecture Notes in Mathematics}, 30702 number = {1133} 30703} 30704 30705@Article{ kiwiel:twice, 30706 author = {K. C. Kiwiel}, 30707 title = {On the Twice Differentiable Cubic Augmented {L}agrangian}, 30708 journal = {Journal of Optimization Theory and Applications}, 30709 year = {1996}, 30710 volume = {88}, 30711 pages = {233--236} 30712} 30713 30714@Article{ klarbring.bjorkman:mathematical, 30715 author = {A. Klarbring and G. Bj{\"{o}}rkman}, 30716 title = {A mathematical programming approach to contact problems with friction and varying 30717 contact surface}, 30718 journal = {Computers \& Structures}, 30719 volume = {30}, 30720 year = {1988}, 30721 pages = {1185--1198} 30722} 30723 30724@Article{ klarbring.bjorkman:solution, 30725 author = {A. Klarbring and G. Bj{\"{o}}rkman}, 30726 title = {Solution of large displacement contact problems with friction using {N}ewton's 30727 method for generalized equations}, 30728 journal = {International Journal for Numerical Methods in Engineering}, 30729 volume = {34}, 30730 year = {1992}, 30731 pages = {249--269} 30732} 30733 30734@Article{ klarbring.pang:existence, 30735 author = {A. Klarbring and J. S. Pang}, 30736 title = {Existence of solution to discrete semicoercive frictional contact problems}, 30737 journal = {{SIAM} Journal on Optimization, under review}, 30738 year = {1996} 30739} 30740 30741@Article{ klarbring:discrete, 30742 author = {A. Klarbring}, 30743 title = {On Discrete and Discretized Non-linear Elastic Structures in Unilateral Contact 30744 (Stability, Uniqueness and Variational Principles)}, 30745 journal = {International Journal on Solids and Structures}, 30746 volume = {24}, 30747 pages = {459--479}, 30748 year = {1988} 30749} 30750 30751@TechReport{ klarbring:large, 30752 author = {A. Klarbring}, 30753 title = {Large Displacement Frictional Contact: a Continuum Framework for Finite Element 30754 Discretization}, 30755 number = {LiTH-IKP-R-798}, 30756 institution = {Department of Mechanical Engineering, Link{\"o}ping Institute of Technology}, 30757 address = {Link{\"o}ping}, 30758 year = {1994} 30759} 30760 30761@Article{ klarbring:mathematical, 30762 author = {A. Klarbring}, 30763 title = {A mathematical programming approach to three dimensional contact problems with 30764 friction}, 30765 journal = {Computer Methods in Applied Mechanics and Engineering}, 30766 volume = {58}, 30767 year = {1986}, 30768 pages = {175--200} 30769} 30770 30771@InCollection{ klarbring:mathematical*1, 30772 author = {A. Klarbring}, 30773 title = {Mathematical programming and augmented {L}agrangian methods for frictional 30774 contact problems}, 30775 editor = {A. Curnier}, 30776 booktitle = {Proceedings Contact Mechanics International Symposium}, 30777 publisher = {Presse Polytechniques et Universitaires Romandes}, 30778 address = {Lausanne}, 30779 year = {1992}, 30780 pages = {409--422} 30781} 30782 30783@InCollection{ klarbring:mathematical*2, 30784 author = {A. Klarbring}, 30785 title = {Mathematical programming in contact problems}, 30786 editors = {M. H. Aliabadi and C. A. Brebbia}, 30787 booktitle = {Computational Methods for Contact Problems}, 30788 publisher = {Computational Mechanics Publications}, 30789 address = {Southampton}, 30790 year = {1993}, 30791 pages = {233--264} 30792} 30793 30794@Article{ klarbring:quadratic, 30795 author = {A. Klarbring}, 30796 title = {A quadratic program in frictionless contact problems}, 30797 journal = {International Journal of Engineering Science}, 30798 volume = {24}, 30799 pages = {1207--1217}, 30800 year = {1986} 30801} 30802 30803@InCollection{ klee.minty:how, 30804 author = {V. Klee and G. J. Minty}, 30805 title = {How Good is the Simplex Algorithm?}, 30806 booktitle = {Inequalities--III}, 30807 year = {1972}, 30808 publisher = {Academic Press}, 30809 pages = {159--175} 30810} 30811 30812@Article{ kleywegt.shapiro:sample, 30813 author = {A. Kleywegt and A. Shapiro}, 30814 title = {The Sample Average Approximation Method for Stochastic Discrete Optimization}, 30815 journal = {Stochastic Programming E-Print Series}, 30816 year = {1999}, 30817 note = {Available from dochost.rz.hu-berlin.de/speps} 30818} 30819 30820@Book{ knuth:art, 30821 author = {D. E. Knuth}, 30822 title = {The Art of Computer Programming}, 30823 publisher = {Addison-Wesley Longman Inc.}, 30824 address = {Reading, Massachusetts}, 30825 year = {1998}, 30826 edition = {Third}, 30827 volume = {2} 30828} 30829 30830@InProceedings{ kocvara.outrata:nonsmooth, 30831 author = {M. Ko\v{c}vara and J. V. Outrata}, 30832 title = {A nonsmooth approach to optimization problems with equilibrium constraints}, 30833 crossref = {ferris.pang:complementarity}, 30834 pages = {148--164} 30835} 30836 30837@Article{ kocvara.outrata:optimization, 30838 author = {M. Ko\v{c}vara and J. V. Outrata}, 30839 title = {On Optimization of Systems Governed by Implicit Complementarity Problems}, 30840 volume = {15}, 30841 journal = {Numerical Fucntional Analysis and Optimization}, 30842 year = {1994}, 30843 pages = {869--887} 30844} 30845 30846@InCollection{ kocvara.outrata:solution, 30847 author = {M. Ko\v{c}vara and J. V. Outrata}, 30848 title = {On the solution of optimum design problems with variational inequalities}, 30849 editors = {D. Z. Du and L. Qi and R. Womersley}, 30850 booktitle = {Recent Advances in Nonsmooth Optimization}, 30851 publisher = {World Scientific Publishers}, 30852 address = {Singapore}, 30853 year = {1995}, 30854 pages = {172--192} 30855} 30856 30857@Article{ kojima.hirabayashi:homotopy, 30858 author = {M. Kojima and R. Hirabayashi}, 30859 title = {Continuous deformation of nonlinear programs}, 30860 journal = {Mathematical Programming Study}, 30861 editor = {A.~V. Fiacco}, 30862 publisher = {North--Holland}, 30863 address = {Amsterdam}, 30864 year = {1984}, 30865 volume = {21}, 30866 pages = {150--198} 30867} 30868 30869@Article{ kojima.megiddo.ea:homotopy, 30870 author = {M. Kojima and N. Megiddo and T. Noma}, 30871 title = {Homotopy Continuation Methods for Nonlinear Complementarity Problems}, 30872 journal = {Mathematics of Operations Research}, 30873 year = {1991}, 30874 volume = {16}, 30875 pages = {754--774} 30876} 30877 30878@TechReport{ kojima.megiddo.ea:primal-dual, 30879 author = {M. Kojima and N. Megiddo and S. Mizuno}, 30880 title = {A primal-dual exterior point algorithm for linear programming}, 30881 institution = {IBM Alamaden Research Center}, 30882 year = {1991}, 30883 number = {RJ 8500}, 30884 address = {San Jose, California} 30885} 30886 30887@Book{ kojima.megiddo.ea:unified, 30888 author = {M. Kojima and N. Megiddo and T. Noma and A. Yoshise}, 30889 title = {A Unified Approach to Interior Point Algorithms for Linear Complementarity 30890 Problems}, 30891 year = {1991}, 30892 publisher = {Springer-Verlag}, 30893 address = {Berlin}, 30894 volume = {538}, 30895 series = {Lecture Notes in Computer Science} 30896} 30897 30898@Article{ kojima.mizuno.ea:continuation, 30899 author = {M. Kojima and S. Mizuno and T. Noma}, 30900 title = {A New Continuation Method for Complementarity Problems with Uniform 30901 {P}-function}, 30902 journal = {Mathematical Programming}, 30903 year = {1989}, 30904 volume = {43}, 30905 pages = {107--113} 30906} 30907 30908@TechReport{ kojima.mizuno.ea:infeasible, 30909 author = {M. Kojima and S. Mizuno and M. Todd}, 30910 title = {Infeasible interior-point primal-dual potential-reduction algorithms for linear 30911 programming}, 30912 institution = {School of Operations Research and Industrial Engineering, Cornell University}, 30913 year = {1992}, 30914 number = {1023}, 30915 address = {Ithaca, New York}, 30916 month = aug 30917} 30918 30919@Article{ kojima.mizuno.ea:onl, 30920 author = {M. Kojima and S. Mizuno and A. Yoshise}, 30921 title = {An ${O}(\sqrt{n}{L})$ iteration potential reduction algorithm for linear 30922 complementarity problems}, 30923 journal = {Mathematical Programming}, 30924 year = {1991}, 30925 volume = {50}, 30926 pages = {331--342} 30927} 30928 30929@Article{ kojima.mizuno.ea:polynomial-time, 30930 author = {M. Kojima and S. Mizuno and A. Yoshise}, 30931 title = {A Polynomial-Time Algorithm for a Class of Linear Complementarity Problems}, 30932 journal = {Mathematical Programming}, 30933 year = {1989}, 30934 volume = {44}, 30935 pages = {1--20} 30936} 30937 30938@Article{ kojima.noma.ea:global, 30939 author = {M. Kojima and T. Noma and A. Yoshise}, 30940 title = {Global Convergence in Infeasible Interior--Point Algorithms}, 30941 journal = {Mathematical Programming}, 30942 volume = {65}, 30943 pages = {43--72}, 30944 year = {1994} 30945} 30946 30947@Article{ kojima.shindo.ea:interior-point, 30948 author = {M. Kojima and S. Shindo and S. Hara}, 30949 title = {Interior--Point Methods for the Monotone Semidefinite Linear Complementarity 30950 Problem in Symmetric Matrices}, 30951 journal = {SIAM Journal on Optimization}, 30952 volume = {7}, 30953 pages = {86--125} 30954} 30955 30956@Article{ kojima.shindo:extensions, 30957 author = {M. Kojima and S. Shindo}, 30958 title = {Extensions of {N}ewton and Quasi-{N}ewton Methods to Systems of {PC}$^1$ 30959 Equations}, 30960 journal = {Journal of Operations Research Society of Japan}, 30961 year = {1986}, 30962 volume = {29}, 30963 pages = {352--374} 30964} 30965 30966@Article{ kojima:computational, 30967 author = {M. Kojima}, 30968 title = {Computational Methods for Solving the Nonlinear Complementarity Problem}, 30969 journal = {Keio Engineering Reports}, 30970 year = {1974}, 30971 volume = {27}, 30972 pages = {1--41} 30973} 30974 30975@Article{ kojima:recent, 30976 author = {M. Kojima}, 30977 title = {Recent advances in mathematical programming. {X}. Computation of fixed points by 30978 continuation methods}, 30979 journal = {Systems and Control}, 30980 year = {1981}, 30981 volume = {25}, 30982 pages = {421--430} 30983} 30984 30985@Article{ kolesar:branch, 30986 author = {P. J. Kolesar}, 30987 title = {A Branch and Bound Algorithm for the Knapsack Problem}, 30988 journal = {Management Science}, 30989 year = {1967}, 30990 volume = {13}, 30991 pages = {723--735} 30992} 30993 30994@Book{ kolman.beck:elementary, 30995 author = {B. Kolman and R. E. Beck}, 30996 title = {Elementary Linear Programming with Applications}, 30997 year = {1980}, 30998 publisher = {Academic Press} 30999} 31000 31001@Book{ koopmans:activity, 31002 editor = {T. C. Koopmans}, 31003 title = {Activity Analysis of Production and Allocation}, 31004 publisher = {John Wiley}, 31005 address = {New York}, 31006 year = {1951} 31007} 31008 31009@Article{ korpelevich:extragradient, 31010 author = {G. M. Korpelevich}, 31011 title = {The Extragradient Method for Finding Saddle Points and Other Problems}, 31012 journal = {Matecon}, 31013 year = {1976}, 31014 volume = {12}, 31015 pages = {747--756} 31016} 31017 31018@Article{ kortanek.shi:convergence, 31019 author = {K. O. Kortanek and M. Shi}, 31020 title = {Convergence Results and Numerical Experiments on a Linear Programming Hybrid 31021 Algorithm}, 31022 journal = {European Journal of Operational Research}, 31023 year = {1987}, 31024 volume = {32}, 31025 pages = {47--61} 31026} 31027 31028@TechReport{ kortanek.shi:remarks, 31029 author = {K. O. Kortanek and M. Shi}, 31030 title = {Remarks on `Convergence Results and Numerical Experiments on a Linear Programming 31031 Hybrid Algorithm 1985-6'}, 31032 institution = {College of Business Administration, University of Iowa}, 31033 year = {1987}, 31034 address = {Iowa City}, 31035 number = {87--1}, 31036 type = {Working Paper} 31037} 31038 31039@TechReport{ kortanek:vector-supercomputer, 31040 author = {K. O. Kortanek}, 31041 title = {Vector--Supercomputer Experiments with the Linear Programming Scaling Algorithm}, 31042 institution = {College of Business Administration, University of Iowa}, 31043 year = {1987}, 31044 address = {Iowa City}, 31045 number = {87--2}, 31046 type = {Working Paper} 31047} 31048 31049@Article{ kostreva:block, 31050 author = {M. M. Kostreva}, 31051 title = {Block Pivot Methods for Solving the Complementarity Problem}, 31052 journal = {Linear Algebra and Its Applications}, 31053 volume = {21}, 31054 pages = {207--215}, 31055 year = {1978} 31056} 31057 31058@Article{ kostreva:elasto-hydrodynamic, 31059 author = {M. M. Kostreva}, 31060 title = {Elasto-hydrodynamic Lubrication: {A} non-linear complementarity problem}, 31061 journal = {International Journal for Numerical Methods in Fluids}, 31062 year = {1984}, 31063 volume = {4}, 31064 pages = {377--397} 31065} 31066 31067@Article{ kostreva:recent, 31068 author = {M. M. Kostreva}, 31069 title = {Recent Results on Complementarity Models for Engineering and Economics}, 31070 journal = {Infor, Journal of the Canadian {OR} Society}, 31071 year = {1990}, 31072 volume = {28}, 31073 pages = {324--334} 31074} 31075 31076@Article{ kotiah.steinberg:occurrences, 31077 author = {T. C. T. Kotiah and D. I. Steinberg}, 31078 title = {Occurrences of Cycling and Other Phenomena Arising in a Class of Linear 31079 Programming Models}, 31080 journal = {Communications of the ACM}, 31081 volume = {20}, 31082 year = {1977}, 31083 pages = {107--112} 31084} 31085 31086@Article{ kotiah.steinberg:possibility, 31087 author = {T. C. T. Kotiah and D. I. Steinberg}, 31088 title = {On the Possibility of Cycling with the Simplex Method}, 31089 journal = {Operations Research}, 31090 volume = {26}, 31091 year = {1978}, 31092 pages = {374--376} 31093} 31094 31095@InCollection{ kuhn.tucker:nonlinear, 31096 author = {H. W. Kuhn and A. W. Tucker}, 31097 title = {Nonlinear Programming}, 31098 booktitle = {Proceedings of the Second Berkeley Symposium on Mathematical Statistics and 31099 Probability}, 31100 year = {1951}, 31101 editor = {J. Neyman}, 31102 publisher = {University of California Press}, 31103 address = {Berkeley and Los Angeles}, 31104 pages = {481--492} 31105} 31106 31107@Article{ kummer:metric, 31108 author = {B. Kummer}, 31109 title = {Metric regularity: characterizations, nonsmooth variations, and successive 31110 approximation}, 31111 journal = {Journal of Mathematical Analysis and its Applications}, 31112 year = {}, 31113 optkey = {}, 31114 optvolume = {}, 31115 optnumber = {}, 31116 optpages = {}, 31117 optmonth = {}, 31118 optnote = {}, 31119 optannote = {} 31120} 31121 31122@InCollection{ kummer:newtons, 31123 author = {B. Kummer}, 31124 title = {{N}ewton's Method for Non--Differentiable Functions}, 31125 booktitle = {Advances in Mathematical Optimization}, 31126 publisher = {Akademie--Verlag}, 31127 year = {1988}, 31128 editors = {J. Guddat et al.}, 31129 pages = {114--125}, 31130 address = {Berlin} 31131} 31132 31133@Unpublished{ kuntsevich.kappel:solvopt, 31134 author = {A. Kuntsevich and F. Kappel}, 31135 title = {{SolvOpt}: The Solver for Local Nonlinear Optimization Problems}, 31136 year = {1997}, 31137 note = {Institute for Mathematics, Karl-Franzens University of Graz}, 31138 url = {http://bedvgm.kfunigraz.ac.at:8001/alex/solvopt/solvopt.html} 31139} 31140 31141@Book{ kushner.clark:stochastic, 31142 author = {H. J. Kushner and D. S. Clark}, 31143 title = {Stochastic Approximation Methods for Constrained and Unconstrained Systems}, 31144 publisher = {Springer-Verlag}, 31145 year = {1978}, 31146 address = {New York} 31147} 31148 31149@Article{ kutcher.burman.ea:histogram, 31150 author = {G. J. Kutcher and C. Burman and L. Brewster and M. Goitein and R. Mohan}, 31151 title = {Histogram reduction method for calculating complication probabilities for 31152 three-dimensional treatment planning evaluation}, 31153 journal = {International Journal of Radiation Oncology, Biology and Physics}, 31154 year = {1991}, 31155 optvolume = {21}, 31156 optpages = {137-146} 31157} 31158 31159@Article{ kutcher.burman:calculation, 31160 author = {G. J. Kutcher and C. Burman}, 31161 title = {Calculation of Complication Probability Factors for Non-Uniform Normal Tissue 31162 Irradiation: The Effective Volume Method}, 31163 journal = {International Journal of Radiation Oncology, Biology and Physics}, 31164 year = {1989}, 31165 volume = {16}, 31166 pages = {1623--1630} 31167} 31168 31169@Article{ kwak.lee:complementarity, 31170 author = {B. M. Kwak and B. C. Lee.}, 31171 title = {A Complementarity Problem Formulation for Two-Dimensional Frictional Contact 31172 Problem}, 31173 journal = {Computers and Structures}, 31174 volume = {18}, 31175 pages = {469--480}, 31176 year = {1988} 31177} 31178 31179@Article{ kwak:complementarity, 31180 author = {B. M. Kwak}, 31181 title = {Complementarity Problem Formulation of Three-Dimensional Frictional Contact}, 31182 journal = {Journal of Applied Mechanics}, 31183 volume = {58}, 31184 pages = {134--140}, 31185 year = {1991} 31186} 31187 31188@Article{ lagarias.reeds.ea:convergence, 31189 author = {J. C. Lagarias and J. A. Reeds and M. H. Wright and P. E. Wright}, 31190 title = {Convergence of the {N}elder-{M}ead Simplex method in Low Dimensions}, 31191 journal = {SIAM Journal on Optimization}, 31192 year = {1998}, 31193 volume = {9}, 31194 pages = {112--147} 31195} 31196 31197@Article{ lahaye:methode, 31198 author = {E. Lahaye}, 31199 title = {Une {M}\'{e}thode de {R}\'{e}solution d'une Cat\'{e}gorie d'\'{E}quations 31200 transcendantes}, 31201 journal = {C. R. Acad. Sci. Paris}, 31202 year = {1934}, 31203 volume = {198}, 31204 pages = {1840--1842} 31205} 31206 31207@Article{ lahaye:solution, 31208 author = {E. Lahaye}, 31209 title = {Solution of Systems of Transcendental Equations}, 31210 journal = {Acad. Roy. Belg. Bull. Cl. Sci.}, 31211 year = {1948}, 31212 volume = {5}, 31213 pages = {805--822} 31214} 31215 31216@Article{ lahenbruch.mickey:estimation, 31217 author = {P. A. Lahenbruch and R. M. Mickey}, 31218 title = {Estimation of Error Rates in Discriminant Analysis}, 31219 journal = {Technometrics}, 31220 year = {1968}, 31221 volume = {10}, 31222 pages = {1--11} 31223} 31224 31225@Article{ lakshminarayan.lakshmanan.ea:optimal, 31226 author = {S. Lakshminarayan and R. Lakshmanan and R. L. Papineau and R. Rochette}, 31227 title = {Optimal Single--Machine Scheduling with Earliness and Tardiness}, 31228 journal = {Operations Research}, 31229 year = {1978}, 31230 volume = {26}, 31231 pages = {1079--1082} 31232} 31233 31234@Article{ land.doig:automatic, 31235 author = {A. H. Land and A. G. Doig}, 31236 title = {An Automatic Method for Solving Discrete Programming Problems}, 31237 journal = {Econometrica}, 31238 volume = {28}, 31239 year = {1960}, 31240 pages = {497-520} 31241} 31242 31243@Article{ langer.morrill:comparison, 31244 author = {M. Langer and S. Morrill}, 31245 title = {A comparison of mixed integer programming and fast simulated annealing for 31246 optimized beam weights in radiation therapy}, 31247 journal = {Medical Physics}, 31248 year = {1996}, 31249 volume = {23}, 31250 number = {6}, 31251 pages = {957--964} 31252} 31253 31254@Article{ larsson.patriksson:class, 31255 author = {T. Larsson and M. Patriksson}, 31256 title = {A Class of Gap Functions for Variational Inequalities}, 31257 journal = {Mathematical Programming}, 31258 year = {1994}, 31259 volume = {64}, 31260 pages = {53--79} 31261} 31262 31263@Article{ lasdon.waren.ea:solving, 31264 author = {L. S. Lasdon and A. Waren and S. Sarkar and F. Palacios}, 31265 title = {Solving the Pooling Problem Using Generalized Reduced Gradient and Successive 31266 Linear Programming Algorithms}, 31267 journal = {ACM SIGMAP Bulletin}, 31268 year = {1979}, 31269 volume = {27}, 31270 pages = {9--15} 31271} 31272 31273@TechReport{ lawler.lenstra.ea:sequencing, 31274 author = {E. L. Lawler and J. K. Lenstra and A. H. G. Rinnooy Kan and D. B. Shmoys}, 31275 title = {Sequencing and Scheduling: Algorithms and Complexity}, 31276 institution = {Centre for Mathematics and Computer Science}, 31277 year = {1989}, 31278 address = {P.O. Box 4079, 1009 AB Amsterdam, The Netherlands}, 31279 number = {BS--R89xx} 31280} 31281 31282@Article{ lawler:fast, 31283 author = {E. L. Lawler}, 31284 title = {Fast Approximations Algorithms for Knapsack Problems}, 31285 journal = {Mathematics of Operations Research}, 31286 year = {1979}, 31287 volume = {4}, 31288 pages = {339--356} 31289} 31290 31291@Book{ lawless:statistical, 31292 author = {J. F. Lawless}, 31293 title = {Statistical Models and Methods for Lifetime Data}, 31294 year = {1982}, 31295 publisher = {John Wiley and Sons}, 31296 address = {New York, NY} 31297} 31298 31299@Article{ lawrence.spingarn:fixed, 31300 author = {J. Lawrence and J. E. Spingarn}, 31301 title = {On fixed points of non-expansive piecewise isometric mappings}, 31302 journal = {Proceedings of the London Mathematical Society}, 31303 year = {1987}, 31304 volume = {55}, 31305 number = {3}, 31306 pages = {605--624} 31307} 31308 31309@Article{ leavitt.martin.ea:dynamic, 31310 author = {D. D. Leavitt and M. Martin and J. H. Moeller and W. L. Lee}, 31311 title = {Dynamic wedge field techniques through computer-controlled collimator motion and 31312 dose delivery}, 31313 journal = {Medical Physics}, 31314 year = {1990}, 31315 volume = {17}, 31316 number = {1}, 31317 pages = {87--92} 31318} 31319 31320@Article{ leblanc.morlok.ea:efficient, 31321 author = {L. J. LeBlanc and E. K. Morlok and W. P. Pierskalla}, 31322 title = {An Efficient Approach to Solving the Road Network Equilibrium Traffic Assignment 31323 Problem}, 31324 journal = {Transportation Research}, 31325 volume = {9}, 31326 year = {1975}, 31327 pages = {309--318} 31328} 31329 31330@Article{ lee:computational, 31331 author = {S. S. Lee}, 31332 title = {A computational method for frictional contact problem using finite element 31333 method}, 31334 journal = {International Journal for Numerical Methods in Engineering}, 31335 volume = {37}, 31336 year = {1994}, 31337 pages = {217--228} 31338} 31339 31340@PhDThesis{ lee:military, 31341 author = {D. K. Lee}, 31342 title = {Military Force Planning Problems Under Uncertainty}, 31343 school = {University of Wisconsin -- Madison}, 31344 year = {1996}, 31345 address = {Madison, Wisconsin} 31346} 31347 31348@Article{ leibel.kutcher.ea:improved, 31349 author = {S. A. Leibel and G. J. Kutcher and L. B. Harrison and D. E. Fass and C. Burman 31350 and M. Hunt and R. Mohan and L. J. Brewster and C. C. Ling and Z. Y. Fuks}, 31351 title = {Improved Dose Distributions For 3{D} Conformal Boost Treatments in Carcinoma of 31352 the Nasopharynx}, 31353 journal = {International Journal of Radiation Oncology, Biology and Physics}, 31354 year = {1991}, 31355 volume = {20}, 31356 pages = {823--833} 31357} 31358 31359@Article{ lee.gallagher.ea:treatment, 31360 author = {E. K. Lee and R. J. Gallagher and D. Silvern and C. S. Wuu and M. Zaider}, 31361 title = {Treatment Planning for Brachytherapy: an Integer Programming Model, Two 31362 Computational Approaches and Experiments with Permanent Prostate Implant 31363 Planning}, 31364 journal = {Physics in Medicine and Biology}, 31365 year = {1999}, 31366 volume = {44}, 31367 pages = {145--165} 31368} 31369 31370@Article{ lemarechal.nemirovskii.ea:variants, 31371 author = {C. Lemar\'{e}chal and A. Nemirovskii and Y. Nesterov}, 31372 title = {New Variants of Bundle Methods}, 31373 year = {1995}, 31374 journal = {Mathematical Programming}, 31375 volume = {69}, 31376 pages = {111--147} 31377} 31378 31379@InCollection{ lemarechal.strodiot.ea:bundle, 31380 author = {C. Lemar\'{e}chal and J. J. Strodiot and A. Bihain}, 31381 title = {On a Bundle Algorithm for Nonsmooth Optimization}, 31382 booktitle = {Nonlinear Programming}, 31383 year = {1981}, 31384 editor = {O. L. Mangasarian and R. R. Meyer and S. M. Robinson}, 31385 publisher = {Academic Press}, 31386 pages = {245--282}, 31387 volume = {4} 31388} 31389 31390@Article{ lemke.howson:equilibrium, 31391 author = {C. E. Lemke and J. T. Howson}, 31392 title = {Equilibrium Points of Bimatrix Games}, 31393 journal = {SIAM Journal on Applied Mathematics}, 31394 year = {1964}, 31395 volume = {12}, 31396 pages = {413--423} 31397} 31398 31399@Article{ lemke:bimatrix, 31400 author = {C. E. Lemke}, 31401 title = {Bimatrix Equilibrium Points and Mathematical Programming}, 31402 journal = {Management Science}, 31403 year = {1965}, 31404 volume = {11}, 31405 pages = {681--689} 31406} 31407 31408@InCollection{ lemke:complementary, 31409 author = {C. E. Lemke}, 31410 title = {On Complementary Pivot Theory}, 31411 booktitle = {Mathematics of the Decision Sciences: Part 1}, 31412 publisher = {American Mathematical Society}, 31413 year = {1968}, 31414 editor = {G. B. Dantzig and A. F. Veinott}, 31415 volume = {11}, 31416 series = {Lectures in Applied Mathematics}, 31417 address = {Providence}, 31418 pages = {95--114} 31419} 31420 31421@Article{ levenberg:method, 31422 author = {K. Levenberg}, 31423 title = {A Method for the Solution of Certain Nonlinear Problems in Least Squares}, 31424 journal = {Quarterly Applied Mathematics}, 31425 year = {1944}, 31426 volume = {2}, 31427 pages = {164--168} 31428} 31429 31430@Article{ levitin.polyak:constrained, 31431 author = {E. S. Levitin and B. T. Polyak}, 31432 title = {Constrained minimization methods}, 31433 journal = {Computational Mathematics and Mathematical Physics}, 31434 year = {1968}, 31435 volume = {6}, 31436 pages = {1--50}, 31437 note = {Translated from Russian} 31438} 31439 31440@Article{ li.swetis:linear, 31441 author = {W. Li and J. J. Swetits}, 31442 title = {The Linear $\ell_1$ Estimator and the {H}uber {M}-Estimator}, 31443 journal = {SIAM Journal on Optimization}, 31444 volume = {8}, 31445 pages = {457-475}, 31446 year = {1998} 31447} 31448 31449@TechReport{ li:error, 31450 author = {W. Li}, 31451 title = {Error Bounds for Piecewise Convex Quadratic Programs and Applications}, 31452 institution = {Department of Mathematics and Statistics, Old Dominion University}, 31453 year = {1993}, 31454 address = {Norfolk, VA 23529}, 31455 number = {TR93-1}, 31456 note = {SIAM Journal on Control and Optimization, to appear} 31457} 31458 31459@TechReport{ li:linearly, 31460 author = {W. Li}, 31461 title = {Linearly Convergent Descent Methods for Unconstrained Minimization of Convex 31462 Quadratic Splines}, 31463 institution = {Department of Mathematics and Statistics, Old Dominion University}, 31464 year = {1993}, 31465 address = {Norfolk, VA 23529}, 31466 number = {TR93-3}, 31467 note = {Journal of Optimization Theory and Applications, to appear} 31468} 31469 31470@InProceedings{ li:merit, 31471 author = {W. Li}, 31472 title = {A Merit Function and a {N}ewton-Type Method for Symmetric Linear Complementarity 31473 Problems}, 31474 crossref = {ferris.pang:complementarity} 31475} 31476 31477@Article{ li:remarks, 31478 author = {W. Li}, 31479 title = {Remarks on Convergence of Matrix Splitting Algorithm for the Symmetric Linear 31480 Complementarity Problem}, 31481 journal = {SIAM Journal on Optimization}, 31482 year = {1993}, 31483 volume = {3}, 31484 pages = {155--163} 31485} 31486 31487@TechReport{ li:sharp, 31488 author = {W. Li}, 31489 title = {Sharp {L}ipschitz Constants for Basic Optimal Solutions of Linear Programs}, 31490 institution = {Department of Mathematics and Statistics, Old Dominion University}, 31491 year = {1991}, 31492 address = {Norfolk, VA 23529}, 31493 number = {TR91-13}, 31494 note = {SIAM Journal on Control and Optimization, to appear} 31495} 31496 31497@Article{ lin.kernighan:efficient, 31498 author = {S. Lin and B. W. Kernighan}, 31499 title = {An Efficient Heuristic Algorithm for the Traveling Salesman Problem}, 31500 journal = {Operations Research}, 31501 year = {1973}, 31502 volume = {21}, 31503 pages = {498--516} 31504} 31505 31506@Article{ lin.pang:iterative, 31507 author = {Y. Y. Lin and J. S. Pang}, 31508 title = {Iterative Methods for Large Convex Quadratic Programs: {A} Survey}, 31509 journal = {SIAM Journal on Control and Optimization}, 31510 year = {1987}, 31511 volume = {25}, 31512 pages = {383--411} 31513} 31514 31515@Unpublished{ linderoth:branch, 31516 author = {J. Linderoth}, 31517 title = {A {B}ranch-and-{P}rice Approach to Stochastic Integer Programming}, 31518 institution = {Argonne National Laboratories}, 31519 year = {2000}, 31520 note = {Working Paper} 31521} 31522 31523@Article{ lions.stampacchia:variational, 31524 author = {J. L. Lions and G. Stampacchia}, 31525 title = {Variational Inequalities}, 31526 journal = {Communications on Pure and Applied Math}, 31527 year = {1967}, 31528 volume = {20}, 31529 pages = {493--19} 31530} 31531 31532@Article{ lions.mercier:splitting, 31533 author = {P.--L. Lions and B. Mercier}, 31534 title = {Splitting Methods for the Sum of Two Nonlinear Operators}, 31535 journal = {SIAM Journal on Numerical Analysis}, 31536 year = {1979}, 31537 volume = {16}, 31538 pages = {964--979} 31539} 31540 31541@Article{ lions:methode, 31542 author = {P.--L. Lions}, 31543 title = {Une {M}\'{e}thode it\'{e}rative de resolution d'une inequation variationnelle}, 31544 journal = {Israel Journal of Mathematics}, 31545 year = {1978}, 31546 volume = {31}, 31547 number = {2}, 31548 pages = {204--208} 31549} 31550 31551@InProceedings{ litzkow.livny.ea:condor, 31552 author = {M. J. Litzkow and M. Livny and M. W. Mutka}, 31553 title = {Condor: {A} Hunter of Idle Workstations}, 31554 booktitle = {Proceedings of the 8th International Conference on Distributed Computing 31555 Systems}, 31556 year = {1988}, 31557 pages = {104--111}, 31558 month = jun 31559} 31560 31561@Article{ liu.nocedal:limited, 31562 author = {D. C. Liu and J. Nocedal}, 31563 title = {On the Limited Memory Method for Large Scale Optimization}, 31564 journal = {Mathematical Programming}, 31565 year = {1989}, 31566 volume = {45}, 31567 pages = {503--528} 31568} 31569 31570@InBook{ livny.raman:high, 31571 author = {M. Livny and R. Raman}, 31572 title = {The Grid: Blueprint for a Future Computing Infrastructure}, 31573 chapter = {High Throughput Resource Management}, 31574 publisher = {Morgan Kaufmann Publishers}, 31575 year = {1999}, 31576 pages = {311--337} 31577} 31578 31579@Article{ llacer:inverse, 31580 author = {J. Llacer}, 31581 title = {Inverse Radiation Treatment Planning using the Dynamically Penalized Likelihood 31582 Method}, 31583 journal = {Medical Physics}, 31584 year = {1997}, 31585 volume = {24}, 31586 number = {11}, 31587 pages = {1751--1764} 31588} 31589 31590@Book{ lojasiewicz:ensembles, 31591 author = {M. S. Lojasiewicz}, 31592 title = {Ensembles semi-analytiques}, 31593 publisher = {Institut des Hautes Etudes Scientifiques}, 31594 year = {1964}, 31595 address = {Bures-sur-Yvette} 31596} 31597 31598@Article{ lootsma:logarithmic, 31599 author = {F. A. Lootsma}, 31600 title = {Logarithmic Programming: {A} Method of Solving Nonlinear Programming Problems}, 31601 journal = {Phillips Research Reports}, 31602 year = {1967}, 31603 volume = {22}, 31604 pages = {329--344} 31605} 31606 31607@InCollection{ lootsma:survey, 31608 author = {F. A. Lootsma}, 31609 title = {A Survey of Methods for Solving Constrained Minimization Problems via 31610 Unconstrained Minimization}, 31611 booktitle = {Numerical Methods for Nonlinear Optimization}, 31612 year = {1972}, 31613 editor = {F. A. Lootsma}, 31614 publisher = {Academic Press}, 31615 address = {London} 31616} 31617 31618@TechReport{ lopezdesilanes.markusen.ea:anti-competitive, 31619 author = {F. {Lopez-de-Silanes} and J. R. Markusen and T. F. Rutherford}, 31620 title = {Anti--Competitive and Rent--Shifting Aspects of Domestic--Content Provisions in 31621 Regional Trade Blocks}, 31622 institution = {National Bureau of Economic Research, Inc.}, 31623 year = {1993}, 31624 number = {4512}, 31625 address = {Cambridge, Massechusetts} 31626} 31627 31628@InCollection{ lopezdesilanes.markusen.ea:auto, 31629 author = {F. {Lopez-de-Silanes} and J. R. Markusen and T. F. Rutherford}, 31630 title = {The auto industry and the {N}orth {A}merican free-trade agreement}, 31631 year = {1994}, 31632 booktitle = {Modelling Trade Policy: AGE Assessments of North American Free Trade}, 31633 publisher = {Cambridge University Press}, 31634 editor = {C. Shields and J. Francois} 31635} 31636 31637@Article{ lopezdesilanes.markusen.ea:complementarity, 31638 author = {F. {Lopez-de-Silanes} and J. R. Markusen and T. F. Rutherford}, 31639 title = {Complementarity and Increasing Returns in Intermediate Inputs}, 31640 journal = {Journal of Development Economics}, 31641 year = {1994}, 31642 volume = {45}, 31643 pages = {133--151} 31644} 31645 31646@Article{ lopezdesilanes.markusen.ea:trade, 31647 author = {F. {Lopez-de-Silanes} and J. R. Markusen and T. F. Rutherford}, 31648 title = {Trade Policy Subtleties with Multinational Firms}, 31649 journal = {European Economic Review}, 31650 year = {1996} 31651} 31652 31653@Article{ lotstedt:coulomb, 31654 author = {P. L{\"{o}}tstedt}, 31655 title = {Coulomb friction in two-dimensional rigid body systems}, 31656 journal = {Zeitschrift f{\"{u}}r Angewandte Mathematik und Mechanik}, 31657 volume = {61}, 31658 year = {1981}, 31659 pages = {605--615} 31660} 31661 31662@Article{ lotstedt:mechanical, 31663 author = {P. L{\"{o}}tstedt}, 31664 title = {Mechanical systems of rigid bodies subject to unilateral constraints}, 31665 journal = {SIAM Journal on Applied Mathematics}, 31666 volume = {42}, 31667 year = {1982}, 31668 pages = {281--296} 31669} 31670 31671@Book{ luenberger:linear, 31672 author = {D. G. Luenberger}, 31673 title = {Linear and Nonlinear Programming}, 31674 year = {1984}, 31675 publisher = {Addison-Wesley}, 31676 edition = {Second} 31677} 31678 31679@Book{ luenberger:optimization, 31680 author = {D. G. Luenberger}, 31681 title = {Optimization by Vector Space Methods}, 31682 year = {1969}, 31683 publisher = {John Wiley \& Sons}, 31684 address = {New York} 31685} 31686 31687@Article{ lundy.mees:convergence, 31688 author = {M. Lundy and A. Mees}, 31689 title = {Convergence of an Annealing Algorithm}, 31690 journal = {Mathematical Programming}, 31691 year = {1986}, 31692 volume = {34}, 31693 pages = {111--124} 31694} 31695 31696@Article{ luo.luo:extension, 31697 author = {X.-D. Luo and Z.-Q. Luo}, 31698 title = {Extension of Hoffman's Error Bound to Polynomial Systems}, 31699 journal = {SIAM Journal on Optimization}, 31700 year = {1994}, 31701 volume = {4}, 31702 pages = {383--392} 31703} 31704 31705@Article{ luo.mangasarian.ea:error, 31706 author = {Z.-Q. Luo and O. L. Mangasarian and J. Ren and M. V. Solodov}, 31707 title = {New Error Bounds for the Linear Complementarity Problem}, 31708 journal = {Mathematics of Operations Research}, 31709 year = {1994}, 31710 pages = {880--892}, 31711 volume = {19} 31712} 31713 31714@Article{ luo.pang.ea:exact, 31715 author = {Z.-Q. Luo and J. S. Pang and D. Ralph and S.-Q. Wu}, 31716 title = {Exact Penalization and Stationarity Conditions of Mathematical Programs with 31717 Equilibrium Constraints}, 31718 journal = {Mathematical Programming}, 31719 volume = {75}, 31720 pages = {19--76}, 31721 year = {1996} 31722} 31723 31724@Book{ luo.pang.ea:mathematical, 31725 author = {Z.-Q. Luo and J. S. Pang and D. Ralph}, 31726 title = {Mathematical Programs with Equilibrium Constraints}, 31727 publisher = {Cambridge University Press}, 31728 year = {1996} 31729} 31730 31731@Article{ luo.pang:error, 31732 author = {Z.-Q. Luo and J. S. Pang}, 31733 title = {Error Bounds for Analytic Systems and their Applications}, 31734 journal = {Mathematical Programming}, 31735 year = {1994}, 31736 volume = {67}, 31737 pages = {1--28} 31738} 31739 31740@Article{ luo.shu.ea:optimizing, 31741 author = {L. Luo and H. Shu and W. Yu and Y. Yan and X. Bao and Y. Fu}, 31742 title = {Optimizing computerized treatment planning for the Gamma Knife by source 31743 culling}, 31744 journal = {International Journal of Radiation Oncology, Biology and Physics}, 31745 year = {1999}, 31746 volume = {45}, 31747 number = {5}, 31748 pages = {1339--1346} 31749} 31750 31751@InProceedings{ luo.tseng:class, 31752 author = {Z.-Q. Luo and P. Tseng}, 31753 title = {A New Class of Merit Functions for the Nonlinear Complementarity Problem}, 31754 crossref = {ferris.pang:complementarity}, 31755 pages = {204--225} 31756} 31757 31758@Article{ luo.tseng:convergence, 31759 author = {Z.-Q. Luo and P. Tseng}, 31760 title = {On the Convergence of the Coordinate Descent Method for Convex Differentiable 31761 Minimization}, 31762 journal = {Journal of Optimization Theory and Applications}, 31763 year = {1992}, 31764 volume = {72}, 31765 pages = {7--35} 31766} 31767 31768@Article{ luo.tseng:convergence*1, 31769 author = {Z.-Q. Luo and P. Tseng}, 31770 title = {On the Convergence of a Matrix Splitting Algorithm for the Symmetric Monotone 31771 Linear Complementarity Problem}, 31772 journal = {SIAM Journal on Control and Optimization}, 31773 year = {1991}, 31774 volume = {29}, 31775 pages = {1037--1060} 31776} 31777 31778@Article{ luo.tseng:convergence*2, 31779 author = {Z.-Q. Luo and P. Tseng}, 31780 title = {On the Convergence Rate of Dual Ascent Methods for Strictly Convex Minimization}, 31781 journal = {Mathematics of Operations Research}, 31782 year = {1993}, 31783 volume = {18}, 31784 pages = {846--867} 31785} 31786 31787@Article{ luo.tseng:error, 31788 author = {Z.--Q. Luo and P. Tseng}, 31789 title = {Error Bound and Convergence Analysis of Matrix Splitting Algorithms for the 31790 Affine Variational Inequality Problem}, 31791 journal = {SIAM Journal on Optimization}, 31792 year = {1992}, 31793 volume = {2}, 31794 pages = {43--54} 31795} 31796 31797@Article{ luo.tseng:error*1, 31798 author = {Z.-Q. Luo and P. Tseng}, 31799 title = {Error Bound and Reduced Gradient Projection Algorithms for Convex Minimization 31800 Over a Polyhedral Set}, 31801 journal = {SIAM Journal on Optimization}, 31802 year = {1993}, 31803 volume = {3}, 31804 pages = {43--59} 31805} 31806 31807@Article{ luo.tseng:error*2, 31808 author = {Z.-Q. Luo and P. Tseng}, 31809 title = {Error Bounds and Convergence Analysis of Feasible Descent Methods: {A} General 31810 Approach}, 31811 journal = {Annals of Operations Research}, 31812 year = {1993}, 31813 volume = {46}, 31814 pages = {157--178} 31815} 31816 31817@Article{ luo.tseng:global, 31818 author = {Z.-Q. Luo and P. Tseng}, 31819 title = {On Global Error Bound for a Class of Monotone Affine Variational Inequality 31820 Problems}, 31821 journal = {Operations Research Letters}, 31822 year = {1992}, 31823 volume = {11}, 31824 pages = {159--165} 31825} 31826 31827@Article{ luo.tseng:linear, 31828 author = {Z.-Q. Luo and P. Tseng}, 31829 title = {On the linear convergence of descent methods for convex essentially smooth 31830 minimization}, 31831 journal = {SIAM Journal on Control and Optimization}, 31832 year = {1992}, 31833 volume = {30}, 31834 pages = {408--425} 31835} 31836 31837@TechReport{ luo:convergence, 31838 author = {Z.-Q. Luo}, 31839 title = {Convergence Analysis of Primal--Dual Interior--Point Algorithms for Convex 31840 Quadratic Programs}, 31841 institution = {Communications Research Laboratory, McMaster University}, 31842 year = {1992}, 31843 address = {Hamilton, Ontario} 31844} 31845 31846@Article{ lustig.marsten.ea:computational, 31847 author = {I. J. Lustig and R. E. Marsten and D. F. Shanno}, 31848 title = {Computational Experience with a Primal-Dual Interior Point Method for Linear 31849 Programming}, 31850 journal = {Linear Algebra and Its Applications}, 31851 year = {1991}, 31852 volume = {152}, 31853 pages = {191--222} 31854} 31855 31856@Article{ lustig.marsten.ea:implementing, 31857 author = {I. J. Lustig and R. E. Marsten and D. F. Shanno}, 31858 title = {On implementing {M}ehrotra's predictor-corrector interior point method for linear 31859 programming}, 31860 journal = {SIAM Journal on Optimization}, 31861 year = {1992}, 31862 volume = {2}, 31863 pages = {435--449} 31864} 31865 31866@Article{ lustig.marsten.ea:interior-point, 31867 author = {I. J. Lustig and R. E. Marsten and D. F. Shanno}, 31868 title = {Interior-Point Methods for Linear Programming: Computational State of the Art}, 31869 journal = {ORSA Journal on Computing}, 31870 year = {1994}, 31871 volume = {6}, 31872 number = {1}, 31873 pages = {1--38} 31874} 31875 31876@Article{ lyman.wolbarst:optimization, 31877 author = {J. T. Lyman and A. B. Wolbarst}, 31878 title = {Optimization of Radiation Therapy {IV}: {A} Dose Volume Histogram Reduction 31879 Algorithm}, 31880 journal = {International Journal of Radiation Oncology, Biology and Physics}, 31881 year = {1989}, 31882 volume = {17}, 31883 pages = {433--436} 31884} 31885 31886@Article{ mackie.holmes.ea:tomotherapy*1, 31887 author = {T. R. Mackie and T. Holmes and S. Swerdloff and P. Reckwerdt and J. O. Deasy and 31888 J. Yang and B. Paliwal and T. Kinsella}, 31889 title = {Tomotherapy: a new concept for the delivery of dynamic conformal radiotherapy}, 31890 journal = {Medical Physics}, 31891 year = {1993}, 31892 volume = {20}, 31893 number = {6}, 31894 pages = {1709--1719} 31895} 31896 31897@Article{ mackie.holmes.ea:tomotherapy*2, 31898 author = {T. R. Mackie and T. W. Holmes and P. J. Reckwerdt and J. Yang}, 31899 title = {Tomotherapy: Optimized Planning and Delivery of Radiation Therapy}, 31900 journal = {Int. J. of Imaging Systems and Technology}, 31901 year = {1995}, 31902 volume = {6}, 31903 pages = {43--55} 31904} 31905 31906@Article{ mackie.scrimger.ea:convolution, 31907 author = {T. R. Mackie and J. W. Scrimger and J. J. Batista}, 31908 title = {A convolution method of calculating dose from 15 Me{V} x-rays}, 31909 journal = {Medical Physics}, 31910 year = {1985}, 31911 volume = {12}, 31912 pages = {188--196} 31913} 31914 31915@Article{ mackinnon:technique, 31916 author = {James G. Mac{K}innon}, 31917 title = {A Technique for the Solution of Spatial Equilibrium Models}, 31918 journal = {Journal of Regional Science}, 31919 year = {1976}, 31920 volume = {16}, 31921 pages = {293--307} 31922} 31923 31924@PhDThesis{ madsen:minimization, 31925 author = {K. Madsen}, 31926 title = {Minimization of Nonlinear Approximation Functions}, 31927 year = {1985}, 31928 address = {Lyngby, Denmark}, 31929 school = {Institute of Numerical Analysis, Technical University of Denmark}, 31930 annote = {Dissertation} 31931} 31932 31933@Book{ magill.quinzii:theory, 31934 author = {M. Magill and M. Quinzii}, 31935 title = {Theory of Incomplete Markets}, 31936 publisher = {MIT Press}, 31937 year = {1996} 31938} 31939 31940@InCollection{ magnanti:models, 31941 author = {T. L. Magnanti}, 31942 title = {Models and Algorithms for Predicting Urban Traffic Equilibria}, 31943 booktitle = {Transportation Planning Models}, 31944 year = {1984}, 31945 editor = {M. Florian}, 31946 publisher = {North Holland}, 31947 pages = {153--186} 31948} 31949 31950@InCollection{ maguregui:modified, 31951 author = {J. Maguregui}, 31952 title = {A modified {N}ewton algorithm for functions over convex sets}, 31953 crossref = {mangasarian.meyer.ea:nonlinear*3}, 31954 pages = {461--473} 31955} 31956 31957@PhDThesis{ maguregui:regular, 31958 author = {J. Maguregui}, 31959 title = {Regular Multivalued Functions and Algorithmic Applications}, 31960 year = {1977}, 31961 address = {Madison, Wisconsin}, 31962 school = {Computer Sciences Department, University of Wisconsin} 31963} 31964 31965@Article{ mahey.oualibouch.ea:proximal, 31966 author = {P. Mahey and S. Oualibouch and D. T. Pham}, 31967 title = {Proximal Decomposition on the Graph of a Maximal Monotone Operator}, 31968 journal = {SIAM Journal on Optimization}, 31969 year = {1995}, 31970 volume = {5}, 31971 pages = {454--466} 31972} 31973 31974@Article{ mahey.pham:partial, 31975 author = {P. Mahey and D. T. Pham}, 31976 title = {Partial Regularization of the Sum of Two Maximal Monotone Operators}, 31977 journal = {{RAIRO} Mod\'{e}lisation et Analyse Num\'{e}rique}, 31978 year = {1993}, 31979 volume = {27}, 31980 pages = {375--392} 31981} 31982 31983@InCollection{ maier.novati:shakedown, 31984 author = {G. Maier and G. Novati}, 31985 title = {A shakedown and bounding theory allowing for nonlinear hardening and second order 31986 geometric effects with reference to discrete structural models}, 31987 editors = {J. A. K{\"{o}}nig and M. Kleiber}, 31988 booktitle = {Inelastic Solids and Structures, A. Sawczuk memorial volume}, 31989 publisher = {Pineridge Press}, 31990 address = {Swansea}, 31991 year = {1990}, 31992 pages = {451--471} 31993} 31994 31995@Article{ maier:incremental, 31996 author = {G. Maier}, 31997 title = {Incremental Plastic Analysis in the Presence of Large Displacement and Physical 31998 Instabilizing Effects}, 31999 journal = {International Journal of Solids and Structures}, 32000 volume = {7}, 32001 year = {1971}, 32002 pages = {345--372} 32003} 32004 32005@InCollection{ maier:inverse, 32006 author = {G. Maier}, 32007 title = {Inverse Problems in Engineering Plasticity: {A} Quadratic Programming Approach}, 32008 booktitle = {Serie VIII}, 32009 publisher = {Academia Nazionale dei Lincei}, 32010 year = {1981}, 32011 volume = {LXX}, 32012 pages = {203--209} 32013} 32014 32015@Article{ maier:matrix, 32016 author = {G. Maier}, 32017 title = {A matrix structural theory of piecewise linear elastoplasticity with interacting 32018 yield planes}, 32019 journal = {Meccanica}, 32020 volume = {5}, 32021 year = {1970}, 32022 pages = {54--66} 32023} 32024 32025@Article{ maier:quadratic, 32026 author = {G. Maier}, 32027 title = {A quadratic programming approach for certain classes of nonlinear structural 32028 problems}, 32029 journal = {Meccanica}, 32030 volume = {3}, 32031 year = {1968}, 32032 pages = {121--130} 32033} 32034 32035@Book{ manber:introduction, 32036 author = {U. Manber}, 32037 title = {Introduction to Algorithms: {A} Creative Approach}, 32038 year = {1989}, 32039 publisher = {Addison-Wesley} 32040} 32041 32042@Article{ mangasarian.deleone:error, 32043 author = {O. L. Mangasarian and R. {De~Leone}}, 32044 title = {Error Bounds for Strongly Convex Programs and (Super)linearly Convergent 32045 Iterative Schemes for the Least 2--norm Solution of Linear Programs}, 32046 journal = {Applied Mathematics and Optimization}, 32047 year = {1988}, 32048 volume = {17}, 32049 pages = {1--14} 32050} 32051 32052@Article{ mangasarian.deleone:parallel, 32053 author = {O. L. Mangasarian and R. {De~Leone}}, 32054 title = {Parallel Successive Overrelaxation Methods for Symmetric Linear Complementarity 32055 Problems and Linear Programs}, 32056 journal = {Journal of Optimization Theory and Applications}, 32057 year = {1987}, 32058 volume = {54}, 32059 pages = {437--446} 32060} 32061 32062@Article{ mangasarian.fromovitz:fritz, 32063 author = {O. L. Mangasarian and S. Fromovitz}, 32064 title = {The {F}ritz {J}ohn necessary optimality conditions in the presence of equality 32065 and inequality constraints}, 32066 journal = {Journal of Mathematical Analysis and its Applications}, 32067 year = {1967}, 32068 volume = {17}, 32069 pages = {37--47} 32070} 32071 32072@Article{ mangasarian.mclinden:simple, 32073 author = {O. L. Mangasarian and L. McLinden}, 32074 title = {Simple Bounds for Solutions of Monotone Complementarity Problems and Convex 32075 Programs}, 32076 journal = {Mathematical Programming}, 32077 year = {1985}, 32078 volume = {32}, 32079 pages = {32--40} 32080} 32081 32082@Article{ mangasarian.meyer:nonlinear, 32083 author = {O. L. Mangasarian and R. R. Meyer}, 32084 title = {Nonlinear Perturbation of Linear Programs}, 32085 journal = {SIAM Journal on Control and Optimization}, 32086 year = {1979}, 32087 volume = {17}, 32088 pages = {745--752} 32089} 32090 32091@TechReport{ mangasarian.musicant:active, 32092 author = {O. L. Mangasarian and David R. Musicant}, 32093 title = {Active Set Support Vector Machine Classification}, 32094 institution = {Data Mining Institute, Computer Sciences Department, University of Wisconsin}, 32095 year = {2000}, 32096 number = {00-04}, 32097 address = {Madison, Wisconsin} 32098} 32099 32100@TechReport{ mangasarian.musicant:lagrangian, 32101 author = {O. L. Mangasarian and D. R. Musicant}, 32102 title = {Lagrangian Support Vector Machines}, 32103 institution = {Data Mining Institute, Computer Sciences Department, University of Wisconsin}, 32104 year = {2000}, 32105 number = {00-06}, 32106 address = {Madison, Wisconsin} 32107} 32108 32109@TechReport{ mangasarian.musicant:robust, 32110 author = {O. L. Mangasarian and David R. Musicant}, 32111 title = {Robust Linear and Support Vector Regression}, 32112 institution = {Data Mining Institute, Computer Sciences Department, University of Wisconsin}, 32113 year = {1999}, 32114 number = {99-09}, 32115 address = {Madison, Wisconsin} 32116} 32117 32118@Article{ mangasarian.musicant:successive, 32119 author = {O. L. Mangasarian and David R. Musicant}, 32120 title = {Successive Overrelaxation for Support Vector Machines}, 32121 journal = {IEEE Transactions on Neural Networks}, 32122 volume = {10}, 32123 year = {1999}, 32124 pages = {1032-1037} 32125} 32126 32127@Article{ mangasarian.pang:exact, 32128 author = {O. L. Mangasarian and J. S. Pang}, 32129 title = {Exact Penalty Functions for Mathematical Programs with Linear Complementarity 32130 Constraints}, 32131 journal = {Optimization}, 32132 year = {1997}, 32133 volume = {42}, 32134 pages = {1--8} 32135} 32136 32137@Article{ mangasarian.pang:extended, 32138 author = {O. L. Mangasarian and J. S. Pang}, 32139 title = {The Extended Linear Complementarity Problem}, 32140 journal = {SIAM Journal on Matrix Analysis and Applications}, 32141 year = {1994}, 32142 volume = {16} 32143} 32144 32145@Article{ mangasarian.ren:error, 32146 author = {O. L. Mangasarian and J. Ren}, 32147 title = {New error bounds for the nonlinear complementarity problem}, 32148 year = {1994}, 32149 volume = {1}, 32150 pages = {49--56}, 32151 journal = {Communications on Applied Nonlinear Analysis} 32152} 32153 32154@Article{ mangasarian.ren:improved, 32155 author = {O. L. Mangasarian and J. Ren}, 32156 title = {New Improved Error Bounds for the Linear Complementarity Problem}, 32157 year = {1994}, 32158 volume = {66}, 32159 journal = {Mathematical Programming}, 32160 pages = {241--255} 32161} 32162 32163@InProceedings{ mangasarian.setiono.ea:pattern, 32164 crossref = {coleman.li:large-scale}, 32165 author = {O. L. Mangasarian and R. Setiono and W. H. Wolberg}, 32166 title = {Pattern Recognition via Linear Programming: Theory and Application to Medical 32167 Diagnosis}, 32168 pages = {22--31} 32169} 32170 32171@Article{ mangasarian.shiau:error, 32172 author = {O. L. Mangasarian and T.--H. Shiau}, 32173 title = {Error Bounds for Monotone Linear Complementarity Problems}, 32174 journal = {Mathematical Programming}, 32175 year = {1986}, 32176 volume = {36}, 32177 pages = {81--89} 32178} 32179 32180@Article{ mangasarian.shiau:lipschitz, 32181 author = {O. L. Mangasarian and T.--H. Shiau}, 32182 title = {{L}ipschitz Continuity of Solutions of Linear Inequalities, Programs and 32183 Complementarity Problems}, 32184 journal = {SIAM Journal on Control and Optimization}, 32185 year = {1987}, 32186 volume = {25}, 32187 pages = {583--595} 32188} 32189 32190@Article{ mangasarian.solodov:nonlinear, 32191 author = {O. L. Mangasarian and M. V. Solodov}, 32192 title = {Nonlinear Complementarity as Unconstrained and Constrained Minimization}, 32193 journal = {Mathematical Programming}, 32194 year = {1993}, 32195 volume = {62}, 32196 pages = {277--298} 32197} 32198 32199@Article{ mangasarian.solodov:serial, 32200 author = {O. L. Mangasarian and M. V. Solodov}, 32201 title = {Serial and Parallel Backpropagation Convergence via Nonmonotone Perturbed 32202 Minimization}, 32203 year = {1994}, 32204 journal = {Optimization Methods and Software}, 32205 volume = {4}, 32206 pages = {103--116} 32207} 32208 32209@Article{ mangasarian.street.ea:breast, 32210 author = {O. L. Mangasarian and W. N. Street and W. H. Wolberg}, 32211 title = {Breast Cancer Diagnosis and Prognosis via Linear Programming}, 32212 journal = {Operations Research}, 32213 year = {1995}, 32214 volume = {43}, 32215 pages = {570--577} 32216} 32217 32218@Article{ mangasarian.wolberg:cancer, 32219 author = {O. L. Mangasarian and W. H. Wolberg}, 32220 title = {Cancer Diagnosis via Linear Programming}, 32221 journal = {SIAM News}, 32222 year = {1990}, 32223 volume = {23}, 32224 pages = {1 \& 18} 32225} 32226 32227@InCollection{ mangasarian:applications, 32228 author = {O. L. Mangasarian}, 32229 title = {Some Applications of Penalty Functions in Mathematical Programming}, 32230 booktitle = {Optimization and Related Fields}, 32231 year = {1986}, 32232 editor = {R. Conti and E. De~Giorgi and F. Giannessi}, 32233 publisher = {Springer-Verlag}, 32234 address = {Heidelberg}, 32235 pages = {307--329}, 32236 note = {Lecture Notes in Mathematics 1190} 32237} 32238 32239@Article{ mangasarian:characterization, 32240 author = {O. L. Mangasarian}, 32241 title = {Characterization of linear complementarity problems as linear programs}, 32242 journal = {Mathematical Programming Study}, 32243 year = {1978}, 32244 volume = {7}, 32245 pages = {74--87} 32246} 32247 32248@InProceedings{ mangasarian:condition, 32249 author = {O. L. Mangasarian}, 32250 title = {A condition number for linear inequalities and linear programs}, 32251 booktitle = {Proceedings of 6. Symposium uber Operations Research, Augsburg, 7-9 September 32252 1981}, 32253 year = {1981}, 32254 editor = {G. Bamberg and O. Opitz}, 32255 publisher = {Verlagsgruppe Athenaum/Hain/Scriptor/Hanstein}, 32256 address = {Konigstein}, 32257 pages = {3--15} 32258} 32259 32260@Article{ mangasarian:convergence, 32261 author = {O. L. Mangasarian}, 32262 title = {On the Convergence of Iterates of an Inexact Matrix Splitting Algorithm for the 32263 Symmetric Monotone Linear Complementarity Problem}, 32264 journal = {SIAM Journal on Optimization}, 32265 volume = {1}, 32266 pages = {114--122}, 32267 year = {1991} 32268} 32269 32270@Article{ mangasarian:equivalence, 32271 author = {O. L. Mangasarian}, 32272 title = {Equivalence of the Complementarity Problem to a System of Nonlinear Equations}, 32273 journal = {SIAM Journal on Applied Mathematics}, 32274 year = {1976}, 32275 volume = {31}, 32276 pages = {89--92} 32277} 32278 32279@Article{ mangasarian:error, 32280 author = {O. L. Mangasarian}, 32281 title = {Error Bounds for Inconsistent Linear Inequalities and Programs}, 32282 journal = {ORSA Journal on Computing}, 32283 volume = {15}, 32284 pages = {187--192}, 32285 year = {1994} 32286} 32287 32288@Article{ mangasarian:error*1, 32289 author = {O. L. Mangasarian}, 32290 title = {Error Bounds for Nondegenerate Monotone Linear Complementarity Problems}, 32291 journal = {Mathematical Programming}, 32292 year = {1990}, 32293 volume = {48}, 32294 pages = {437--445} 32295} 32296 32297@Article{ mangasarian:generalized, 32298 author = {O. L. Mangasarian}, 32299 title = {Generalized Linear Complementarity Problems as Linear Programs}, 32300 journal = {Methods of Operations Research}, 32301 year = {1979}, 32302 editor = {W. Oettli and F. Steffens}, 32303 volume = {31}, 32304 pages = {393--402} 32305} 32306 32307@InCollection{ mangasarian:generalized*1, 32308 author = {O. L. Mangasarian}, 32309 title = {Generalized Support Vector Machines}, 32310 year = {2000}, 32311 pages = {135-146}, 32312 booktitle = {Advances in Large Margin Classifiers}, 32313 editor = {A. Smola and P.~Bartlett and B.~Sch{\"o}lkopf and D.~Schuurmans}, 32314 publisher = {MIT Press}, 32315 address = {Cambridge, MA} 32316} 32317 32318@Article{ mangasarian:global, 32319 author = {O. L. Mangasarian}, 32320 title = {Global error bounds for monotone affine variational inequality problems}, 32321 journal = {Linear Algebra and Its Applications}, 32322 year = {1992}, 32323 pages = {153--164} 32324} 32325 32326@InCollection{ mangasarian:least, 32327 author = {O. L. Mangasarian}, 32328 title = {Least Norm Solution of Non--Monotone Complementarity Problems}, 32329 booktitle = {Functional Analysis, Optimization and Mathematical Economics}, 32330 year = {1990}, 32331 publisher = {Oxford University Press}, 32332 address = {New York}, 32333 pages = {217--221} 32334} 32335 32336@Article{ mangasarian:least-norm, 32337 author = {O. L. Mangasarian}, 32338 title = {Least--Norm Linear Programming Solution as an Unconstrained Minimization 32339 Problem}, 32340 journal = {Journal of Mathematical Analysis and Applications}, 32341 year = {1983}, 32342 volume = {92}, 32343 pages = {240--251} 32344} 32345 32346@Article{ mangasarian:linear, 32347 author = {O. L. Mangasarian}, 32348 title = {Linear Complementarity Problems Solvable by a Single Linear Program}, 32349 journal = {Mathematical Programming}, 32350 year = {1976}, 32351 volume = {10}, 32352 pages = {263--270} 32353} 32354 32355@Article{ mangasarian:linear*1, 32356 author = {O. L. Mangasarian}, 32357 title = {Linear and Nonlinear Separation of Patterns by Linear Programming}, 32358 journal = {Operations Research}, 32359 year = {1965}, 32360 volume = {13}, 32361 pages = {444--452} 32362} 32363 32364@Article{ mangasarian:locally, 32365 author = {O. L. Mangasarian}, 32366 title = {Locally Unique Solutions of Quadratic Programs, Linear and Nonlinear 32367 Complementarity Problems}, 32368 journal = {Mathematical Programming}, 32369 year = {1980}, 32370 volume = {19}, 32371 pages = {200--212} 32372} 32373 32374@InCollection{ mangasarian:machine, 32375 author = {O. L. Mangasarian}, 32376 title = {Machine Learning via Polyhedral Concave Minimization}, 32377 editor = {H. Fischer and B. Riedmueller and S. Schaeffler}, 32378 booktitle = {Applied Mathematics and Parallel Computing - Festschrift for Klaus Ritter}, 32379 pages = {175-188}, 32380 year = {1996}, 32381 address = {Heidelberg}, 32382 publisher = {Physica-Verlag A Springer-Verlag Company} 32383} 32384 32385@Article{ mangasarian:mathematical, 32386 author = {O. L. Mangasarian}, 32387 title = {Mathematical Programming in Neural Networks}, 32388 journal = {ORSA Journal on Computing}, 32389 volume = {5}, 32390 pages = {349--360}, 32391 year = {1993} 32392} 32393 32394@InProceedings{ mangasarian:mathematical*1, 32395 author = {O. L. Mangasarian}, 32396 title = {Mathematical Programming in Machine Learning}, 32397 booktitle = {Nonlinear Optimization and Applications}, 32398 editor = {G. Di Pillo and F. Giannessi}, 32399 publisher = {Plenum Publishing}, 32400 address = {New York}, 32401 pages = {283--295}, 32402 year = {1996} 32403} 32404 32405@Article{ mangasarian:mathematical*2, 32406 author = {O. L. Mangasarian}, 32407 title = {Mathematical Programming in Data Mining}, 32408 journal = {Data Mining and Knowledge Discovery}, 32409 volume = {1}, 32410 year = {1997}, 32411 pages = {183-201} 32412} 32413 32414@Article{ mangasarian:multi-surface, 32415 author = {O. L. Mangasarian}, 32416 title = {Multi-surface Method of Pattern Separation}, 32417 journal = {IEEE Transactions on Information Theory}, 32418 year = {1968}, 32419 volume = {IT-14}, 32420 pages = {801--807} 32421} 32422 32423@Book{ mangasarian:nonlinear, 32424 author = {O. L. Mangasarian}, 32425 title = {Nonlinear Programming}, 32426 year = {1969}, 32427 publisher = {McGraw--Hill}, 32428 address = {New York}, 32429 note = {SIAM Classics in Applied Mathematics 10, SIAM, Philadelphia, 1994} 32430} 32431 32432@Article{ mangasarian:normal, 32433 author = {O. L. Mangasarian}, 32434 title = {Normal Solutions of Linear Programs}, 32435 journal = {Mathematical Programming Study}, 32436 year = {1984}, 32437 volume = {22}, 32438 pages = {206--216} 32439} 32440 32441@Article{ mangasarian:optimal, 32442 author = {O. L. Mangasarian}, 32443 title = {Optimal Simplex Tableau Characterization of Unique and Bounded Solutions of 32444 Linear Programs}, 32445 journal = {Journal of Optimization Theory and Applications}, 32446 year = {1981}, 32447 volume = {35}, 32448 pages = {123--128} 32449} 32450 32451@Article{ mangasarian:parallel, 32452 author = {O. L. Mangasarian}, 32453 title = {Parallel Gradient Distribution in Unconstrained Optimization}, 32454 journal = {SIAM Journal on Control and Optimization}, 32455 volume = {33}, 32456 pages = {1916--1925}, 32457 year = {1995} 32458} 32459 32460@TechReport{ mangasarian:regularized, 32461 author = {O. L. Mangasarian}, 32462 title = {Regularized Linear Programs with Equilibrium Constraints}, 32463 institution = {Computer Sciences Department, University of Wisconsin}, 32464 year = {1997}, 32465 address = {Madison, Wisconsin}, 32466 type = {Mathematical Programming Technical Report}, 32467 number = {97--13}, 32468 url = {ftp: //ftp.cs.wisc.edu/math-prog/tech-reports/97-13.ps} 32469} 32470 32471@Article{ mangasarian:simple, 32472 author = {O. L. Mangasarian}, 32473 title = {A Simple Characterization of Solution Sets of Convex Programs}, 32474 journal = {Operations Research Letters}, 32475 year = {1988}, 32476 volume = {7}, 32477 pages = {21--26} 32478} 32479 32480@Article{ mangasarian:solution, 32481 author = {O. L. Mangasarian}, 32482 title = {Solution of Symmetric Linear Complementarity Problems by Iterative Methods}, 32483 journal = {Journal of Optimization Theory and Applications}, 32484 year = {1977}, 32485 month = aug, 32486 volume = {22}, 32487 pages = {465--485} 32488} 32489 32490@Article{ mangasarian:stable, 32491 author = {O. L. Mangasarian}, 32492 title = {A Stable Theorem of the Alternative: An Extension of the {G}ordan Theorem}, 32493 journal = {Linear Algebra and Its Applications}, 32494 year = {1981}, 32495 volume = {41}, 32496 pages = {209--223} 32497} 32498 32499@Article{ mangasarian:sufficiency, 32500 author = {O. L. Mangasarian}, 32501 title = {Sufficiency of Exact Penalty Minimization}, 32502 journal = {SIAM Journal on Control and Optimization}, 32503 year = {1985}, 32504 month = jan, 32505 volume = {23}, 32506 pages = {30--37} 32507} 32508 32509@Article{ mangasarian:unconstrained, 32510 author = {O. L. Mangasarian}, 32511 title = {Unconstrained {L}agrangians in Nonlinear Programming}, 32512 journal = {SIAM Journal on Control and Optimization}, 32513 year = {1975}, 32514 volume = {13}, 32515 pages = {772--791} 32516} 32517 32518@Book{ manne.richels:buying, 32519 author = {A. S. Manne and R. G. Richels}, 32520 title = {Buying Greenhouse Insurance: The Economics of Carbon Dioxide Emission Limits}, 32521 publisher = {MIT Press}, 32522 year = {1992}, 32523 address = {Cambridge MA} 32524} 32525 32526@Article{ manne.richels:global, 32527 author = {A. S. Manne and R. G. Richels}, 32528 title = {Global {CO2} Emission Reductions - the Impacts of Rising Energy Costs}, 32529 journal = {The Energy Journal}, 32530 year = {1991}, 32531 volume = {12}, 32532 pages = {87--107} 32533} 32534 32535@Article{ manne.richels:international, 32536 author = {A. S. Manne and R. G. Richels}, 32537 title = {International Trade in Carbon Emission Rights: {A} Decomposition Procedure}, 32538 journal = {Economic Review}, 32539 year = {1991}, 32540 volume = {81}, 32541 pages = {135--139} 32542} 32543 32544@Article{ manne.rutherford:international, 32545 author = {A. S. Manne and T. F. Rutherford}, 32546 title = {International Trade in Oil, Gas and Carbon Emission Rights: An Intertemporal 32547 General Equilibrium Model}, 32548 journal = {The Energy Journal}, 32549 year = {1993}, 32550 volume = {14}, 32551 pages = {1--20} 32552} 32553 32554@InCollection{ manne:eta-macro, 32555 author = {A. S. Manne}, 32556 title = {{ETA}-{M}acro: {A} {M}odel of Energy-Economy Interactions}, 32557 booktitle = {Modeling Energy-Economy Interactions}, 32558 year = {1977}, 32559 editor = {C. J. Hitch}, 32560 publisher = {Resources for the Future}, 32561 address = {Washington DC} 32562} 32563 32564@PhDThesis{ maratos:exact, 32565 author = {N. Maratos}, 32566 title = {Exact Penalty Function Algorithms for Finite Dimensional and Control Optimization 32567 Problems}, 32568 year = {1978}, 32569 school = {Imperial College, University of London} 32570} 32571 32572@Article{ marcotte.dussault:note, 32573 author = {P. Marcotte and J.--P. Dussault}, 32574 title = {A Note on a Globally Convergent {N}ewton Method for Solving Monotone Variational 32575 Inequalities}, 32576 journal = {Operations Research Letters}, 32577 year = {1987}, 32578 volume = {6}, 32579 pages = {35--42} 32580} 32581 32582@Article{ marcotte.zhu:exact, 32583 author = {P. Marcotte and D. L. Zhu}, 32584 title = {Exact and Inexact Penalty Methods for the Generalized Bilevel Programming 32585 Problem}, 32586 journal = {Mathematical Programming}, 32587 year = {1996}, 32588 volume = {74}, 32589 pages = {141--158} 32590} 32591 32592@Article{ marcotte:algorithm, 32593 author = {P. Marcotte}, 32594 title = {A New Algorithm for Solving Variational Inequalities with Application to the 32595 Traffic Assignment Problem}, 32596 journal = {Mathematical Programming}, 32597 year = {1985}, 32598 volume = {33}, 32599 pages = {339--351} 32600} 32601 32602@Article{ marcotte:application, 32603 author = {P. Marcotte}, 32604 title = {Application of {K}hobotov's Algorithm to Variational Inequalities and Network 32605 Equilibrium Problems}, 32606 journal = {Information Systems and Operational Research}, 32607 year = {1991}, 32608 volume = {29}, 32609 pages = {258--270} 32610} 32611 32612@Article{ marcotte:network, 32613 author = {P. Marcotte}, 32614 title = {Network Design Problem with Congestion Effects: {A} Case of Bilevel Programming}, 32615 journal = {Mathematical Programming}, 32616 year = {1986}, 32617 volume = {34}, 32618 pages = {142--162} 32619} 32620 32621@Article{ markusen.rutherford.ea:el, 32622 author = {J. R. Markusen and T. F. Rutherford and L. Hunter}, 32623 title = {El libre comercio en {A}merica del {N}orte y la produccion de automoviles}, 32624 journal = {Cuadernos Economicos de Ice}, 32625 year = {1995}, 32626 volume = {59}, 32627 pages = {57--68} 32628} 32629 32630@Article{ markusen.rutherford.ea:trade, 32631 author = {J. R. Markusen and T. F. Rutherford and L. Hunter}, 32632 title = {Trade liberalization in a multinational-dominated industry}, 32633 journal = {Journal of International Economics}, 32634 year = {1995}, 32635 volume = {38}, 32636 pages = {95--118} 32637} 32638 32639@Article{ markusen.rutherford:discrete, 32640 author = {J. R. Markusen and T. F. Rutherford}, 32641 title = {Discrete plant-location decisions in an applied general equilibrium model of 32642 trade liberalization}, 32643 journal = {Weltwirtshchaftliches Archiv}, 32644 year = {1994} 32645} 32646 32647@Article{ markusen.wigle:nash, 32648 author = {J. Markusen and R. Wigle}, 32649 title = {Nash Equilibrium Tariffs for the {U}nited {S}tates and {C}anada: The Roles of 32650 Country Size, Scale Economies and Capital Mobility}, 32651 journal = {Journal of Political Mobility}, 32652 year = {1989}, 32653 volume = {97}, 32654 pages = {368--386} 32655} 32656 32657@Article{ marquardt:algorithm, 32658 author = {D. W. Marquardt}, 32659 title = {An Algorithm for Least--Squares Estimation of Nonlinear Parameters}, 32660 journal = {SIAM Journal on Applied Mathematics}, 32661 year = {1963}, 32662 volume = {11}, 32663 pages = {431--441} 32664} 32665 32666@Article{ martello.toth:algorithm, 32667 author = {S. Martello and P. Toth}, 32668 title = {A New Algorithm for the 0--1 Knapsack Problem}, 32669 journal = {Management Science}, 32670 year = {1988}, 32671 volume = {34}, 32672 pages = {633--644} 32673} 32674 32675@InCollection{ martello.toth:algorithms, 32676 author = {S. Martello and P. Toth}, 32677 title = {Algorithms for Knapsack Problems}, 32678 booktitle = {Surveys in Combinatorial Optimization}, 32679 year = {1987}, 32680 editor = {S. Martello and G. Laporte and M. Minoux and C. Ribeiro}, 32681 publisher = {Annals of Discrete Mathematics 31, North--Holland}, 32682 address = {Amsterdam} 32683} 32684 32685@Article{ martello.toth:mixture, 32686 author = {S. Martello and P. Toth}, 32687 title = {A Mixture of Dynamic Programming and Branch--and--Bound for the Subset--Sum 32688 Problem}, 32689 journal = {Management Science}, 32690 year = {1984}, 32691 volume = {30}, 32692 pages = {765--771} 32693} 32694 32695@Article{ martello.toth:worst-case, 32696 author = {S. Martello and P. Toth}, 32697 title = {Worst--Case Analysis of Greedy Algorithms for the Subset Sum Problem}, 32698 journal = {Mathematical Programming}, 32699 year = {1984}, 32700 volume = {28}, 32701 pages = {198--205} 32702} 32703 32704@Article{ martinet:regularisation, 32705 author = {Bernard Martinet}, 32706 title = {Regularisation d'Inequations Variationelles par Approximations Successives}, 32707 journal = {Revue Fran\c{c}aise d'Informatique et Recherche Operationelle}, 32708 year = {1970}, 32709 volume = {4}, 32710 pages = {154--159} 32711} 32712 32713@Article{ maskin.tirole:theory, 32714 author = {E. Maskin and J. Tirole}, 32715 title = {A theory of Dynamic Oligopoly, {I}: Overview and quantity competition with large 32716 fixed costs}, 32717 journal = {Econometrica}, 32718 volume = {56}, 32719 year = {1988}, 32720 pages = {549--569} 32721} 32722 32723@Article{ maskin.tirole:theory*1, 32724 author = {E. Maskin and J. Tirole}, 32725 title = {A theory of Dynamic Oligopoly, {II}: Price competition, Kinked demand curves, and 32726 Edgeworth cycles}, 32727 journal = {Econometrica}, 32728 volume = {56}, 32729 year = {1988}, 32730 pages = {571--579} 32731} 32732 32733@Article{ maskus.rutherford.ea:economic, 32734 author = {K. Maskus and T. F. Rutherford and S. Selby}, 32735 title = {Economic Implications of Changes in Labor Standards: a Computational Analysis for 32736 {M}exico}, 32737 journal = {North American Journal of Economics and Finance}, 32738 year = {1996} 32739} 32740 32741@Article{ mastor:experimental, 32742 author = {A. A. Mastor}, 32743 title = {An Experimental Investigation and Comparative Evaluation of Production Line 32744 Balancing Techniques}, 32745 journal = {Management Science}, 32746 year = {1970}, 32747 volume = {16}, 32748 pages = {728--746} 32749} 32750 32751@Article{ mathias.pang:error, 32752 author = {R. Mathias and J. S. Pang}, 32753 title = {Error bounds for the linear complementarity problem with a {P}-matrix}, 32754 journal = {Linear Algebra and Its Applications}, 32755 year = {1990}, 32756 volume = {132}, 32757 pages = {123--136} 32758} 32759 32760@Article{ mathiesen:algorithm, 32761 author = {L. Mathiesen}, 32762 title = {An Algorithm based on a Sequence of Linear Complementarity Problems applied to a 32763 {W}alrasian Equilibrium Model: An Example}, 32764 journal = {Mathematical Programming}, 32765 year = {1987}, 32766 volume = {37}, 32767 pages = {1--18} 32768} 32769 32770@Article{ mathiesen:computation, 32771 author = {L. Mathiesen}, 32772 title = {Computation of Economic Equilibria by a Sequence of Linear Complementarity 32773 Problems}, 32774 journal = {Mathematical Programming Study}, 32775 year = {1985}, 32776 volume = {23}, 32777 pages = {144--162} 32778} 32779 32780@Article{ mathiesen:computational, 32781 author = {L. Mathiesen}, 32782 title = {Computational Experience in Solving Equilibrium Models by a Sequence of Linear 32783 Complementarity Problems}, 32784 journal = {Operations Research}, 32785 year = {1985}, 32786 volume = {33}, 32787 pages = {1225--1250} 32788} 32789 32790@Book{ matlab:users, 32791 author = {{MATLAB}}, 32792 title = {User's Guide}, 32793 year = {1992}, 32794 publisher = {The MathWorks, Inc.} 32795} 32796 32797@Book{ mcclelland.rummelhart:explorations, 32798 author = {J. L. McClelland and D. E. Rummelhart}, 32799 title = {Explorations in Parallel Distributed Processing: {A} Handbook of Models, 32800 Programs, and Exercises}, 32801 year = {1987}, 32802 publisher = {MIT Press}, 32803 address = {Cambridge, Massachusetts} 32804} 32805 32806@Article{ mccormick:modification, 32807 author = {G. P. McCormick}, 32808 title = {A Modification of {A}rmijo's Step--Size Rule for Negative Curvature}, 32809 journal = {Mathematical Programming}, 32810 year = {1977}, 32811 volume = {13}, 32812 pages = {111--115} 32813} 32814 32815@Book{ mccormick:nonlinear, 32816 author = {G. P. McCormick}, 32817 title = {Nonlinear Programming: Theory, Algorithms and Applications}, 32818 year = {1983}, 32819 publisher = {John Wiley \& Sons}, 32820 address = {New York} 32821} 32822 32823@Article{ mcculloch.pitts:logical, 32824 author = {W. McCulloch and W. Pitts}, 32825 title = {A Logical Calculus of the Ideas Immanent in Nervous Activity}, 32826 journal = {Bulletin of Mathematical Biophysics}, 32827 year = {1943}, 32828 volume = {7}, 32829 pages = {115--133} 32830} 32831 32832@TechReport{ mckenna.zenios:optimal, 32833 author = {M. McKenna and S. A. Zenios}, 32834 title = {An Optimal Parallel Implementation of a Quadratic Transportation Algorithm}, 32835 institution = {Thinking Machines Corporation}, 32836 year = {1990}, 32837 type = {Working Paper}, 32838 address = {Cambridge, MA} 32839} 32840 32841@Article{ mckinnon:convergence, 32842 author = {K. I. M. McKinnon}, 32843 title = {Convergence of the {N}elder-{M}ead Simplex Method to a Nonstationary Point}, 32844 journal = {SIAM Journal on Optimization}, 32845 year = {1998}, 32846 volume = {9}, 32847 pages = {148--158} 32848} 32849 32850@Article{ mcshane.monma.ea:implementation, 32851 author = {K. A. McShane and C. L. Monma and D. F. Shanno}, 32852 title = {An implementation of a primal-dual interior point method for linear programming}, 32853 journal = {ORSA Journal of Computing}, 32854 year = {1989}, 32855 volume = {1}, 32856 pages = {70--83} 32857} 32858 32859@PhDThesis{ medhi:decomposition, 32860 author = {D. Medhi}, 32861 title = {Decomposition of Structured Large--Scale Optimization Problems and Parallel 32862 Optimization}, 32863 school = {Computer Sciences Department, University of Wisconsin}, 32864 year = {1987}, 32865 address = {Madison, Wisconsin}, 32866 note = {Technical Report 718} 32867} 32868 32869@Article{ medhi:parallel, 32870 author = {D. Medhi}, 32871 title = {Parallel Bundle-Based Decomposition for Large-Scale Structured Mathematical 32872 Programming Problems}, 32873 journal = {Annals of Operations Research}, 32874 year = {1990}, 32875 volume = {22}, 32876 pages = {101--127} 32877} 32878 32879@Article{ megiddo:complexity, 32880 author = {N. Megiddo}, 32881 title = {On the complexity of polyhedral separability}, 32882 journal = {Discrete and Computational Geometry}, 32883 year = {1988}, 32884 volume = {3}, 32885 pages = {325--337} 32886} 32887 32888@Article{ megiddo:finding, 32889 author = {N. Megiddo}, 32890 title = {On Finding Primal-- and Dual--Optimal Bases}, 32891 journal = {ORSA Journal on Computing}, 32892 year = {1991}, 32893 volume = {3}, 32894 pages = {63--65} 32895} 32896 32897@Article{ mehrotra:implementation, 32898 author = {S. Mehrotra}, 32899 title = {On the implementation of a primal-dual interior point method}, 32900 journal = {SIAM Journal on Optimization}, 32901 year = {1992}, 32902 volume = {2}, 32903 pages = {575--601} 32904} 32905 32906@PhDThesis{ merrill:applications, 32907 author = {O. H. Merrill}, 32908 title = {Application and Extensions of an Algorithm that Computes Fixed Points of Upper 32909 Semicontinuous Point to Set Mappings}, 32910 year = {1972}, 32911 school = {University of Michigan} 32912} 32913 32914@Article{ merten.muller:variance, 32915 author = {A. G. Merten and M. E. Muller}, 32916 title = {Variance Minimization in Single Machine Sequencing Problems}, 32917 journal = {Management Science}, 32918 year = {1972}, 32919 volume = {18}, 32920 pages = {518--528} 32921} 32922 32923@TechReport{ meyer:continuity, 32924 author = {R. R. Meyer}, 32925 title = {Continuity Properties of Linear Programs}, 32926 institution = {Computer Sciences Department, University of Wisconsin}, 32927 year = {1979}, 32928 address = {Madison, Wisconsin}, 32929 number = {373} 32930} 32931 32932@Article{ miersemann.mittelmann:continuation, 32933 author = {E. Miersemann and H. D. Mittelmann}, 32934 title = {Continuation for Parametrized Nonlinear Variational Inequalities}, 32935 journal = {Journal of Computational and Applied Mathematics}, 32936 year = {1989}, 32937 volume = {26}, 32938 pages = {23--34} 32939} 32940 32941@Article{ mifflin:semismooth, 32942 author = {R. Mifflin}, 32943 title = {Semismooth and semiconvex functions in constrained optimization}, 32944 journal = {SIAM Journal on Control and Optimization}, 32945 year = {1977}, 32946 volume = {15}, 32947 pages = {957--972} 32948} 32949 32950@Article{ mifflin:stable, 32951 author = {R. Mifflin}, 32952 title = {A Stable Method for Solving Certain Constrained Least Squares Problems}, 32953 journal = {Mathematical Programming}, 32954 vol = {16}, 32955 pages = {141--158}, 32956 year = {1979} 32957} 32958 32959@Book{ miller:survival, 32960 author = {Jr. R. G. Miller}, 32961 title = {Survival Analysis}, 32962 year = {1981}, 32963 publisher = {John Wiley \& Sons}, 32964 address = {New York} 32965} 32966 32967@Book{ minsky.papert:perceptrons, 32968 author = {M. Minsky and S. Papert}, 32969 title = {Perceptrons: An Introduction to Computational Geometry}, 32970 year = {1969}, 32971 publisher = {MIT Press}, 32972 address = {Cambridge, Massachusetts} 32973} 32974 32975@Article{ minty:monotone, 32976 author = {G. J. Minty}, 32977 title = {Monotone (Nonlinear) Operators in {H}ilbert Space}, 32978 journal = {Duke Mathematics Journal}, 32979 year = {1962}, 32980 volume = {29}, 32981 pages = {341--346} 32982} 32983 32984@Article{ minty:monotonicity, 32985 author = {G. J. Minty}, 32986 title = {On the Monotonicity of the Gradient of a Convex Function}, 32987 journal = {Pacific Journal of Mathematics}, 32988 year = {1964}, 32989 volume = {14}, 32990 pages = {243--247} 32991} 32992 32993@TechReport{ mizuno.jarre.ea:unified, 32994 author = {S. Mizuno and F. Jarre and J. Stoer}, 32995 title = {A Unified approach to infeasible--interior--point algorithms via geometrical 32996 linear complementarity problems}, 32997 institution = {Mathematische Institut der Universit{\"{a}}t W{\"{u}}rzburg}, 32998 address = {W{\"{u}}rzburg, Germany}, 32999 year = {1994}, 33000 number = {Nr. 213}, 33001 type = {Preprint} 33002} 33003 33004@TechReport{ mizuno:polynomiality, 33005 author = {S. Mizuno}, 33006 title = {Polynomiality of {K}ojima-{M}egiddo-{M}izuno infeasible-interior-point algorithm 33007 for linear programming}, 33008 institution = {School of Operations Research and Industrial Engineering, Cornell University}, 33009 year = {1993}, 33010 number = {1006}, 33011 address = {Ithaca, New York}, 33012 month = jan 33013} 33014 33015@Article{ mohan.mageras.ea:clinically, 33016 author = {R. Mohan and G. S. Mageras and B. Baldwin and L. J. Brewster and G. J. Kutcher 33017 and S. Leibel and C. M. Burman and C. C. Ling and Z. Fuks}, 33018 title = {Clinically Relevant Optimization of 3-{D} Conformal Treatments}, 33019 journal = {Medical Physics}, 33020 year = {1992}, 33021 volume = {19}, 33022 number = {4}, 33023 pages = {933--944} 33024} 33025 33026@Article{ mohan:field, 33027 author = {R. Mohan}, 33028 title = {Field Shaping for Three-Dimensional Conformal Radiation Therapy and Multileaf 33029 Collimation}, 33030 journal = {Seminars in Radiation Oncology}, 33031 year = {1995}, 33032 volume = {5}, 33033 number = {2}, 33034 pages = {86--99} 33035} 33036 33037@Article{ monteiro.pang.ea:positive, 33038 author = {R. D. C. Monteiro and J. S. Pang and T. Wang}, 33039 title = {A Positive Algorithm for the Nonlinear Complementarity Problem}, 33040 journal = {SIAM Journal on Optimization}, 33041 year = {1995}, 33042 volume = {5}, 33043 pages = {129--148} 33044} 33045 33046@Article{ monteiro.tsuchiya:limiting, 33047 author = {R. D. C. Monteiro and T. Tsuchiya}, 33048 title = {Limiting Behavior of the Derivatives of Certain Trajectories Associated with a 33049 Monotone Horizontal Linear Complementarity Problem}, 33050 year = {1996}, 33051 journal = {Mathematics of Operations Research}, 33052 pages = {793--814}, 33053 volume = {21} 33054} 33055 33056@Article{ monteiro.wright:local, 33057 author = {R. D. C. Monteiro and S. J. Wright}, 33058 title = {Local Convergence of Interior--Point Algorithms for Degenerate {LCP}}, 33059 journal = {Computational Optimization and Applications}, 33060 year = {1994}, 33061 volume = {3}, 33062 pages = {131--155} 33063} 33064 33065@Article{ monteiro.wright:superlinear, 33066 author = {R. D. C. Monteiro and S. J. Wright}, 33067 title = {A Superlinear Infeasible-Interior-Point Affine Scaling Algorithm for {LCP}}, 33068 year = {1996}, 33069 journal = {SIAM Journal on Optimization}, 33070 volume = {6}, 33071 pages = {1--18} 33072} 33073 33074@Article{ monteiro.wright:superlinear*1, 33075 author = {R. D. C. Monteiro and S. J. Wright}, 33076 title = {Superlinear Primal-Dual Affine Scaling Algorithms for {LCP}}, 33077 journal = {Mathematical Programming}, 33078 year = {1995}, 33079 volume = {69}, 33080 pages = {311--333} 33081} 33082 33083@Article{ more.garbow.ea:testing, 33084 author = {J. J. Mor\'{e} and B. S. Garbow and K. E. Hillstrom}, 33085 title = {Testing Unconstrained Optimization Software}, 33086 journal = {ACM Transactions on Mathematical Software}, 33087 year = {1981}, 33088 volume = {7}, 33089 pages = {17--41} 33090} 33091 33092@Article{ more.rheinboldt:p, 33093 author = {J. J. Mor\'{e} and W. C. Rheinboldt}, 33094 title = {On {P}-- and {S}--functions and Related Classes of {N}--Dimensional Nonlinear 33095 Mappings}, 33096 journal = {Linear Algebra and Its Applications}, 33097 year = {1973}, 33098 volume = {6}, 33099 pages = {45--68} 33100} 33101 33102@Article{ more.sorensen:use, 33103 author = {J. J. Mor\'{e} and D. C. Sorensen}, 33104 title = {On the use of Directions of Negative Curvature in a Modified {N}ewton Method}, 33105 journal = {Mathematical Programming}, 33106 year = {1979}, 33107 volume = {16}, 33108 pages = {1--20} 33109} 33110 33111@Article{ more.sorensen:computing, 33112 author = {J. J. Mor\'{e} and D. C. Sorensen}, 33113 title = {Computing a Trust Region Step}, 33114 journal = {SIAM Journal on Scientific and Statistical Computing}, 33115 year = {1983}, 33116 volume = {4}, 33117 pages = {553--572} 33118} 33119 33120@Article{ more.toraldo:solution, 33121 author = {J. J. Mor\'e and G. Toraldo}, 33122 title = {On the Solution of Large Quadratic Programming Problems with Bound Constraints}, 33123 journal = {SIAM Journal on Optimization}, 33124 year = {1991}, 33125 volume = {1}, 33126 pages = {93--113} 33127} 33128 33129@TechReport{ more.vavasis:solution, 33130 author = {J. J. Mor\'{e} and S. A. Vavasis}, 33131 title = {On the Solution of Concave Knapsack Problems}, 33132 institution = {Argonne National Laboratory}, 33133 year = {1988}, 33134 address = {Argonne, Illinois}, 33135 number = {ANL/MCS--P40--1288}, 33136 type = {Mathematics and Computer Science Division Report} 33137} 33138 33139@Book{ more.wright:optimization, 33140 author = {J. J. Mor\'{e} and S. J. Wright}, 33141 title = {Optimization Software Guide}, 33142 publisher = {SIAM}, 33143 address = {Philadelphia, Pennsylvania}, 33144 series = {Frontiers in Applied Mathematics}, 33145 number = {14}, 33146 year = {1993} 33147} 33148 33149@TechReport{ more.wu:global, 33150 author = {J. J. Mor\'{e} and Z. Wu}, 33151 title = {Global Continuation for Distance Geometry Problems}, 33152 institution = {Argonne National Laboratory}, 33153 year = {1995}, 33154 type = {Preprint}, 33155 number = {MCS-P505-0395}, 33156 address = {Argonne, Illinois} 33157} 33158 33159@TechReport{ more.wu:issues, 33160 author = {J. J. Mor\'{e} and Z. Wu}, 33161 title = {Issues in Large-Scale Global Molecular Optimization}, 33162 institution = {Argonne National Laboratory}, 33163 year = {1995}, 33164 type = {Preprint}, 33165 number = {MCS-P539-1095}, 33166 address = {Argonne, Illinois} 33167} 33168 33169@TechReport{ more:collection, 33170 author = {J. J. Mor\'e}, 33171 title = {A Collection of Nonlinear Model Problems}, 33172 institution = {Argonne National Laboratory}, 33173 year = {1989}, 33174 type = {Preprint}, 33175 address = {Argonne, Illinois}, 33176 number = {MCS-P60-0289} 33177} 33178 33179@Article{ more:global, 33180 author = {J. J. Mor\'e}, 33181 title = {Global Methods for Nonlinear Complementarity Problems}, 33182 year = {1996}, 33183 journal = {Mathematics of Operations Research}, 33184 pages = {589--614}, 33185 volume = {21} 33186} 33187 33188@Article{ moreau:proximite, 33189 author = {J.--J. Moreau}, 33190 title = {Proximit\'{e} et Dualit\'{e} dans un Espace {H}ilbertien}, 33191 journal = {Bulletin de la Soci\'{e}t\'{e} Math\'{e}matique de France}, 33192 year = {1965}, 33193 volume = {93}, 33194 pages = {273--299} 33195} 33196 33197@Article{ morrill.lane.ea:dose-volume, 33198 author = {S. Morrill and R. Lane and J. Wong and I. Rosen}, 33199 title = {Dose-volume considerations with linear programming}, 33200 journal = {Medical Physics}, 33201 year = {1991}, 33202 volume = {18}, 33203 number = {6}, 33204 pages = {1201--1210} 33205} 33206 33207@Article{ morrill:very, 33208 author = {S. M. Morrill and K. S. Lam and R. G. Lane and M. Langer and I. I. Rosen}, 33209 title = {Very Fast Simulated Annealing in Radiation Therapy Treatment Plan Optimization}, 33210 journal = {International Journal of Radiation Oncology, Biology and Physics}, 33211 year = {1995}, 33212 volume = {31}, 33213 pages = {179--188} 33214} 33215 33216@TechReport{ morshedi.tapia:karmarkar, 33217 author = {A. M. Morshedi and R. A. Tapia}, 33218 title = {Karmarkar as a Classical Method}, 33219 institution = {Department of Mathematical Sciences, Rice University}, 33220 year = {1987}, 33221 number = {87--7}, 33222 type = {Technical Report} 33223} 33224 33225@Article{ mosco:dual, 33226 author = {U. Mosco}, 33227 title = {Dual Variational Inequalities}, 33228 journal = {Journal of Mathematical Analysis and its Applications}, 33229 year = {1972}, 33230 volume = {40}, 33231 pages = {202--206} 33232} 33233 33234@Article{ motzkin.schoenberg:relaxation, 33235 author = {T. S. Motzkin and I. J. Schoenberg}, 33236 title = {The relaxation method for linear inequalities}, 33237 journal = {Canadian Journal of Mathematics}, 33238 year = {1954}, 33239 volume = {6}, 33240 pages = {393--404} 33241} 33242 33243@InProceedings{ muhlenbein:parallel, 33244 crossref = {schaeffer:third}, 33245 author = {H. M{\"{}u}hlenbein}, 33246 title = {Parallel Genetic Algorithms, Population Genetics and Combinatorial Optimization}, 33247 pages = {416--421} 33248} 33249 33250@Article{ mukhopadhyay.roy.ea:polynomial, 33251 author = {S. Mukhopadhyay and A. Roy and S. Govil}, 33252 title = {A polynomial time algorithm for generating neural networks for pattern 33253 classification: Its stability properties and some test results}, 33254 journal = {Neural Computation}, 33255 year = {1993}, 33256 volume = {5}, 33257 pages = {317--330} 33258} 33259 33260@Article{ mulvey.ruszczynski:diagonal, 33261 author = {J. M. Mulvey and A. Ruszczynski}, 33262 title = {A Diagonal Quadratic Approximation Methods for Large Scale Linear Programs}, 33263 journal = {Operations Research Letters}, 33264 year = {1992}, 33265 volume = {12}, 33266 pages = {205--215} 33267} 33268 33269@TechReport{ mulvey.ruszczynski:scenario, 33270 author = {J. M. Mulvey and A. Ruszczynski}, 33271 title = {A New Scenario Decomposition Method for Large--Scale Stochastic Optimization}, 33272 institution = {Department of Civil Engineering and Operations Research, Princeton University}, 33273 year = {1991}, 33274 address = {Princeton, New Jersey}, 33275 number = {SOR 91-19}, 33276 type = {Technical Report} 33277} 33278 33279@PhDThesis{ munson:algorithms, 33280 author = {T. S. Munson}, 33281 title = {Algorithms and Environments for Complementarity}, 33282 school = {University of Wisconsin--Madison}, 33283 year = {2000}, 33284 address = {Madison, Wisconsin}, 33285 month = aug, 33286 url = {ftp: //ftp.cs.wisc.edu/math-prog/tech-reports/00-02.ps} 33287} 33288 33289@Article{ munson.facchinei.ea:semismooth, 33290 author = {T. S. Munson and F. Facchinei and M. C. Ferris and A. Fischer and C. Kanzow}, 33291 title = {The Semismooth Algorithm for Large Scale Complementarity Problems}, 33292 journal = {INFORMS Journal on Computing}, 33293 year = {2001}, 33294 volume = {forthcoming} 33295} 33296 33297@Article{ murchland:braess, 33298 author = {J. D. Murchland}, 33299 title = {Braess' Paradox of Traffic Flow}, 33300 journal = {Transportation Research}, 33301 year = {1970}, 33302 volume = {4}, 33303 pages = {391--394} 33304} 33305 33306@Unpublished{ murphy.aha:uci, 33307 author = {P. M. Murphy and D. W. Aha}, 33308 title = {{UCI} Repository of Machine Learning Databases}, 33309 year = {1992}, 33310 note = {Department of Information and Computer Science, University of California, Irvine, 33311 California, http://www.ics.uci.edu/AI/ML/MLDBRepository.html} 33312} 33313 33314@Book{ murphy.lawrence.ea:american, 33315 editor = {G. P. Murphy and W. L. Lawrence and R. E. Lenhard}, 33316 title = {American Cancer Society Textbook of Clinical Oncology}, 33317 publisher = {The American Cancer Society, Inc.}, 33318 address = {Atlanta, Georgia}, 33319 year = {1995} 33320} 33321 33322@Article{ murphy.sherali.ea:mathematical, 33323 author = {Frederic H. Murphy and Hanif D. Sherali and Allen L. Soyster}, 33324 title = {A Mathematical Programming Approach for Determining Oligopolistic Market 33325 Equilibrium}, 33326 journal = {Mathematical Programming}, 33327 year = {1982}, 33328 volume = {24}, 33329 pages = {92--106} 33330} 33331 33332@TechReport{ murtagh.saunders:minos, 33333 author = {B. A. Murtagh and M. A. Saunders}, 33334 title = {{MINOS} 5.0 User's Guide}, 33335 institution = {Stanford University}, 33336 address = {Stanford, California}, 33337 year = {1983}, 33338 number = {{SOL} 83.20}, 33339 type = {Technical Report} 33340} 33341 33342@InProceedings{ murthy.kasif.ea:oc1, 33343 author = {S. Murthy and S. Kasif and S. Salzberg and R. Beigel}, 33344 title = {{OC1}: Randomized Induction of Oblique Decision Trees}, 33345 booktitle = {Proceedings of the Eleventh National Conference on Artificial Intelligence}, 33346 year = {1993}, 33347 publisher = {The AAAI Press/The MIT Press}, 33348 address = {Cambridge, MA 02142}, 33349 pages = {322--327} 33350} 33351 33352@Book{ murty:linear, 33353 author = {K. G. Murty}, 33354 title = {Linear Complementarity, Linear and Nonlinear Programming}, 33355 year = {1988}, 33356 publisher = {Helderman-Verlag}, 33357 address = {Berlin} 33358} 33359 33360@Book{ murty:linear*1, 33361 author = {K. G. Murty}, 33362 title = {Linear Programming}, 33363 year = {1983}, 33364 publisher = {John Wiley \& Sons}, 33365 address = {New York} 33366} 33367 33368@Article{ murty:number, 33369 author = {K. G. Murty}, 33370 title = {On the number of solutions of the complementarity problem and spanning properties 33371 of cones}, 33372 journal = {Linear Algebra and Its Applications}, 33373 year = {1972}, 33374 volume = {5}, 33375 pages = {65--108} 33376} 33377 33378@Book{ murty:linear*2, 33379 author = {K. G. Murty}, 33380 title = {Linear and Combinatorial Programming}, 33381 year = {1976}, 33382 publisher = {John Wiley \& Sons}, 33383 address = {New York} 33384} 33385 33386@Book{ nagurney:network, 33387 author = {A. Nagurney}, 33388 title = {Network Economics -- {A} Variational Inequality Approach}, 33389 publisher = {Kluwer Academic Publishers}, 33390 year = {1993}, 33391 address = {Dordrecht, The Netherlands} 33392} 33393 33394@Article{ nash.nocedal:numerical, 33395 author = {S. G. Nash and J. Nocedal}, 33396 title = {A Numerical Study of the Limited Memory {BFGS} Method and the Truncated-{N}ewton 33397 Method for Large Scale Optimization}, 33398 journal = {SIAM Journal on Optimization}, 33399 year = {1991}, 33400 volume = {3}, 33401 pages = {358--372} 33402} 33403 33404@Article{ nash:equilibrium, 33405 author = {J. F. Nash}, 33406 title = {Equilibrium Points in {N}--Person Games}, 33407 journal = {Proceedings of the National Academy of Sciences}, 33408 year = {1950}, 33409 volume = {36}, 33410 pages = {48--49} 33411} 33412 33413@Article{ nash:non-cooperative, 33414 author = {J. F. Nash}, 33415 title = {Non-cooperative games}, 33416 journal = {Annals of Mathematics}, 33417 year = {1951}, 33418 volume = {54}, 33419 pages = {286--295} 33420} 33421 33422@Article{ nash:newton-type, 33423 author = {S. G. Nash}, 33424 title = {{N}ewton--Type Minimization via {L}anczos Method}, 33425 journal = {SIAM Journal on Numerical Analysis}, 33426 year = {1984}, 33427 volume = {21}, 33428 pages = {770--788} 33429} 33430 33431@Article{ nauss:efficient, 33432 author = {R. M. Nauss}, 33433 title = {An Efficient Algorithm for the 0--1 Knapsack Problem}, 33434 journal = {Management Science}, 33435 year = {1976}, 33436 volume = {23}, 33437 pages = {27--31} 33438} 33439 33440@Book{ nazareth:computer, 33441 author = {J. L. Nazareth}, 33442 title = {Computer Solution of Linear Programs}, 33443 year = {1987}, 33444 publisher = {Oxford University Press}, 33445 address = {Oxford} 33446} 33447 33448@Article{ nelder.mead:simplex, 33449 title = {A Simplex Method for Function Minimization}, 33450 author = {J. A. Nelder and R. Mead}, 33451 journal = {Computer Journal}, 33452 volume = {7}, 33453 pages = {308--313}, 33454 year = {1965} 33455} 33456 33457@Article{ nemhauser.savelsbergh.ea:minto, 33458 author = {G. L. Nemhauser and M. W. P. Savelsbergh and G. S. Sigismondi}, 33459 title = {{MINTO}, {A} Mixed Integer Optimizer}, 33460 journal = {Operations Research Letters}, 33461 year = {1994}, 33462 optkey = {}, 33463 optvolume = {15}, 33464 optnumber = {}, 33465 optpages = {47--58}, 33466 optmonth = {}, 33467 optnote = {}, 33468 optannote = {} 33469} 33470 33471@Book{ nemhauser.wolsey:integer, 33472 author = {G. L. Nemhauser and L. A. Wolsey}, 33473 title = {Integer and Combinatorial Optimization}, 33474 publisher = {John Wiley \& Sons}, 33475 year = {1988}, 33476 address = {New York, NY} 33477} 33478 33479@Article{ nestor.pasurka:alternative, 33480 author = {D. Vaughn Nestor and C. Pasurka}, 33481 title = {Alternative Specifications for Environmental Control Costs in a General 33482 Equilibrium Framework}, 33483 journal = {Economics Letters}, 33484 year = {1995}, 33485 volume = {48}, 33486 pages = {273--280} 33487} 33488 33489@Article{ nestor.pasurka:cge, 33490 author = {D. Vaughn Nestor and C. Pasurka}, 33491 title = {{CGE} Model of Pollution Abatement Processes for Assessing the Economic Effects 33492 of Environmental Policy}, 33493 journal = {Economic Modelling}, 33494 year = {1995}, 33495 volume = {12}, 33496 pages = {53--59} 33497} 33498 33499@Article{ newman.shapiro:theorems, 33500 author = {D. J. Newman and H. S. Shapiro}, 33501 title = {Some Theorems on \v{C}eby\v{s}ev Approximation}, 33502 journal = {Duke Mathematical Journal}, 33503 year = {1963}, 33504 volume = {30}, 33505 pages = {673--682} 33506} 33507 33508@Article{ ng.peyton:block, 33509 author = {E. Ng and B. Peyton}, 33510 title = {Block Sparse Cholesky Algorithms on Advanced Uniprocessor Computers}, 33511 journal = {SIAM Journal on Scientific and Statistical Computing}, 33512 year = {1993}, 33513 volume = {14}, 33514 pages = {1034--1056} 33515} 33516 33517@TechReport{ nielsen.zenios:solving, 33518 author = {S. S. Nielsen and S. A. Zenios}, 33519 title = {Solving Linear Stochastic Network Programs using Massively Parallel Proximal 33520 Algorithms}, 33521 institution = {Decision Sciences Department, The Wharton School, University of Pennsylvania}, 33522 year = {1992}, 33523 address = {Philadelphia}, 33524 number = {92-01-05} 33525} 33526 33527@Article{ niemierko:optimization, 33528 author = {A. Niemierko}, 33529 title = {Optimization of 3{D} Radiation Therapy With Both Physical and Biological End 33530 Points and Constraints}, 33531 journal = {International Journal of Radiation Oncology, Biology and Physics}, 33532 year = {1992}, 33533 volume = {23}, 33534 pages = {99--108} 33535} 33536 33537@InCollection{ niemierko:treatment, 33538 author = {A. Niemierko}, 33539 title = {Treatment Plan Optimization}, 33540 booktitle = {3-D Radiation Treatment Planning and Conformal Therapy}, 33541 editor = {J. A. Purdy and B. Emami}, 33542 publisher = {Medical Physics Publishing}, 33543 year = {1993}, 33544 pages = {49--55}, 33545 address = {St. Louis, Missouri} 33546} 33547 33548@Article{ niemireko:optimization, 33549 author = {A. Niemierko}, 33550 title = {Optimization of intensity modulated beams: Local or global optimum?}, 33551 journal = {Medical Physics}, 33552 year = {1996}, 33553 optvolume = {23}, 33554 optpages = {1072} 33555} 33556 33557@Manual{ nih:radiation, 33558 title = {Radiation Therapy and You - {A} Guide to Self-Help During Treatment}, 33559 author = {N. C. I. National Institutes of Health}, 33560 organization = {NIH Publication}, 33561 address = {Bethesda, Maryland}, 33562 edition = {97-2227}, 33563 year = {1997} 33564} 33565 33566@Book{ nilsson:learning, 33567 author = {N. J. Nilsson}, 33568 title = {Learning Machines}, 33569 year = {1966}, 33570 publisher = {MIT Press}, 33571 address = {Cambridge, Massachusetts} 33572} 33573 33574@Article{ nocedal:theory, 33575 author = {J. Nocedal}, 33576 title = {Theory of Algorithms for Unconstrained Optimization}, 33577 journal = {Acta Numerica}, 33578 year = {1992}, 33579 pages = {199--242} 33580} 33581 33582@InProceedings{ noyes:neural, 33583 author = {J. L. Noyes}, 33584 title = {Neural Network Optimization Methods}, 33585 booktitle = {Proceedings of the Fourth Conference on Neural Networks and Parallel Distributed 33586 Processing}, 33587 year = {1991}, 33588 publisher = {Indiana-Purdue University}, 33589 address = {Fort Wayne, Indiana}, 33590 pages = {1--12} 33591} 33592 33593@Article{ nygard.juell.ea:neural, 33594 author = {K. E. Nygard and P. Juell and N. Kadaba}, 33595 title = {Neural Networks for Selecting Vehicle Routing Heuristics}, 33596 journal = {ORSA Journal on Computing}, 33597 year = {1990}, 33598 volume = {4}, 33599 pages = {353--364} 33600} 33601 33602@Article{ oh.goenka:elastohydrodynamic, 33603 author = {K. P. Oh and P. K. Goenka}, 33604 title = {The Elastohydrodynamic Solution of Journal Bearings under Dynamic Loading}, 33605 journal = {Transactions of the {ASME}, Journal of Tribology}, 33606 volume = {107}, 33607 year = {1985}, 33608 pages = {389--395} 33609} 33610 33611@Article{ oh.li.ea:elastohydrodynamic, 33612 author = {K. P. Oh and C. H. Li and P. K. Goenka}, 33613 title = {Elastohydrodynamic Lubrication of Piston Skirts}, 33614 journal = {Transactions of the {ASME}, Journal of Tribology}, 33615 volume = {109}, 33616 pages = {356--362}, 33617 year = {1987} 33618} 33619 33620@Article{ oh:analysis, 33621 author = {K. P. Oh}, 33622 title = {Analysis of a Needle Bearing}, 33623 journal = {Transactions of the {ASME}, Journal of Tribology}, 33624 volume = {106}, 33625 pages = {78--87}, 33626 year = {1984} 33627} 33628 33629@Article{ oh:formulation, 33630 author = {K. P. Oh}, 33631 title = {The Formulation of the Mixed Lubrication Problem as a Generalized Nonlinear 33632 Complementarity Problem}, 33633 journal = {Transactions of the {ASME}, Journal of Tribology}, 33634 volume = {108}, 33635 year = {1986}, 33636 pages = {598--604} 33637} 33638 33639@Article{ oh:numerical, 33640 author = {K. P. Oh}, 33641 title = {The Numerical Solution of Dynamically Loaded Elastohydrodynamic Contact as a 33642 Nonlinear Complementarity Problem}, 33643 journal = {Transactions of the {ASME}, Journal of Tribology}, 33644 volume = {106}, 33645 year = {1984}, 33646 pages = {88--95} 33647} 33648 33649@Article{ olivera.shepard.ea:maximum, 33650 author = {G. H. Olivera and D. M. Shepard and P. J. Reckwerdt and K. Ruchala and J. Zachman 33651 and E. E. Fitchard and T. R. Mackie}, 33652 title = {Maximum Likelihood as a Common Computational Framework in Tomotherapy}, 33653 journal = {Physics in Medicine and Biology}, 33654 year = {1998}, 33655 pages = {3277--3294} 33656} 33657 33658@Article{ opial:weak, 33659 author = {Z. Opial}, 33660 title = {Weak Convergence of the Sequence of Successive Approximations for Nonexpansive 33661 Mappings}, 33662 journal = {Bulletin of the American Mathematical Society}, 33663 year = {1967}, 33664 volume = {73}, 33665 pages = {591--597} 33666} 33667 33668@Book{ orchard-hays:advanced, 33669 author = {W. Orchard--Hays}, 33670 title = {Advanced Linear Programming Computing Techniques}, 33671 year = {1968}, 33672 publisher = {McGraw--Hill}, 33673 address = {New York} 33674} 33675 33676@Article{ orourke.taylor.ea:factor, 33677 author = {K. O'Rourke and A. M. Taylor and J. G. Williamson}, 33678 title = {Factor price convergence in the late nineteenth century}, 33679 journal = {International Economic Review}, 33680 year = {1996} 33681} 33682 33683@Article{ orourke.williamson:open, 33684 author = {K. O'Rourke and J. G. Williamson}, 33685 title = {Open economy forces and late 19th century {S}wedish catch-up: a quantitative 33686 accounting}, 33687 journal = {Scandinavian Economic and Social History}, 33688 year = {1995}, 33689 volume = {XLIII}, 33690 pages = {171--203} 33691} 33692 33693@Article{ orourke:costs, 33694 author = {K. O'Rourke}, 33695 title = {The costs of international economic disintegration: {I}reland in the 1930's}, 33696 journal = {Research in Economic History}, 33697 year = {1995}, 33698 volume = {15}, 33699 pages = {215--259} 33700} 33701 33702@Article{ orourke:industrial, 33703 author = {K. O'Rourke}, 33704 title = {Industrial policy, employment policy and the non-traded sector}, 33705 journal = {Journal of the Statistical and Social Inquiry Society of Ireland}, 33706 year = {1996} 33707} 33708 33709@Article{ orourke:measuring, 33710 author = {K. O'Rourke}, 33711 title = {Measuring protection: a cautionary tale}, 33712 journal = {Journal of Development Economics}, 33713 year = {1996} 33714} 33715 33716@Book{ ortega.rheinboldt:iterative, 33717 author = {J. M. Ortega and W. C. Rheinboldt}, 33718 title = {Iterative Solution of Nonlinear Equations in Several Variables}, 33719 year = {1970}, 33720 publisher = {Academic Press}, 33721 address = {San Diego, California} 33722} 33723 33724@Book{ ortega:introduction, 33725 author = {J. M. Ortega}, 33726 title = {Introduction to Parallel and Vector Solution of Linear Systems}, 33727 year = {1988}, 33728 publisher = {Plenum Press}, 33729 address = {New York} 33730} 33731 33732@Book{ ortega:numerical, 33733 author = {J. M. Ortega}, 33734 title = {Numerical Analysis, {A} Second Course}, 33735 year = {1972}, 33736 publisher = {Academic Press} 33737} 33738 33739@Article{ osborne.womersley:strong, 33740 author = {M. R. Osborne and R. S. Womersley}, 33741 title = {Strong uniqueness in sequential linear programming}, 33742 journal = {Journal of the Australian Mathematical Society, Series B}, 33743 year = {1990}, 33744 volume = {31}, 33745 pages = {379--384} 33746} 33747 33748@InCollection{ osborne:strong, 33749 author = {M. R. Osborne}, 33750 title = {Strong uniqueness in nonlinear approximation}, 33751 booktitle = {The numerical solution of nonlinear problems}, 33752 year = {1981}, 33753 editor = {C. T. H. Baker and C. Phillips}, 33754 publisher = {Clarendon Press}, 33755 address = {Oxford} 33756} 33757 33758@Book{ outrata.kocvara.ea:nonsmooth, 33759 author = {J. Outrata and M. Ko\v{c}vara and J. Zowe}, 33760 title = {Nonsmooth Approach to Optimization Problems with Equilibrium Constraints}, 33761 publisher = {Kluwer Academic Publishers}, 33762 year = {1998}, 33763 address = {Dordrecht, The Netherlands} 33764} 33765 33766@Article{ outrata.zowe:numerical, 33767 author = {J. V. Outrata and J. Zowe}, 33768 title = {A Numerical Approach to Optimization Problems with Variational Inequality 33769 Constraints}, 33770 journal = {Mathematical Programming}, 33771 year = {1995}, 33772 volume = {68}, 33773 pages = {105--130} 33774} 33775 33776@Article{ outrata:necessary, 33777 author = {J. V. Outrata}, 33778 title = {On Necessary Optimality Conditions for {S}tackelberg Problems}, 33779 journal = {Journal of Optimization Theory and Applications}, 33780 volume = {76}, 33781 year = {1993}, 33782 pages = {305--320} 33783} 33784 33785@Article{ outrata:numerical, 33786 author = {J. V. Outrata}, 33787 title = {On the Numerical Solution of a Class of {S}tackelberg Problems}, 33788 journal = {Zeitschrift f{\"{u}}r Operations Research}, 33789 volume = {4}, 33790 year = {1990}, 33791 pages = {255--278} 33792} 33793 33794@Article{ outrata:optimization, 33795 author = {J. V. Outrata}, 33796 title = {On Optimization Problems with Variational Inequality Constraints}, 33797 journal = {SIAM Journal on Optimization}, 33798 volume = {4}, 33799 year = {1994}, 33800 pages = {340--357} 33801} 33802 33803@Article{ paige.saunders:lsqr, 33804 author = {C. C. Paige and M. A. Saunders}, 33805 title = {{LSQR}: An Algorithm for Sparse Linear Equations and Sparse Least Squares}, 33806 journal = {{ACM} Transactions on Mathematical Software}, 33807 year = {1982}, 33808 volume = {8}, 33809 pages = {43--71} 33810} 33811 33812@Article{ paige.saunders:solution, 33813 author = {C. C. Paige and M. A. Saunders}, 33814 title = {Solution of Sparse Indefinite Systems of Linear Equations}, 33815 journal = {SIAM Journal on Numerical Analysis}, 33816 year = {1975}, 33817 volume = {12}, 33818 pages = {617--629} 33819} 33820 33821@Article{ palacios-gomez.lasdon.ea:nonlinear, 33822 author = {F. Palacios--Gomez and L. Lasdon and M. Engquist}, 33823 title = {Nonlinear Optimization by Successive Linear Programming}, 33824 journal = {Management Science}, 33825 year = {1982}, 33826 volume = {28}, 33827 pages = {1106--1120} 33828} 33829 33830@Article{ palomares.mangasarian:superlinearly, 33831 author = {U. M. Garcia Palomares and O. L. Mangasarian}, 33832 title = {Superlinearly Convergent {Q}uasi--{N}ewton Algorithms for Nonlinearly Constrained 33833 Optimization Problems}, 33834 journal = {Mathematical Programming}, 33835 year = {1976}, 33836 volume = {11}, 33837 pages = {1--13} 33838} 33839 33840@Article{ panagiotopoulos.al-fahed:robot, 33841 author = {P. D. Panagiotopoulos and A. M. Al-Fahed}, 33842 title = {Robot Hand Grasping and Related Problems: Optimal Contol and Identification}, 33843 journal = {The International Journal of Robotics Research}, 33844 year = {1994}, 33845 volume = {13}, 33846 pages = {127--136} 33847} 33848 33849@Book{ panagiotopoulos:hemivariational, 33850 author = {P. D. Panagiotopoulos}, 33851 title = {Hemivariational Inequalities}, 33852 publisher = {Springer-Verlag}, 33853 address = {Berlin}, 33854 year = {1993} 33855} 33856 33857@Book{ panagiotopoulos:inequality, 33858 author = {P. D. Panagiotopoulos}, 33859 title = {Inequality Problems in Mechanics and Applications}, 33860 publisher = {Birkh{\"{a}}user}, 33861 address = {Boston}, 33862 year = {1985} 33863} 33864 33865@Article{ pang.chan:iterative, 33866 author = {J. S. Pang and D. Chan}, 33867 title = {Iterative Methods for Variational and Complementarity Problems}, 33868 journal = {Mathematical Programming}, 33869 year = {1982}, 33870 volume = {24}, 33871 pages = {284--313} 33872} 33873 33874@Article{ pang.gabriel:nesqp, 33875 author = {J. S. Pang and S. A. Gabriel}, 33876 title = {{NE/SQP}: {A} Robust Algorithm for the Nonlinear Complementarity Problem}, 33877 journal = {Mathematical Programming}, 33878 year = {1993}, 33879 volume = {60}, 33880 pages = {295--338} 33881} 33882 33883@Article{ pang.han.ea:minimization, 33884 author = {J. S. Pang and S.--P. Han and N. Rangaraj}, 33885 title = {Minimization of Locally {L}ipschitzian Functions}, 33886 journal = {SIAM Journal on Optimization}, 33887 year = {1991}, 33888 volume = {1}, 33889 pages = {57--82} 33890} 33891 33892@Article{ pang.qi:nonsmooth, 33893 author = {J. S. Pang and L. Qi}, 33894 title = {Nonsmooth Equations: Motivation and Algorithms}, 33895 journal = {SIAM Journal on Optimization}, 33896 year = {1993}, 33897 volume = {3}, 33898 pages = {443--465} 33899} 33900 33901@Article{ pang.trinkle.ea:complementarity, 33902 author = {J. S. Pang and J. C. Trinkle and G. Lo}, 33903 title = {A Complementarity Approach to a Quasistatic Multi-Rigid-Body Contact Problem}, 33904 journal = {Computational Optimization and Applications}, 33905 volume = {5}, 33906 pages = {97--138}, 33907 year = {1996} 33908} 33909 33910@Article{ pang.trinkle:complementarity, 33911 author = {J. S. Pang and J. C. Trinkle}, 33912 title = {Complementarity Formulations and Existence of Solutions of Multi-Rigid-Body 33913 Contact Problems with {C}oulomb Friction}, 33914 year = {1996}, 33915 journal = {Mathematical Programming}, 33916 volume = {73}, 33917 pages = {199--226} 33918} 33919 33920@TechReport{ pang.wang:embedding, 33921 author = {J. S. Pang and Z. P. Wang}, 33922 title = {Embedding Methods for Variational Inequality and Nonlinear Complementarity 33923 Problems}, 33924 institution = {Department of Mathematical Sciences, The Johns Hopkins University}, 33925 year = {1990}, 33926 address = {Baltimore, Maryland} 33927} 33928 33929@TechReport{ pang.yang:parallel, 33930 author = {J. S. Pang and J. M. Yang}, 33931 title = {Parallel {N}ewton Methods for the Nonlinear Complementarity Problem}, 33932 institution = {Department of Mathematical Sciences, The Johns Hopkins University}, 33933 year = {1987}, 33934 address = {Baltimore, Maryland}, 33935 type = {Manuscript} 33936} 33937 33938@Article{ pang.yu:linearized, 33939 author = {J. S. Pang and C. S. Yu}, 33940 title = {Linearized Simplicial Decomposition Methods for Computing Traffic Equilibria on 33941 Networks}, 33942 journal = {Networks}, 33943 volume = {14}, 33944 pages = {427--438}, 33945 year = {1984} 33946} 33947 33948@Article{ pang:b-differentiable, 33949 author = {J. S. Pang}, 33950 title = {A {B}--Differentiable Equation Based, Globally and Locally Quadratically 33951 Convergent Algorithm for Nonlinear Programs, Complementarity and Variational 33952 Inequality Problems}, 33953 journal = {Mathematical Programming}, 33954 year = {1991}, 33955 volume = {51}, 33956 pages = {101--132} 33957} 33958 33959@InCollection{ pang:complementarity, 33960 author = {J. S. Pang}, 33961 title = {Complementarity Problems}, 33962 booktitle = {Handbook in Global Optimization}, 33963 publisher = {Kluwer Academic Publishers}, 33964 year = {1994}, 33965 editor = {R. Horst and P. Pardalos}, 33966 address = {Boston} 33967} 33968 33969@Article{ pang:convergence, 33970 author = {J. S. Pang}, 33971 title = {On the Convergence of a Basic Iterative Method for the Implicit Complementarity 33972 Problem}, 33973 journal = {Journal of Optimization Theory and Applications}, 33974 year = {1982}, 33975 volume = {37}, 33976 pages = {149--162} 33977} 33978 33979@Article{ pang:convergence*1, 33980 author = {J. S. Pang}, 33981 title = {Convergence of Splitting and {N}ewton Methods for Complementarity Problems: An 33982 Application of some Sensitivity Results}, 33983 journal = {Mathematical Programming}, 33984 year = {1993}, 33985 volume = {58}, 33986 pages = {149--160} 33987} 33988 33989@Article{ pang:inexact, 33990 author = {J. S. Pang}, 33991 title = {Inexact {N}ewton Methods for the Nonlinear Complementarity Problem}, 33992 journal = {Mathematical Programming}, 33993 year = {1986}, 33994 volume = {36}, 33995 pages = {54--71} 33996} 33997 33998@Article{ pang:more, 33999 author = {J. S. Pang}, 34000 title = {More Results on the Convergence of Iterative Methods for the Symmetric Linear 34001 Complementarity Problem}, 34002 journal = {Journal of Optimization Theory and Applications}, 34003 year = {1986}, 34004 volume = {49}, 34005 pages = {107--134} 34006} 34007 34008@Article{ pang:more*1, 34009 author = {J. S. Pang}, 34010 title = {More Results on the Convergence of Iterative Methods for Symmetric Linear 34011 Complementarity Problems}, 34012 journal = {Journal of Optimization Theory and Applications}, 34013 year = {1986}, 34014 volume = {49}, 34015 pages = {107--134} 34016} 34017 34018@Article{ pang:necessary, 34019 author = {J. S. Pang}, 34020 title = {Necessary and Sufficient Conditions for the Convergence of Iterative Methods for 34021 the Linear Complementarity Problem}, 34022 journal = {Journal of Optimization Theory and Applications}, 34023 year = {1984}, 34024 volume = {42}, 34025 pages = {1--17} 34026} 34027 34028@Article{ pang:newtons, 34029 author = {J. S. Pang}, 34030 title = {{N}ewton's Method for {B}--Differentiable Equations}, 34031 journal = {Mathematics of Operations Research}, 34032 year = {1990}, 34033 volume = {15}, 34034 pages = {311--341} 34035} 34036 34037@Article{ pang:posteriori, 34038 author = {J. S. Pang}, 34039 title = {A Posteriori Error Bound for the Linearly--Constrained Variational Inequality 34040 Problem}, 34041 journal = {Mathematics of Operations Research}, 34042 year = {1987}, 34043 volume = {12}, 34044 pages = {474--484} 34045} 34046 34047@Article{ pantoja.mayne:sequential, 34048 author = {J. F. A. D. Pantoja and D. Q. Mayne}, 34049 title = {Sequential Quadratic Programming Algorithm for Discrete Optimal Control Problems 34050 with Control Inequality Constraints}, 34051 journal = {International Journal on Control}, 34052 year = {1991}, 34053 volume = {53}, 34054 pages = {823--836} 34055} 34056 34057@Book{ papadimitriou.steiglitz:combinatorial, 34058 author = {C. H. Papadimitriou and K. Steiglitz}, 34059 title = {Combinatorial Optimization: Algorithms and Complexity}, 34060 year = {1982}, 34061 publisher = {Prentice-Hall, Inc}, 34062 address = {Englewood Cliffs, New Jersey} 34063} 34064 34065@Article{ papanikolau.mackie.ea:investigation, 34066 author = {N. Papanikolaou and T. R. Mackie and C. Meger-Wells and M. Gehring and P. 34067 Reckwerdt}, 34068 title = {Investigation of the convolution method for polyenergetic spectra}, 34069 journal = {Medical Physics}, 34070 year = {1993}, 34071 volume = {20}, 34072 number = {5}, 34073 pages = {1327--1336} 34074} 34075 34076@Article{ parisot:resolution, 34077 author = {G. R. Parisot}, 34078 title = {{R}\'{e}solution Num\'{e}rique Approach\'{e}e du Probl\`{e}me de Programmation 34079 Lin\'{e}aire par Application de la Programmation Logarithmique}, 34080 journal = {Revue Fran\c{c}aise Recherche Op\'{e}rationnelle}, 34081 year = {1961}, 34082 volume = {20}, 34083 pages = {227--259} 34084} 34085 34086@Article{ parker.cave.ea:comparison, 34087 author = {L. R. Parker and M. R. Cave and R. M. Barnes}, 34088 title = {Comparison of Simplex Algorithms}, 34089 journal = {Analytica Chimica Acta}, 34090 year = {1985}, 34091 volume = {175}, 34092 pages = {231--237} 34093} 34094 34095@InProceedings{ parker:optimal, 34096 author = {D. Parker}, 34097 title = {Optimal Algorithms for Adaptive Networks: Second Order Direct Propagation, and 34098 Second Order Hebbian Learning}, 34099 booktitle = {Proceedings of the IEEE First International Conference on Neural Networks: Volume 34100 II}, 34101 year = {1987}, 34102 address = {San Diego:IEEE}, 34103 pages = {593--600} 34104} 34105 34106@Book{ pascali.sburlan:nonlinear, 34107 author = {D. Pascali and S. Sburlan}, 34108 title = {Nonlinear Mappings of Monotone Type}, 34109 publisher = {Editura Academeie}, 34110 year = {1978} 34111} 34112 34113@Article{ passty:ergodic, 34114 author = {G. B. Passty}, 34115 title = {Ergodic convergence to a zero of the sum of monotone operators in {H}ilbert 34116 space}, 34117 journal = {Journal of Mathematical Analysis and Applications}, 34118 year = {1979}, 34119 volume = {72}, 34120 pages = {383--390} 34121} 34122 34123@Article{ peaceman.rachford:numerical, 34124 author = {D. W. Peaceman and H. H. Rachford}, 34125 title = {The numerical solution of parabolic and elliptic differential equations}, 34126 journal = {SIAM Journal}, 34127 year = {1955}, 34128 volume = {3}, 34129 pages = {28--41} 34130} 34131 34132@Book{ peck.tiesberg:global, 34133 author = {S. Peck and T. Tiesberg}, 34134 title = {Global Warming Uncertainties and the Value of Information: An Analysis Using 34135 {CETA}}, 34136 publisher = {The Electric Power Institute}, 34137 year = {1992}, 34138 address = {Paolo Alto CA} 34139} 34140 34141@TechReport{ peng:convexity, 34142 author = {J. -M. Peng}, 34143 title = {The Convexity of the Implicit {L}agrangian}, 34144 institution = {State Key Laboratory of Scientific and Engineering Computing, Academic Sinica}, 34145 year = {1995}, 34146 type = {Technical Report}, 34147 address = {Beijing} 34148} 34149 34150@Article{ peng:equivalence, 34151 author = {J. -M. Peng}, 34152 title = {Equivalence of Variational Inequality Problems to Unconstrained Optimization}, 34153 journal = {Mathematical Programming}, 34154 year = {1997}, 34155 volume = {78}, 34156 pages = {347--356} 34157} 34158 34159@Article{ pennisi:taking, 34160 author = {E. Pennisi}, 34161 title = {Taking a structured approach to understanding proteins}, 34162 journal = {Science}, 34163 year = {1998}, 34164 volume = {279}, 34165 pages = {978--979} 34166} 34167 34168@Article{ penot:regularity, 34169 author = {J. P. Penot}, 34170 title = {On regularity conditions in mathematical programming}, 34171 journal = {Mathematical Programming Study}, 34172 year = {1982}, 34173 volume = {17}, 34174 pages = {28--66} 34175} 34176 34177@Book{ perez:principles, 34178 author = {C. A. Perez and L. W. Brady}, 34179 title = {Principles and practice of radiotherapy}, 34180 publisher = {Lippincott-Raven}, 34181 year = {1998}, 34182 address = {Philadelphia}, 34183 edition = {3rd} 34184} 34185 34186@Article{ perroni.rutherford:international, 34187 author = {C. Perroni and T. Rutherford}, 34188 title = {International Trade in Carbon Emission Rights and Basic Materials: General 34189 Equilibrium Calculations for 2020}, 34190 journal = {Scandinavian Journal of Economics}, 34191 year = {1993} 34192} 34193 34194@Article{ perroni.rutherford:regular, 34195 author = {C. Perroni and T. Rutherford}, 34196 title = {Regular Flexibility of Nested {CES} Functions}, 34197 journal = {European Economic Review}, 34198 year = {1995}, 34199 volume = {39}, 34200 pages = {335--343} 34201} 34202 34203@InCollection{ perroni.wigle:environmental, 34204 author = {C. Perroni and R. M. Wigle}, 34205 title = {Environmental Policy Modeling}, 34206 booktitle = {Global Trade Analysis: Modeling and Applications}, 34207 publisher = {Cambridge University Press}, 34208 year = {1996}, 34209 editor = {T. Hertel} 34210} 34211 34212@Article{ peterson:review, 34213 author = {D. W. Peterson}, 34214 title = {A Review of Constraint Qualifications in Finite--Dimensional Spaces}, 34215 journal = {SIAM Review}, 34216 year = {1973}, 34217 volume = {15}, 34218 pages = {639--654} 34219} 34220 34221@PhDThesis{ petersson:optimization, 34222 author = {J. Petersson}, 34223 title = {Optimization of Structures in Unilateral Contact}, 34224 type = {{L}ink{\"o}ping Studies in Science and Technology, Dissertations}, 34225 number = {397}, 34226 school = {Division of Mechanics, Department of Mechanical Engineering, Link{\"o}ping 34227 University}, 34228 address = {Link{\"o}ping, Sweden}, 34229 year = {1995} 34230} 34231 34232@Book{ petri:modelling, 34233 author = {P. Petri}, 34234 title = {Modelling {J}apanese--{A}merican Trade, {A} Study of Asymmetric Interdependence}, 34235 publisher = {Harvard University Press}, 34236 year = {1984} 34237} 34238 34239@InProceedings{ petrzykowski:application, 34240 author = {T. Petrzykowski}, 34241 title = {Application of the Steepest Ascent Method to Concave Programming}, 34242 booktitle = {Proceedings of the {IFIPS} Congress, Munich, 1962}, 34243 year = {1962}, 34244 publisher = {North--Holland}, 34245 address = {Amsterdam}, 34246 pages = {185--189} 34247} 34248 34249@InProceedings{ pettey.leuze.ea:parallel, 34250 crossref = {grefenstette:genetic}, 34251 author = {C. C. Pettey and M. R. Leuze and J. J. Grefenstette}, 34252 title = {A Parallel Genetic Algorithm}, 34253 pages = {155--161} 34254} 34255 34256@InProceedings{ pettey.leuze:theoretical, 34257 crossref = {schaeffer:third}, 34258 author = {C. C. Pettey and M. R. Leuze}, 34259 title = {A Theoretical Investigation of a Parallel Genetic Algorithm}, 34260 pages = {398--405} 34261} 34262 34263@Book{ pfeiffer.glocker:multibody, 34264 author = {F. Pfeiffer and C. Glocker}, 34265 title = {Multibody Dynamics with Unilateral Contact}, 34266 year = {1996}, 34267 publisher = {John Wiley \& Sons} 34268} 34269 34270@TechReport{ pierro.iusem:convergence, 34271 author = {A. R. de Pierro and A. N. Iusem}, 34272 title = {Convergence Properties of Iterative Methods for Symmetric Positive Semidefinite 34273 Linear Complementarity Problems}, 34274 institution = {Instituto de Matematica, Elasticita e Ciencia da Computacao}, 34275 year = {1990}, 34276 address = {Universidade Estadual de Campinas, CP 6065, Campinas, 13081, SP, Brazil} 34277} 34278 34279@InCollection{ pillo.grippo.ea:class, 34280 author = {G. Di Pillo and L. Grippo and F. Lampariello}, 34281 title = {A Class of Methods for the Solution of Optimization Problems with Inequalities}, 34282 booktitle = {System Modelling and Optimization}, 34283 year = {1981}, 34284 editor = {R. F. Drenick and F. Kozin}, 34285 publisher = {Springer-Verlag}, 34286 address = {Berlin} 34287} 34288 34289@Article{ pillo.grippo:augmented, 34290 author = {G. Di Pillo and L. Grippo}, 34291 title = {An Augmented {L}agrangian for Inequality Constraints in Nonlinear Programming 34292 Problems}, 34293 journal = {Journal of Optimization Theory and Applications}, 34294 year = {1982}, 34295 volume = {36}, 34296 pages = {495--519} 34297} 34298 34299@Article{ pillo.grippo:class, 34300 author = {G. Di Pillo and L. Grippo}, 34301 title = {A New Class of Augmented {L}agrangians in Nonlinear Programming}, 34302 journal = {SIAM Journal on Control and Optimization}, 34303 year = {1979}, 34304 volume = {17}, 34305 pages = {618--628} 34306} 34307 34308@Article{ pillo.grippo:continuously, 34309 author = {G. Di Pillo and L. Grippo}, 34310 title = {A Continuously Differentiable Exact Penalty Function for Nonlinear Programming 34311 Problems with Inequality Constraints}, 34312 journal = {SIAM Journal on Control and Optimization}, 34313 year = {1985}, 34314 volume = {23}, 34315 pages = {72--84} 34316} 34317 34318@Article{ pillo.grippo:exact, 34319 author = {G. Di Pillo and L. Grippo}, 34320 title = {An Exact Penalty Method with Global Convergence Properties for Nonlinear 34321 Programming Problems}, 34322 journal = {Mathematical Programming}, 34323 year = {1986}, 34324 volume = {36}, 34325 pages = {1--18} 34326} 34327 34328@InProceedings{ plambeck.fu.ea:throughput, 34329 author = {E. L. Plambeck and B. --R. Fu and S.M. Robinson and R. Suri}, 34330 title = {Throughput Optimization in Tandem Production Lines via Nonsmooth Programming}, 34331 booktitle = {Proceedings of the 1993 Summer Computer Simulation Conference}, 34332 editor = {J. Schoen}, 34333 year = {1993}, 34334 publisher = {Society for Computer Simulation}, 34335 address = {San Diego, CA}, 34336 pages = {70--75} 34337} 34338 34339@Article{ plambeck.fu.ea:sample-path, 34340 author = {E. L. Plambeck and B. --R. Fu and S.M. Robinson and R. Suri}, 34341 title = {Sample-Path Optimization of Convex Stochastic Performance Functions}, 34342 journal = {Mathematical Programming}, 34343 year = {1996}, 34344 volume = {75}, 34345 pages = {137--176} 34346} 34347 34348@InProceedings{ platt:sequential, 34349 author = {J. Platt}, 34350 title = {Sequential Minimal Optimization: A Fast Algorithm for Training Support Vector 34351 Machines}, 34352 editor = {Bernhard {Sch\"olkopf} and Christopher J. C. Burges and Alexander J. Smola}, 34353 booktitle = {Advances in Kernel Methods {-} Support Vector Learning}, 34354 publisher = {MIT Press}, 34355 pages = {185-208}, 34356 year = {1999} 34357} 34358 34359@Book{ poincare:sur, 34360 author = {H. Poincar\'{e}}, 34361 title = {Sur les Courbes {D}\'{e}fin\'{e}es par une \'{E}quation Differentielle {I}}, 34362 year = {1881}, 34363 publisher = {Oeuvres I}, 34364 address = {Gauthier--Villars, Paris} 34365} 34366 34367@Article{ polak.ribiere:note, 34368 author = {E. Polak and G. Ribi\`{e}re}, 34369 title = {Note sur la convergence de m\'{e}thodes de directions conjug\'{e}es}, 34370 journal = {Revue Francaise Informatique et Recherche Op\'{e}rationelle}, 34371 year = {1969}, 34372 volume = {16-R1}, 34373 pages = {35--43} 34374} 34375 34376@Book{ polak:computational, 34377 author = {E. Polak}, 34378 title = {Computational Methods in Optimization; {A} Unified Approach}, 34379 year = {1971}, 34380 publisher = {Academic Press}, 34381 address = {New York} 34382} 34383 34384@Article{ polak:global, 34385 author = {E. Polak}, 34386 title = {On the Global Stabilization of Locally Convergent Algorithms}, 34387 journal = {Automatica}, 34388 year = {1976}, 34389 volume = {12}, 34390 pages = {337--349} 34391} 34392 34393@Article{ polyak.tretiyakov:concerning, 34394 author = {B. T. Polyak and N. V. Tretiyakov}, 34395 title = {Concerning an Iterative Method for Linear Programming and its Economic 34396 Interpretation}, 34397 journal = {Economics and Mathematical Methods}, 34398 year = {1972}, 34399 volume = {8}, 34400 pages = {740--751}, 34401 note = {(Russian)} 34402} 34403 34404@Article{ polyak.tretiyakov:method, 34405 author = {B. T. Polyak and N. V. Tretiyakov}, 34406 title = {The Method of Penalty Estimates for Conditional Extremeum Problems}, 34407 journal = {U.S.S.R. Computational Mathematics and Mathematical Physics}, 34408 year = {1973}, 34409 volume = {13}, 34410 pages = {42--58} 34411} 34412 34413@Article{ polyak:conjugate, 34414 author = {B. T. Polyak}, 34415 title = {The conjugate gradient method in extremal problems}, 34416 journal = {USSR Computational Mathematics and Mathematical Physics}, 34417 year = {1969}, 34418 volume = {9}, 34419 pages = {94--112}, 34420 note = {Translated from Russian} 34421} 34422 34423@Book{ polyak:introduction, 34424 author = {B. T. Polyak}, 34425 title = {Introduction to Optimization}, 34426 year = {1987}, 34427 publisher = {Optimization Software, Inc.}, 34428 address = {Publications Division, New York} 34429} 34430 34431@Unpublished{ polyak:methods, 34432 author = {R. A. Polyak}, 34433 title = {On the Methods of Centers}, 34434 year = {1988}, 34435 note = {Unpublished manuscript} 34436} 34437 34438@Unpublished{ polyak:sharp, 34439 author = {B. T. Polyak}, 34440 title = {Sharp Minima}, 34441 year = {1979}, 34442 note = {A Talk given at the {IIASA} Workshop on Generalized {L}agrangians and their 34443 Applications, {IIASA}, Laxenburg, Austria} 34444} 34445 34446@InProceedings{ polyak:smooth, 34447 author = {R. A. Polyak}, 34448 title = {Smooth Optimization Methods for Solving Nonlinear Extremal and Equilibrium 34449 Problems with Constraints}, 34450 booktitle = {Abstracts of the Papers of the 11th International Symposium on Mathematical 34451 Programming}, 34452 year = {1982}, 34453 address = {Bonn} 34454} 34455 34456@Article{ polychronopoulos.tsitsiklis:analysis, 34457 author = {G. H. Polychronopoulos and J. N. Tsitsiklis}, 34458 title = {Stochastic Shortest Path Problems with Recourse}, 34459 journal = {Networks}, 34460 year = {1996}, 34461 volume = {27}, 34462 pages = {133--143} 34463} 34464 34465@TechReport{ potra.bonnans:infeasible, 34466 author = {F. A. Potra and J. F. Bonnans}, 34467 title = {Infeasible path following algorithms for linear complementarity problems}, 34468 institution = {INRIA}, 34469 year = {1994}, 34470 month = dec, 34471 number = {RR--2445}, 34472 type = {Research Report} 34473} 34474 34475@Article{ potra.sheng:large-step, 34476 author = {F. A. Potra and R. Sheng}, 34477 title = {A Large--Step Infeasible--Interior--Point Method for the ${P}_*$--Matrix {LCP}}, 34478 year = {1997}, 34479 journal = {SIAM Journal on Optimization}, 34480 volume = {7}, 34481 pages = {318--335} 34482} 34483 34484@Article{ potra:infeasible, 34485 author = {F. A. Potra}, 34486 title = {An infeasible interior-point predictor-corrector algorithm for linear 34487 programming}, 34488 journal = {SIAM Journal on Optimization}, 34489 year = {1996}, 34490 volume = {6}, 34491 pages = {19--32} 34492} 34493 34494@TechReport{ potra:onl, 34495 author = {F. A. Potra}, 34496 title = {An ${O}(n{L})$ infeasible--interior--point algorithm for {LCP} with quadratic 34497 convergence.}, 34498 institution = {Department of Mathematics, The University of Iowa}, 34499 address = {Iowa City, Iowa}, 34500 year = {1994}, 34501 number = {50}, 34502 type = {Reports on Computational Mathematics} 34503} 34504 34505@TechReport{ potra:predictor-corrector, 34506 author = {F. A. Potra}, 34507 title = {On a predictor-corrector method for solving linear programs from infeasible 34508 starting points}, 34509 institution = {Department of Mathematics, University of Iowa}, 34510 address = {Iowa City, Iowa}, 34511 year = {1992}, 34512 number = {34}, 34513 type = {Reports on Computational Mathematics} 34514} 34515 34516@TechReport{ potra:quadratically, 34517 author = {F. A. Potra}, 34518 title = {A quadratically convergent infeasible interior-point algorithm for linear 34519 programming}, 34520 institution = {Department of Mathematics, University of Iowa}, 34521 year = {1992}, 34522 number = {28}, 34523 address = {Iowa City, Iowa}, 34524 month = jul 34525} 34526 34527@InCollection{ powell:convergence, 34528 author = {M. J. D. Powell}, 34529 title = {The Convergence of Variable Metric Methods for Nonlinearly Constrained 34530 Optimization Calculations}, 34531 crossref = {mangasarian.meyer.ea:nonlinear*3}, 34532 pages = {27--63} 34533} 34534 34535@InProceedings{ powell:direct, 34536 author = {M. J. D. Powell}, 34537 title = {A Direct Search Optimization Method that Models the Objective and Constraint 34538 Functions by Linear Interpolation}, 34539 booktitle = {Advances in Optimization and Numerical Analysis, Proceedings of the Sixth 34540 Workshop on Optimization and Numerical Analysis, Oaxaca, Mexico}, 34541 volume = {275}, 34542 year = {1994}, 34543 publisher = {Kluwer Academic Publishers}, 34544 pages = {51--67}, 34545 address = {Dordrecht, The Netherlands} 34546} 34547 34548@Article{ powell:efficient, 34549 author = {M. J. D. Powell}, 34550 title = {An Efficient Method for Finding the Minimum of a Function of Several Variables 34551 without Calculating Derivatives}, 34552 journal = {Computer Journal}, 34553 year = {1964}, 34554 volume = {17}, 34555 pages = {155--162} 34556} 34557 34558@InCollection{ powell:general, 34559 author = {M. J. D. Powell}, 34560 title = {General Algorithm for Discrete Nonlinear Approximation Calculations}, 34561 booktitle = {Approximation Theory IV}, 34562 year = {1983}, 34563 editor = {L. L. Schumaker C. K. Chui and J. D. Ward}, 34564 publisher = {Academic Press}, 34565 address = {New York}, 34566 pages = {187--218} 34567} 34568 34569@InCollection{ powell:hybrid, 34570 author = {M. J. D. Powell}, 34571 title = {A hybrid method for nonlinear equations}, 34572 booktitle = {Numerical Methods for Nonlinear Algebraic Equations}, 34573 publisher = {Gordon and Breach}, 34574 year = {1970}, 34575 editor = {P. Rabinowitz} 34576} 34577 34578@TechReport{ powell:karmarkars, 34579 author = {M. J. D. Powell}, 34580 title = {{K}armarkar's algorithm: a view from nonlinear programming}, 34581 institution = {Department of Applied Mathematics and Theoretical Physics, University of 34582 Cambridge}, 34583 year = {1989}, 34584 month = nov, 34585 address = {Cambridge, CB3 9EW, England} 34586} 34587 34588@InCollection{ powell:method, 34589 author = {M. J. D. Powell}, 34590 title = {A Method for Nonlinear Constraints in Minimization Problems}, 34591 booktitle = {Optimization}, 34592 year = {1969}, 34593 editor = {R. Fletcher}, 34594 publisher = {Academic Press}, 34595 address = {London}, 34596 pages = {283--298} 34597} 34598 34599@Book{ prekopa:stochastic, 34600 author = {A. Pr{\'{e}}kopa}, 34601 title = {Stochastic Programming}, 34602 publisher = {Kluwer Academic Publishers}, 34603 year = {1995}, 34604 address = {Dordrecht, The Netherlands} 34605} 34606 34607@Book{ press.flannery.ea:numerical, 34608 author = {William H. Press and Brian P. Flannery and Saul A. Teukolsky and William T. 34609 Vetterling}, 34610 title = {Numerical Recipes : the Art of Scientific Computing}, 34611 publisher = {Cambridge University Press}, 34612 year = {1988} 34613} 34614 34615@Article{ pruyne.livny:interfacing, 34616 author = {J. Pruyne and M. Livny}, 34617 title = {Interfacing {C}ondor and {PVM} to Harness the Cycles of Workstation Clusters}, 34618 journal = {Journal on Future Generations of Computer Systems}, 34619 volume = {12}, 34620 year = {1996}, 34621 pages = {67--85} 34622} 34623 34624@InCollection{ pruyne.livny:parallel, 34625 author = {J. Pruyne and M. Livny}, 34626 title = {Parallel Processing on Dynamic Resources using {CARMI}}, 34627 booktitle = {Job Scheduling Strategies for Parallel Processing}, 34628 publisher = {Springer-Verlag}, 34629 year = {1995}, 34630 editor = {D. G. Feitelson and L. Rudolph}, 34631 volume = {949}, 34632 series = {Lecture Notes in Computer Science} 34633} 34634 34635@PhDThesis{ pruyne:resource, 34636 author = {J. C. Pruyne}, 34637 title = {Resource Management Services for Parallel Applications}, 34638 school = {University of Wisconsin--Madison}, 34639 year = {1996}, 34640 address = {Madison, Wisconsin} 34641} 34642 34643@Book{ pshenichny.danilin:numerical, 34644 author = {B. N. Pshenichny and Yu. M. Danilin}, 34645 title = {Numerical Methods in Extremal Problems}, 34646 year = {1978}, 34647 publisher = {MIR Publishers}, 34648 address = {Moscow} 34649} 34650 34651@TechReport{ qi.chen:globally, 34652 author = {L. Qi and X. Chen}, 34653 title = {A Globally Convergent Successive Approximation Method for Nonsmooth Equations}, 34654 institution = {School of Mathematics, University of New South Wales}, 34655 year = {1993}, 34656 annote = {revised}, 34657 address = {Sydney} 34658} 34659 34660@Article{ qi.jiang:semismooth, 34661 author = {L. Qi and H. Jiang}, 34662 title = {Semismooth {K}arush--{K}uhn--{T}ucker Equations and Convergence Analysis of 34663 {N}ewton Methods and Quasi--{N}ewton Methods for Solving these Equations}, 34664 journal = {Mathematics of Operations Research}, 34665 volume = {22}, 34666 pages = {301--325}, 34667 year = {1997} 34668} 34669 34670@TechReport{ qi.peng:unconstrained, 34671 author = {H. -D. Qi and J. -M. Peng}, 34672 title = {A New Unconstrained Optimization Approach for Nonlinear Complementarity 34673 Problems}, 34674 institution = {State Key Laboratory of Scientific and Engineering Computing, Academic Sinica}, 34675 year = {1996}, 34676 type = {Technical Report}, 34677 address = {Beijing} 34678} 34679 34680@InCollection{ qi.sun:survey, 34681 author = {L. Qi and D. Sun}, 34682 title = {A Survey of Some Nonsmooth Equations and Smoothing {N}ewton Methods}, 34683 year = {1999}, 34684 editor = {A. Eberhard and B. Glover and R. Hill and D. Ralph}, 34685 booktitle = {Progress in Optimization}, 34686 pages = {121--146}, 34687 series = {Applied Optimization}, 34688 volume = {30}, 34689 publisher = {Kluwer Academic Publishers}, 34690 address = {Dordrecht} 34691} 34692 34693@Article{ qi.sun:nonsmooth, 34694 author = {L. Qi and J. Sun}, 34695 title = {A Nonsmooth Version of {N}ewton's Method}, 34696 journal = {Mathematical Programming}, 34697 year = {1993}, 34698 volume = {58}, 34699 pages = {353--368} 34700} 34701 34702@Article{ qi:convergence, 34703 author = {L. Qi}, 34704 title = {Convergence Analysis of Some Algorithms for Solving Nonsmooth Equations}, 34705 journal = {Mathematics of Operations Research}, 34706 year = {1993}, 34707 volume = {18}, 34708 pages = {227--244} 34709} 34710 34711@TechReport{ qi:regular, 34712 author = {L. Qi}, 34713 title = {Regular pseudo-smooth {NCP} and {BVIP} functions and globally and quadratically 34714 convergent generalized {N}ewton methods for complementarity and variational 34715 inequality problems}, 34716 institution = {School of Mathematics, University of New South Wales}, 34717 year = {1997}, 34718 type = {Applied Mathematics Report}, 34719 number = {AMR 97/14}, 34720 address = {Sydney, Australia} 34721} 34722 34723@Article{ radner:competitive, 34724 author = {R. Radner}, 34725 title = {Competitive Equilibrium under Uncertainty}, 34726 journal = {Econometrica}, 34727 year = {1968}, 34728 volume = {36}, 34729 pages = {31--58} 34730} 34731 34732@Article{ radstrom:embedding, 34733 author = {H. R{\aa}dstr{\"{o}}m}, 34734 title = {An embedding theorem for spaces of convex sets}, 34735 journal = {Proc. Amer. Math. Soc.}, 34736 year = {1952}, 34737 volume = {3}, 34738 pages = {165--169} 34739} 34740 34741@Article{ raghavachari:connections, 34742 author = {M. Raghavachari}, 34743 title = {On Connections between Zero--One Integer Programming and Concave Programming 34744 Under Linear Constraints}, 34745 journal = {Operations Research}, 34746 year = {1969}, 34747 volume = {17}, 34748 pages = {680--684} 34749} 34750 34751@Article{ rajan.burridge.ea:dynamics, 34752 author = {V. T. Rajan and R. Burridge and J. T. Schwartz}, 34753 title = {Dynamics of a rigid body in frictional contact with rigid walls}, 34754 journal = {IEEE International Conference on Robotics and Automation, Raleigh NC}, 34755 month = mar, 34756 year = {1987}, 34757 pages = {671--677} 34758} 34759 34760@Article{ ralph:branching, 34761 author = {D. Ralph}, 34762 title = {On Branching Numbers of Normal Manifolds}, 34763 journal = {Nonlinear Analysis, Theory, Methods and Applications}, 34764 volume = {22}, 34765 pages = {1041--1050}, 34766 year = {1994} 34767} 34768 34769@Article{ ralph:global, 34770 author = {D. Ralph}, 34771 title = {Global Convergence of Damped {N}ewton's Method for Nonsmooth Equations, via the 34772 Path Search}, 34773 journal = {Mathematics of Operations Research}, 34774 year = {1994}, 34775 volume = {19}, 34776 pages = {352--389} 34777} 34778 34779@InProceedings{ ralph:piecewise, 34780 author = {D. Ralph}, 34781 title = {A Piecewise Sequential Quadratic Programming Method for Mathematical Programs 34782 with Linear Complementarity Constraints}, 34783 booktitle = {Proceedings of the Seventh Conference on Computational Techniques and 34784 Applications (CTAC95)}, 34785 year = {1996} 34786} 34787 34788@PhDThesis{ raman:integration, 34789 author = {R. Raman}, 34790 title = {Integration of logic and heuristic knowledge in discrete optimization techniques 34791 for process systems.}, 34792 address = {Pittsburgh, Pennsylvania}, 34793 year = {1993}, 34794 school = {Department of Chemical Engineering, Carnegie Mellon University} 34795} 34796 34797@PhDThesis{ rangaraj:nonsmooth, 34798 author = {Narayan Rangaraj}, 34799 title = {Nonsmooth Optimization: Algorithms and Applications}, 34800 year = {1990}, 34801 address = {Baltimore, MD}, 34802 school = {Department of Mathematical Sciences, The Johns Hopkins University} 34803} 34804 34805@InProceedings{ reckwerdt.mackie.ea:three-dimensional, 34806 author = {P. J. Reckwerdt and T. R. Mackie and J. P. Balog and T. R. McNutt}, 34807 title = {Three-Dimensional Inverse Treatment Optimization for Tomotherapy}, 34808 booktitle = {Proceedings of the XII International Conference on the Use of Computers in 34809 Radiation Therapy, Salt Lake City}, 34810 year = {1997}, 34811 editor = {D. D. Leavitt and G. Starkshall}, 34812 publisher = {Medical Physics Publishing}, 34813 address = {St. Louis, Missouri}, 34814 pages = {420--422} 34815} 34816 34817@Article{ reid:sparsity-exploiting, 34818 author = {J. K. Reid}, 34819 title = {A Sparsity-Exploiting Variant of the {B}artels-{G}olub Decomposition for Linear 34820 Programming Bases}, 34821 journal = {Mathematical Programming}, 34822 year = {1982}, 34823 volume = {24}, 34824 pages = {55--69} 34825} 34826 34827@Book{ reingold.nievergelt.ea:combinatorial, 34828 author = {E. Reingold and J. Nievergelt and N. Deo}, 34829 title = {Combinatorial Algorithms: Theory and Practice}, 34830 publisher = {Prentice-Hall, Inc}, 34831 address = {Englewood Cliffs, New Jersey} 34832} 34833 34834@PhDThesis{ reinoza:degree, 34835 author = {J. A. Reinoza}, 34836 title = {A Degree for Generalized Equations}, 34837 year = {1979}, 34838 address = {Madison, Wisconsin}, 34839 school = {University of Wisconsin} 34840} 34841 34842@Article{ reinoza:solving, 34843 author = {A. Reinoza}, 34844 title = {Solving Generalized Equations via Homotopies}, 34845 journal = {Mathematical Programming}, 34846 year = {1985}, 34847 volume = {31}, 34848 pages = {307--320} 34849} 34850 34851@PhDThesis{ ren:computable, 34852 author = {J. Ren}, 34853 title = {Computable Error Bounds in Mathematical Programming}, 34854 school = {Computer Sciences Department, University of Wisconsin}, 34855 year = {1993}, 34856 address = {Madison, Wisconsin}, 34857 note = {Technical Report 1173} 34858} 34859 34860@Article{ renegar:polynomial-time, 34861 author = {J. Renegar}, 34862 title = {A Polynomial--Time Algorithm, based on {N}ewton's method, for Linear 34863 Programming}, 34864 journal = {Mathematical Programming}, 34865 year = {1988}, 34866 volume = {40}, 34867 pages = {59--94} 34868} 34869 34870@Article{ robbins.monro:stochastic, 34871 author = {H. Robbins and S. Monro}, 34872 title = {A Stochastic Approximation Method}, 34873 journal = {Annals of Mathematical Statistics}, 34874 year = {1951}, 34875 volume = {22}, 34876 pages = {400--407} 34877} 34878 34879@Article{ robinson:analysis, 34880 author = {S. M. Robinson}, 34881 title = {Analysis of Sample-Path Optimization}, 34882 journal = {Mathematics of Operations Research}, 34883 year = {1996}, 34884 volume = {21}, 34885 pages = {513--528} 34886} 34887 34888@InCollection{ robinson:bundle-based, 34889 author = {S. M. Robinson}, 34890 title = {Bundle-Based Decomposition: Conditions for Convergence}, 34891 booktitle = {Analyse Non Lin\'{e}aire}, 34892 year = {1989}, 34893 editor = {H. Attouch and J. P. Aubin and F. Clarke and I. Ekeland}, 34894 publisher = {Gauthier-Villaars}, 34895 address = {Paris}, 34896 pages = {435--447} 34897} 34898 34899@InCollection{ robinson:bundle-based*1, 34900 author = {S. M. Robinson}, 34901 title = {Bundle-Based Decomposition: Description and Preliminary Results}, 34902 booktitle = {System Modeling and Optimization}, 34903 year = {1986}, 34904 editor = {A Pr\'{e}kopa and J. Szelezc\'{a}n and B. Straazicky}, 34905 publisher = {Springer-Verlag}, 34906 address = {Berlin}, 34907 pages = {751--756}, 34908 volume = {84}, 34909 series = {Lecture Notes in Control and Information Sciences} 34910} 34911 34912@Article{ robinson:continuity, 34913 author = {S. M. Robinson}, 34914 title = {Some Continuity Properties of Polyhedral Multifunctions}, 34915 journal = {Mathematical Programming Study}, 34916 year = {1981}, 34917 volume = {14}, 34918 pages = {206--214} 34919} 34920 34921@Article{ robinson:extension, 34922 author = {S. M. Robinson}, 34923 title = {Extension of {N}ewton's Method to Nonlinear Functions with Values in a Cone}, 34924 journal = {Numerische Mathematik}, 34925 year = {1972}, 34926 volume = {19}, 34927 pages = {341--347} 34928} 34929 34930@InCollection{ robinson:generalized, 34931 crossref = {bachem.grotschel.ea:mathematical}, 34932 author = {S. M. Robinson}, 34933 title = {Generalized Equations}, 34934 pages = {346--367} 34935} 34936 34937@Article{ robinson:generalized*1, 34938 author = {S. M. Robinson}, 34939 title = {Generalized Equations and their Solution: {P}art {I}: Basic Theory}, 34940 journal = {Mathematical Programming Study}, 34941 year = {1979}, 34942 volume = {10}, 34943 pages = {128--141} 34944} 34945 34946@InCollection{ robinson:homeomorphism, 34947 author = {S. M. Robinson}, 34948 title = {Homeomorphism Conditions for Normal Maps of Polyhedra}, 34949 booktitle = {Optimization and Nonlinear Analysis}, 34950 year = {1992}, 34951 editor = {A. Ioffe and M. Marcus and S. Reich}, 34952 publisher = {Longman}, 34953 address = {Harlow, Essex, England}, 34954 pages = {240--248}, 34955 series = {Pitman Research Notes in Mathematics Series No. 244} 34956} 34957 34958@Article{ robinson:implicit-function, 34959 author = {S. M. Robinson}, 34960 title = {An Implicit--Function Theorem for a Class of Nonsmooth Functions}, 34961 journal = {Mathematics of Operations Research}, 34962 year = {1991}, 34963 volume = {16}, 34964 pages = {292--309} 34965} 34966 34967@Article{ robinson:local*1, 34968 author = {S. M. Robinson}, 34969 title = {Local Epi--Continuity and Local Optimization}, 34970 journal = {Mathematical Programming}, 34971 year = {1987}, 34972 volume = {37}, 34973 pages = {208--222} 34974} 34975 34976@Article{ robinson:local*2, 34977 author = {S. M. Robinson}, 34978 title = {Local Structure of Feasible Sets in Nonlinear Programming, {P}art~{II}: 34979 Nondegeneracy}, 34980 journal = {Mathematical Programming Study}, 34981 year = {1984}, 34982 volume = {22}, 34983 pages = {217--230} 34984} 34985 34986@Article{ robinson:local*3, 34987 author = {S. M. Robinson}, 34988 title = {Local Structure of Feasible Sets in Nonlinear Programming, {P}art~{III}: 34989 Stability and Sensitivity}, 34990 journal = {Mathematical Programming Study}, 34991 year = {1987}, 34992 volume = {30}, 34993 pages = {45--66} 34994} 34995 34996@Article{ robinson:mathematical, 34997 author = {S. M. Robinson}, 34998 title = {Mathematical Foundations of Nonsmooth Embedding Methods}, 34999 journal = {Mathematical Programming}, 35000 year = {1990}, 35001 volume = {48}, 35002 pages = {221--229} 35003} 35004 35005@Article{ robinson:newtons, 35006 author = {S. M. Robinson}, 35007 title = {{N}ewton's Method for a Class of Nonsmooth Functions}, 35008 journal = {Set Valued Analysis}, 35009 year = {1994}, 35010 volume = {2}, 35011 pages = {291--305} 35012} 35013 35014@Article{ robinson:nonsingularity, 35015 author = {S. M. Robinson}, 35016 title = {Nonsingularity and Symmetry for Linear Normal Maps}, 35017 journal = {Mathematical Programming}, 35018 year = {1993}, 35019 volume = {62}, 35020 pages = {415--425} 35021} 35022 35023@InCollection{ robinson:nonsmooth, 35024 author = {S. M. Robinson}, 35025 title = {Nonsmooth Continuation for Generalized Equations}, 35026 year = {1997}, 35027 pages = {282--291}, 35028 editors = {P. Gritzmann and R. Horst and E. Sachs and R. Tichatschke}, 35029 booktitle = {Recent Advances in Optimization}, 35030 series = {Lecture Notes in Economics and Mathematical Systems}, 35031 volume = {452}, 35032 publisher = {Springer-Verlag}, 35033 address = {Heidelberg} 35034} 35035 35036@Article{ robinson:normal, 35037 author = {S. M. Robinson}, 35038 title = {Normal Maps Induced by Linear Transformations}, 35039 journal = {Mathematics of Operations Research}, 35040 year = {1992}, 35041 volume = {17}, 35042 pages = {691--714} 35043} 35044 35045@Article{ robinson:normed, 35046 author = {S. M. Robinson}, 35047 title = {Normed Convex Processes}, 35048 journal = {Transactions of the American Mathematical Society}, 35049 year = {1972}, 35050 volume = {174}, 35051 pages = {127--140} 35052} 35053 35054@Article{ robinson:reduction, 35055 author = {S. M. Robinson}, 35056 title = {A reduction method for variational inequalities}, 35057 journal = {Mathematical Programming}, 35058 year = {1998}, 35059 volume = {80}, 35060 pages = {161--169} 35061} 35062 35063@Article{ robinson:regularity, 35064 author = {S. M. Robinson}, 35065 title = {Regularity and stability for convex multivalued functions}, 35066 journal = {Mathematics of Operations Research}, 35067 year = {1976}, 35068 volume = {1}, 35069 pages = {130--143} 35070} 35071 35072@Unpublished{ robinson:shadow, 35073 author = {S. M. Robinson}, 35074 title = {Shadow {JUNK} for biblio file}, 35075 year = {1800} 35076} 35077 35078@Article{ robinson:shadow*1, 35079 author = {S. M. Robinson}, 35080 title = {Shadow Prices for Measures of Effectiveness {I}: Linear Model}, 35081 journal = {Operations Research}, 35082 year = {1993}, 35083 volume = {41}, 35084 pages = {518--535} 35085} 35086 35087@Article{ robinson:shadow*2, 35088 author = {S. M. Robinson}, 35089 title = {Shadow Prices for Measures of Effectiveness {II}: General Model}, 35090 journal = {Operations Research}, 35091 year = {1993}, 35092 volume = {41}, 35093 pages = {536--548} 35094} 35095 35096@Unpublished{ robinson:stability, 35097 author = {S. M. Robinson}, 35098 title = {Stability {JUNK} for biblio file}, 35099 year = {1800} 35100} 35101 35102@Article{ robinson:stability*1, 35103 author = {S. M. Robinson}, 35104 title = {Stability theory for systems of inequalities, {P}art {I}: linear systems}, 35105 journal = {SIAM Journal on Numerical Analysis}, 35106 year = {1975}, 35107 volume = {12}, 35108 pages = {754--769} 35109} 35110 35111@Article{ robinson:stability*2, 35112 author = {S. M. Robinson}, 35113 title = {Stability theory for systems of inequalities, {P}art {II}: Differentiable 35114 Nonlinear Systems}, 35115 journal = {SIAM Journal on Numerical Analysis}, 35116 year = {1976}, 35117 volume = {13}, 35118 pages = {497--513} 35119} 35120 35121@Article{ robinson:strongly, 35122 author = {S. M. Robinson}, 35123 title = {Strongly Regular Generalized Equations}, 35124 journal = {Mathematics of Operations Research}, 35125 year = {1980}, 35126 volume = {5}, 35127 pages = {43--62} 35128} 35129 35130@Article{ rockafellar.wets:generalized, 35131 author = {R. T. Rockafellar and R. J.--B. Wets}, 35132 title = {Generalized Linear-Quadratic Problems of Deterministic and Stochastic Optimal 35133 Control in Discrete Time}, 35134 journal = {SIAM Journal on Control and Optimization}, 35135 year = {1990}, 35136 volume = {28}, 35137 pages = {810--822} 35138} 35139 35140@Article{ rockafellar.wets:lagrangian, 35141 author = {R. T. Rockafellar and R. J.--B. Wets}, 35142 title = {A {L}agrangian Finite Generation Technique for Solving Linear-Quadratic Problems 35143 in Stochastic Programming}, 35144 journal = {Mathematical Programming Study}, 35145 year = {1986}, 35146 volume = {28}, 35147 pages = {63--93} 35148} 35149 35150@InCollection{ rockafellar.wets:linear-quadratic, 35151 author = {R. T. Rockafellar and R. J.--B. Wets}, 35152 title = {Linear-Quadratic Programming Problems with Stochastic Penalties: the Finite 35153 Generation Algorithm}, 35154 booktitle = {Stochastic Optimization}, 35155 publisher = {Springer-Verlag}, 35156 year = {1987}, 35157 editor = {V. I. Arkin and A. Shiraer and R. J.--B. Wets}, 35158 series = {Lecture Notes in Control and Information Sciences, IIASA Series No. 81}, 35159 pages = {545--560}, 35160 address = {New York, Berlin} 35161} 35162 35163@Article{ rockafellar.wets:scenarios, 35164 author = {R. T. Rockafellar and R. J.--B. Wets}, 35165 title = {Scenarios and Policy Aggregation in Optimization under Uncertainty}, 35166 journal = {Mathematics of Operations Research}, 35167 year = {1991}, 35168 volume = {10}, 35169 pages = {119--147} 35170} 35171 35172@InProceedings{ rockafellar:applications, 35173 author = {R. T. Rockafellar}, 35174 title = {New Applications of Duality in Convex Programming}, 35175 booktitle = {Proceedings of the Fourth Conference on Probability}, 35176 year = {1971}, 35177 address = {Brasov, Romania} 35178} 35179 35180@Article{ rockafellar:augmented, 35181 author = {R. T. Rockafellar}, 35182 title = {Augmented {L}agrange Multiplier Functions and Duality in Nonconvex Programming}, 35183 journal = {SIAM Journal on Control and Optimization}, 35184 year = {1974}, 35185 volume = {12}, 35186 pages = {268--285} 35187} 35188 35189@Article{ rockafellar:augmented*1, 35190 author = {R. T. Rockafellar}, 35191 title = {Augmented {L}agrangians and Applications of the Proximal Point Algorithm in 35192 Convex Programming}, 35193 journal = {Mathematics of Operations Research}, 35194 year = {1976}, 35195 volume = {1}, 35196 pages = {97--116} 35197} 35198 35199@Article{ rockafellar:characterization, 35200 author = {R. T. Rockafellar}, 35201 title = {Characterization of the subdifferentials of convex functions}, 35202 journal = {Pacific Journal of Mathematics}, 35203 year = {1966}, 35204 volume = {17}, 35205 number = {3}, 35206 pages = {497--510} 35207} 35208 35209@Article{ rockafellar:computational, 35210 author = {R. T. Rockafellar}, 35211 title = {Computational Schemes for Large--Scale Problems in Extended Linear--Quadratic 35212 Programming}, 35213 journal = {Mathematical Programming}, 35214 year = {1990}, 35215 volume = {48}, 35216 pages = {447--474} 35217} 35218 35219@Book{ rockafellar:conjugate, 35220 author = {R. T. Rockafellar}, 35221 title = {Conjugate Duality and Optimization}, 35222 year = {1974}, 35223 publisher = {SIAM}, 35224 address = {Philadelphia, Pennsylvania}, 35225 volume = {16}, 35226 series = {Conference Board of the Mathematical Sciences} 35227} 35228 35229@Book{ rockafellar:convex, 35230 author = {R. T. Rockafellar}, 35231 title = {Convex Analysis}, 35232 year = {1970}, 35233 publisher = {Princeton University Press}, 35234 address = {Princeton, New Jersey} 35235} 35236 35237@Article{ rockafellar:first-, 35238 author = {R. T. Rockafellar}, 35239 title = {First-- and Second--Order Epi--Differentiabilty in Nonlinear Programming}, 35240 journal = {Transactions of the American Mathematical Society}, 35241 year = {1988}, 35242 volume = {307}, 35243 pages = {75--108} 35244} 35245 35246@InProceedings{ rockafellar:generalized, 35247 author = {R. T. Rockafellar}, 35248 title = {A Generalized Approach to Linear-Quadratic Programming}, 35249 booktitle = {Proceedings of the International Conference on Numerical Optimization and 35250 Applications}, 35251 year = {1986}, 35252 pages = {58--66}, 35253 note = {(Xi'an, China)} 35254} 35255 35256@InProceedings{ rockafellar:generalized*1, 35257 crossref = {bachem.grotschel.ea:mathematical}, 35258 author = {R. T. Rockafellar}, 35259 title = {Generalized Subgradients in Mathematical Programming}, 35260 pages = {368--390} 35261} 35262 35263@InCollection{ rockafellar:large-scale, 35264 author = {R. T. Rockafellar}, 35265 title = {Large-Scale Extended Linear-Quadratic Programming and Multistage Optimization}, 35266 booktitle = {Advances in Numerical Partial Differential Equations and Optimization}, 35267 chapter = {15}, 35268 year = {1991}, 35269 editor = {S. Gomez and J. P. Hennart and R. A. Tapia}, 35270 publisher = {SIAM Publications}, 35271 pages = {247--261} 35272} 35273 35274@Article{ rockafellar:linear-quadratic, 35275 author = {R. T. Rockafellar}, 35276 title = {Linear-Quadratic Programming and Optimal Control}, 35277 journal = {SIAM Journal on Control and Optimization}, 35278 year = {1987}, 35279 volume = {25}, 35280 pages = {781--814} 35281} 35282 35283@Article{ rockafellar:maximality, 35284 author = {R. T. Rockafellar}, 35285 title = {On the Maximality of Sums of Nonlinear Monotone Operators}, 35286 journal = {Transactions of the American Mathematical Society}, 35287 year = {1970}, 35288 volume = {149}, 35289 pages = {75--88} 35290} 35291 35292@InCollection{ rockafellar:monotone, 35293 author = {R. T. Rockafellar}, 35294 title = {Monotone Operators and Augmented {L}agrangian Methods in Nonlinear Programming}, 35295 crossref = {mangasarian.meyer.ea:nonlinear*3}, 35296 pages = {1--26} 35297} 35298 35299@Article{ rockafellar:monotone*1, 35300 author = {R. T. Rockafellar}, 35301 title = {Monotone Operators and the Proximal Point Algorithm}, 35302 journal = {SIAM Journal on Control and Optimization}, 35303 year = {1976}, 35304 volume = {14}, 35305 pages = {877--898} 35306} 35307 35308@Article{ rockafellar:multiplier, 35309 author = {R. T. Rockafellar}, 35310 title = {The Multiplier Method of {H}estenes and {P}owell Applied to Convex Programming}, 35311 journal = {Journal of Optimization Theory and Applications}, 35312 year = {1973}, 35313 volume = {12}, 35314 pages = {555--562} 35315} 35316 35317@Article{ rockafellar:multistage, 35318 author = {R. T. Rockafellar}, 35319 title = {Multistage Convex Programming and Discrete-Time Optimal Control}, 35320 journal = {Control and Cybernetics}, 35321 year = {1988}, 35322 volume = {17}, 35323 number = {2-3}, 35324 pages = {225--245} 35325} 35326 35327@Book{ rockafellar:network, 35328 author = {R. T. Rockafellar}, 35329 title = {Network Flows and Monotropic Optimization}, 35330 publisher = {John Wiley}, 35331 year = {1984}, 35332 address = {New York} 35333} 35334 35335@Article{ rodrigues:mixed, 35336 author = {H. C. Rodrigues}, 35337 title = {A mixed variational formulation for shape optimization of solids with contact 35338 conditions}, 35339 journal = {Structural Optimization}, 35340 volume = {6}, 35341 year = {1993}, 35342 pages = {19--28} 35343} 35344 35345@Book{ rodrigues:obstacle, 35346 author = {J. F. Rodrigues}, 35347 title = {Obstacle Problems in Mathematical Physics}, 35348 publisher = {Elsevier Publishing Company}, 35349 address = {Amsterdam}, 35350 year = {1987} 35351} 35352 35353@Book{ roos.terlaky.ea:theory, 35354 author = {C. Roos and T. Terlaky and J.--Ph. Vial}, 35355 title = {Theory and Algorithms for Linear Optimization: An Interior-Point Approach}, 35356 publisher = {John Wiley \& Sons}, 35357 year = {1997}, 35358 address = {Chichester} 35359} 35360 35361@TechReport{ rosa:decomposition, 35362 author = {C. H. Rosa}, 35363 title = {A Decomposition Technique for Equilibrium Programming under Uncertainty}, 35364 institution = {IIASA}, 35365 year = {1996}, 35366 number = {WP-96-013}, 35367 address = {A-2361 Laxenburg, Austria} 35368} 35369 35370@Article{ rosen.lane.ea:treatment, 35371 author = {I. Rosen and R. Lane and S. Morrill and J. Belli}, 35372 title = {Treatment Plan Optimization Using Linear Programming}, 35373 journal = {Medical Physics}, 35374 year = {1990}, 35375 volume = {18}, 35376 number = {2}, 35377 pages = {141--152} 35378} 35379 35380@TechReport{ rosenblatt:perceptron-a, 35381 author = {F. Rosenblatt}, 35382 title = {The perceptron--a perceiving and recognizing automaton}, 35383 institution = {Cornell Aeronautical Laboratory}, 35384 year = {1957}, 35385 month = jan, 35386 address = {Ithaca, New York}, 35387 number = {85-460-1} 35388} 35389 35390@Book{ rosenblatt:principles, 35391 author = {F. Rosenblatt}, 35392 title = {Principles of Neurodynamics}, 35393 year = {1962}, 35394 publisher = {Spartan Books}, 35395 address = {New York} 35396} 35397 35398@InProceedings{ rosenblatt:two, 35399 author = {F. Rosenblatt}, 35400 title = {Two theorems of statistical separability in the perceptron}, 35401 booktitle = {Proceedings of Symposium Held at National Physical Laboratory, November 1958}, 35402 year = {1959}, 35403 publisher = {{HMS} Stationery Office}, 35404 address = {London}, 35405 volume = {1} 35406} 35407 35408@Article{ rosenbrock:automatic, 35409 author = {H. H. Rosenbrock}, 35410 title = {Automatic Method for Finding the Greatest or Least Value of a Function}, 35411 journal = {Computer Journal}, 35412 year = {1960}, 35413 volume = {3}, 35414 pages = {175--184} 35415} 35416 35417@Article{ roy.mukhopadhyay:pattern, 35418 author = {A. Roy and S. Mukhopadhyay}, 35419 title = {Pattern Classification Using Linear Programming}, 35420 journal = {ORSA Journal on Computing}, 35421 year = {1990}, 35422 volume = {3}, 35423 pages = {66--80} 35424} 35425 35426@Book{ rubinstein:monte, 35427 author = {R. Rubinstein}, 35428 title = {Monte Carlo Optimization, Simulation, and Sensitivity Analysis of Queueing 35429 Networks}, 35430 publisher = {Wiley}, 35431 address = {New York, NY}, 35432 year = {1986} 35433} 35434 35435@Article{ ruchala.olivera.ea:comparison, 35436 author = {K. J. Ruchala and G. H. Olivera and T. R. Mackie}, 35437 title = {A Comparison of Maximum-Likelihood and Iterative Filtered Backprojection 35438 Reconstruction Algorithms for Megavoltage {CT} on a Tomotherapy System}, 35439 journal = {Physics in Medicine and Biology, forthcoming}, 35440 year = {1999} 35441} 35442 35443@Book{ rudin:principles, 35444 author = {W. Rudin}, 35445 title = {Principles of Mathematical Analysis}, 35446 year = {1976}, 35447 publisher = {McGraw--Hill}, 35448 address = {Tokyo, Japan}, 35449 edition = {Third} 35450} 35451 35452@Book{ rudin:real, 35453 author = {W. Rudin}, 35454 title = {Real and Complex Analysis}, 35455 year = {1974}, 35456 publisher = {McGraw--Hill}, 35457 address = {Tokyo, Japan}, 35458 edition = {Second} 35459} 35460 35461@InProceedings{ rumelhart.hinton.ea:learning, 35462 author = {D. E. Rumelhart and G. E. Hinton and R. J. Williams}, 35463 title = {Learning Internal Representations by Error Propagation}, 35464 booktitle = {Parallel Distributed Processing}, 35465 year = {1986}, 35466 editor = {D. E. Rumelhart and J. L. McClelland}, 35467 publisher = {MIT Press}, 35468 address = {Cambridge, Massachusetts}, 35469 pages = {318--362} 35470} 35471 35472@Book{ rumelhart.mcclelland:parallel, 35473 author = {D. E. Rumelhart and J. L. McClelland}, 35474 title = {Parallel Distributed Processing}, 35475 year = {1986}, 35476 publisher = {MIT Press}, 35477 address = {Cambridge, Massachusetts} 35478} 35479 35480@InCollection{ ruszczynski:regularized, 35481 author = {A. Ruszczynski}, 35482 title = {On the Regularized Decomposition for Stochastic Programming Problems}, 35483 year = {1995}, 35484 booktitle = {Stochastic Programming: Numerical Techniques and Engineering Applications}, 35485 editor = {K. Marti and P. Kall}, 35486 publisher = {Springer-Verlag}, 35487 address = {Berlin}, 35488 volume = {425}, 35489 series = {Lecture Notes in Control and Information Sciences}, 35490 pages = {93--108} 35491} 35492 35493@Article{ rutherford.rutstrom.ea:lacord, 35494 author = {T. F. Rutherford and E. E. Rutstrom and D. Tarr}, 35495 title = {{L}'accord de libre-echange entre le {M}aroc et la {CE}: une evaluation 35496 quantitative}, 35497 journal = {Revue d' Economie du developpement}, 35498 year = {1994} 35499} 35500 35501@InCollection{ rutherford.tarr:blueprints, 35502 author = {T. Rutherford and D. Tarr}, 35503 title = {Blueprints, Spillovers and the Dynamic Gains from Trade Liberalization in a Small 35504 Open Economy}, 35505 booktitle = {Dynamic Issues in Applied Commercial Policy Analysis}, 35506 publisher = {Cambridge University Press}, 35507 year = {1997}, 35508 editor = {R. Baldwin and J. Francois}, 35509 address = {New York} 35510} 35511 35512@Article{ rutherford:applied, 35513 author = {T. F. Rutherford}, 35514 title = {Applied General Equilibrium Modeling with {MPSGE} as a {GAMS} Subsystem: An 35515 Overview of the Modeling Framework and Syntax}, 35516 year = {1999}, 35517 volume = {14}, 35518 pages = {1--46}, 35519 journal = {Computational Economics} 35520} 35521 35522@PhDThesis{ rutherford:applied*1, 35523 author = {T. F. Rutherford}, 35524 title = {Applied General Equilibrium Modeling}, 35525 school = {Stanford University}, 35526 year = {1987} 35527} 35528 35529@Article{ rutherford:extensions, 35530 author = {T. F. Rutherford}, 35531 title = {Extensions of {GAMS} for Complementarity Problems Arising in Applied Economic 35532 Analysis}, 35533 journal = {Journal of Economic Dynamics and Control}, 35534 volume = {19}, 35535 pages = {1299--1324}, 35536 year = {1995} 35537} 35538 35539@Misc{ rutherford:gnuplot, 35540 author = {T. F. Rutherford}, 35541 title = {A Libinclude Interface to Gnuplot from {GAMS}}, 35542 organization = {Department of Economics, University of Colorado}, 35543 address = {Boulder, Colorado}, 35544 note = {http://robles.colorado.edu/~tomruth/gnuplot/gnuplot.htm} 35545} 35546 35547@Unpublished{ rutherford:miles, 35548 author = {T. F. Rutherford}, 35549 title = {{MILES}: {A} Mixed Inequality and nonLinear Equation Solver}, 35550 year = {1993}, 35551 note = {Working Paper, Department of Economics, University of Colorado, Boulder} 35552} 35553 35554@TechReport{ rutherford:modeling, 35555 author = {T. F. Rutherford}, 35556 title = {A Modeling System for Applied General Equilibrium Analysis}, 35557 type = {Cowles Foundation Discussion Paper}, 35558 number = {836}, 35559 institution = {Yale University}, 35560 year = {1987} 35561} 35562 35563@TechReport{ rutherford:mpsge, 35564 author = {T. F. Rutherford}, 35565 title = {{MPSGE}}, 35566 institution = {University of Western Ontario}, 35567 year = {1988}, 35568 address = {London, Ontario} 35569} 35570 35571@Article{ rykov:simplex, 35572 author = {A. S. Rykov}, 35573 title = {Simplex Direct Search Algorithms}, 35574 journal = {Automation and Remote Control}, 35575 year = {1980}, 35576 volume = {41}, 35577 pages = {784--793} 35578} 35579 35580@Article{ saad.schultz:gmres, 35581 author = {Y. Saad and M. Schultz}, 35582 title = {{GMRES}: {A} Generalized Minimal Residual Algorithm for Solving Nonsymmetric 35583 Linear Systems}, 35584 journal = {SIAM Journal on Scientific and Statistical Computing}, 35585 year = {1986}, 35586 volume = {44}, 35587 pages = {856--869} 35588} 35589 35590@Book{ saad:iterative, 35591 author = {Y. Saad}, 35592 title = {Iterative Methods for Sparse Linear Systems}, 35593 year = {1996}, 35594 publisher = {PWS Publishing Company}, 35595 address = {Boston, Massachusetts} 35596} 35597 35598@Article{ sahni:approximate, 35599 author = {S. Sahni}, 35600 title = {Approximate Algorithms for the 0/1 Knapsack Problem}, 35601 journal = {jacm}, 35602 year = {1975}, 35603 volume = {22}, 35604 pages = {115--124} 35605} 35606 35607@InProceedings{ sauer.shepard.ea:comparison, 35608 author = {O. A. Sauer and D. M. Shepard and L. Angelos and T. R. Mackie}, 35609 title = {A Comparison of Objective Functions for Use in Radiotherapy Optimization}, 35610 booktitle = {Proceedings of the XII International Conference on the Use of Computers in 35611 Radiation Therapy, Salt Lake City}, 35612 year = {1997}, 35613 editor = {D. D. Leavitt and G. Starkshall}, 35614 publisher = {Medical Physics Publishing}, 35615 address = {St. Louis, Missouri} 35616} 35617 35618@Article{ sauer.xu:multivariate, 35619 author = {Th. Sauer and Y. Xu}, 35620 title = {On Multivariate {L}agrange Interpolation}, 35621 journal = {Mathematics of Computation}, 35622 year = {1995}, 35623 volume = {64}, 35624 pages = {1147--1170} 35625} 35626 35627@Article{ savelsbergh:preprocessing, 35628 author = {M. W. P. Savelsbergh}, 35629 title = {Preprocessing and Probing Techniques for Mixed Integer Programming Problems}, 35630 journal = {ORSA Journal on Computing}, 35631 year = {1994}, 35632 volume = {6}, 35633 pages = {445--454} 35634} 35635 35636@Article{ scarf:approximation, 35637 author = {H. E. Scarf}, 35638 title = {The Approximation of Fixed Points of a Continuous Mapping}, 35639 journal = {SIAM Journal on Applied Mathematics}, 35640 year = {1967}, 35641 volume = {15}, 35642 pages = {1328--1343} 35643} 35644 35645@Book{ scarf:computation, 35646 author = {H. E. Scarf}, 35647 title = {The Computation of Economic Equilibria}, 35648 year = {1973}, 35649 publisher = {Yale University Press}, 35650 address = {New Haven, Connecticut} 35651} 35652 35653@TechReport{ scheel.scholtes:mathematical, 35654 author = {H. Scheel and S. Scholtes}, 35655 title = {Mathematical Programs with Complementarity Constraints: Stationarity, Optimality, 35656 and Sensitivity}, 35657 institution = {Judge Institute of Management Studies, University of Cambridge}, 35658 year = {1998}, 35659 type = {Technical Report}, 35660 address = {Cambridge, England} 35661} 35662 35663@Article{ schlick:modified, 35664 author = {T. Schlick}, 35665 title = {Modified {C}holesky Factorization for Sparse Preconditioners}, 35666 journal = {SIAM Journal on Scientific Computing}, 35667 year = {1993}, 35668 volume = {14}, 35669 pages = {424--445} 35670} 35671 35672@Article{ schnabel.eskow:modified, 35673 author = {R. B. Schnabel and E. Eskow}, 35674 title = {A New Modified {C}holesky Factorization}, 35675 journal = {SIAM Journal on Scientific and Statistical Computing}, 35676 year = {1991}, 35677 volume = {11}, 35678 pages = {1136--1158} 35679} 35680 35681@Article{ schneider.zenios:comparative, 35682 author = {M. H. Schneider and S. A. Zenios}, 35683 title = {A Comparative Study of Algorithms for Matrix Balancing}, 35684 journal = {Operations Research}, 35685 year = {1990}, 35686 volume = {38}, 35687 pages = {439--455} 35688} 35689 35690@Book{ scholkopf.burges.ea:advances, 35691 editor = {B. {Sch\"{o}lkopf} and C. Burges and A. Smola}, 35692 title = {Advances in Kernel Methods: Support Vector Machines}, 35693 publisher = {MIT Press}, 35694 address = {Cambridge, MA }, 35695 year = {1998}, 35696 isbn = {0-262-19416-3} 35697} 35698 35699@Article{ scholtes.stohr:exact, 35700 author = {S. Scholtes and M. St{\"{o}}hr}, 35701 title = {Exact Penalization of Mathematical Programs with Equilibrium Constraints}, 35702 journal = {SIAM Journal on Control and Optimization}, 35703 volume = {37}, 35704 pages = {617--652}, 35705 year = {1999} 35706} 35707 35708@TechReport{ scholtes:introduction, 35709 author = {S. Scholtes}, 35710 title = {Introduction to piecewise differentiable equations}, 35711 institution = {Institut f{\"{u}}r Statistik und Mathematische Wirtschaftstheorie, 35712 Universit{\"{a}}t Karlsruhe}, 35713 year = {1994}, 35714 type = {Preprint}, 35715 number = {No. 53/1994}, 35716 address = {Karlsruhe, Germany} 35717} 35718 35719@Article{ schramm.zowe:version, 35720 author = {H. Schramm and J. Zowe}, 35721 title = {A Version of the Bundle Idea for Minimizing a Nonsmooth Function: Conceptual 35722 Idea, Convergence Analysis, Numerical Results}, 35723 journal = {SIAM Journal on Optimization}, 35724 year = {1992}, 35725 volume = {2}, 35726 pages = {121--152} 35727} 35728 35729@Article{ schultz.meyer:interior, 35730 author = {G. L. Schultz and R. R. Meyer}, 35731 title = {An Interior Point Method for Block Angular Optimization}, 35732 journal = {SIAM Journal on Optimization}, 35733 year = {1991}, 35734 volume = {1}, 35735 pages = {583--602} 35736} 35737 35738@InProceedings{ sekiguchi.sato.ea:ninf, 35739 author = {S. Sekiguchi and M. Sato and S. Matsuoka and U. Nagashima}, 35740 title = {Ninf: Network based Information Library for Globally High Performance Computing}, 35741 booktitle = {Proceedings of the Parallel Object-Oriented Methods and Applications ({POOMA})}, 35742 year = {1996}, 35743 address = {Santa Fe} 35744} 35745 35746@InCollection{ sellami.robinson:homotopies, 35747 author = {H. Sellami and S. M. Robinson}, 35748 title = {Homotopies Based on Nonsmooth Equations for Solving Nonlinear Variational 35749 Inequalities}, 35750 booktitle = {Nonlinear Optimization and Applications}, 35751 editor = {G. Di Pillo and F. Giannessi}, 35752 year = {1996}, 35753 pages = {327--343}, 35754 publisher = {Plenum Press}, 35755 address = {New York} 35756} 35757 35758@Article{ sellami.robinson:implementation, 35759 author = {H. Sellami and S. M. Robinson}, 35760 title = {Implementation of a Continuation Method for Normal Maps}, 35761 journal = {Mathematical Programming}, 35762 year = {1997}, 35763 volume = {76}, 35764 pages = {563--578} 35765} 35766 35767@PhDThesis{ sellami:continuation, 35768 author = {H. Sellami}, 35769 title = {A Continuation Method for Normal Maps}, 35770 school = {University of Wisconsin -- Madison}, 35771 year = {1994}, 35772 address = {Madison, Wisconsin} 35773} 35774 35775@Article{ sellami:homotopy, 35776 author = {H. Sellami}, 35777 title = {A Homotopy Continuation Method for Normal Maps}, 35778 journal = {Mathematical Programming}, 35779 vol = {82}, 35780 year = {1998}, 35781 pages = {317--337} 35782} 35783 35784@Book{ seuss:one, 35785 author = {{Dr.} A. Seuss}, 35786 title = {One Fish, Two Fish, Red Fish, Blue Fish}, 35787 year = {1960}, 35788 publisher = {Beginner Books}, 35789 address = {New York}, 35790 series = {Beginner Books, B13}, 35791 note = {A story--poem about the activities of such unusual animals as the Nook, Wump, 35792 Yink, Yop, Gack, and the Zeds} 35793} 35794 35795@Article{ seyfferth.pfeiffer:dynamics, 35796 author = {W. Seyfferth and F. Pfeiffer}, 35797 title = {Dynamics of Assembly Processes With a Manipulator}, 35798 journal = {Proceedings of the 1992 IEEE/RSJ International Conference on Intelligent Robots 35799 and Systems}, 35800 year = {1992}, 35801 pages = {1303--1310} 35802} 35803 35804@Article{ shanno.simantiraki:infeasible, 35805 author = {D. Shanno and E. Simantiraki}, 35806 title = {An Infeasible Interior--Point Method for Linear Complementarity Problems}, 35807 year = {1997}, 35808 journal = {SIAM Journal on Optimization}, 35809 volume = {7}, 35810 pages = {620--640} 35811} 35812 35813@InProceedings{ shanno.simantiraki:interior, 35814 author = {D. Shanno and E. Simantiraki}, 35815 title = {Interior Point Methods for Linear and Nonlinear Programming}, 35816 booktitle = {State of the Art in Numerical Analysis}, 35817 year = {1997}, 35818 editor = {I. S. Duff and G. A. Watson}, 35819 publisher = {Oxford University Press}, 35820 address = {Oxford} 35821} 35822 35823@Article{ shannon:introduction, 35824 author = {R. E. Shannon}, 35825 title = {Introduction to the Art and Science of simulation}, 35826 journal = {WSC98 1998 Winter simulation conference proceedings}, 35827 year = {1998}, 35828 volume = {1}, 35829 pages = {7--14} 35830} 35831 35832@TechReport{ shapiro:concepts, 35833 author = {A. Shapiro}, 35834 title = {On Concepts of Directional Differentiability}, 35835 institution = {Department of Mathematics and Applied Mathematics, University of South Africa}, 35836 year = {1988}, 35837 address = {Pretoria, South Africa}, 35838 number = {73/88(18)}, 35839 type = {Research Report} 35840} 35841 35842@Book{ shavlik.editors:readings, 35843 author = {J. W. Shavlik and T. G. Dietterich {(editors)}}, 35844 title = {Readings in Machine Learning}, 35845 year = {1990}, 35846 publisher = {Morgan Kaufman}, 35847 address = {San Mateo, California} 35848} 35849 35850@Article{ shavlik.mooney.ea:symbolic, 35851 author = {J. W. Shavlik and R. J. Mooney and G. G. Towell}, 35852 title = {Symbolic and Neural Network Learning Algorithms: An Experimental Comparison}, 35853 journal = {Machine Learning}, 35854 year = {1991}, 35855 volume = {6}, 35856 pages = {111--143} 35857} 35858 35859@Book{ sheffi:urban, 35860 author = {Y. Sheffi}, 35861 title = {Urban Transportation Networks}, 35862 publisher = {Prentice-Hall, Inc}, 35863 year = {1985}, 35864 address = {Englewood Cliffs, New Jersey} 35865} 35866 35867@Article{ sheng.potra:quadratically, 35868 author = {R. Sheng and F. A. Potra}, 35869 title = {A Quadratically {CO}nvergent Infeasible-Interior-Point {AL}gorithm for {LCP} with 35870 Polynomial {CO}mplexity}, 35871 journal = {SIAM Journal on Optimization}, 35872 year = {1997}, 35873 volume = {7}, 35874 pages = {304--317} 35875} 35876 35877@InProceedings{ shepard.angelos.ea:simple, 35878 author = {D. M. Shepard and L. Angelos and O. A. Sauer and T. R. Mackie}, 35879 title = {A Simple Model for Examining Radiotherapy Optimization}, 35880 booktitle = {Proceedings of the XII International Conference on the Use of Computers in 35881 Radiation Therapy, Salt Lake City}, 35882 year = {1997}, 35883 editor = {D. D. Leavitt and G. Starkshall}, 35884 publisher = {Medical Physics Publishing}, 35885 address = {St. Louis, Missouri} 35886} 35887 35888@Article{ shepard.ferris.ea:inverse, 35889 author = {D. M. Shepard and M. C. Ferris and R. Ove and L. Ma}, 35890 title = {Inverse Treatment Planning for Gamma Knife Radiosurgery}, 35891 journal = {Medical Physics}, 35892 volume = {27}, 35893 pages = {12}, 35894 year = {2000}, 35895 key = {93} 35896} 35897 35898@Article{ shepard.ferris.ea:optimizing, 35899 author = {D. M. Shepard and M. C. Ferris and G. Olivera and T. R. Mackie}, 35900 title = {Optimizing the Delivery of Radiation to Cancer Patients}, 35901 journal = {SIAM Review}, 35902 volume = {41}, 35903 pages = {721--744}, 35904 year = {1999}, 35905 url = {ftp://ftp.cs.wisc.edu/math-prog/tech-reports/98-07.ps}, 35906 key = {68}, 35907 institution = {Computer Sciences Department, University of Wisconsin}, 35908 address = {Madison, Wisconsin}, 35909 number = {98-07}, 35910 type = {Mathematical Programming Technical Report} 35911} 35912 35913@Article{ sherali.shetty:finitely, 35914 author = {H. D. Sherali and C. M. Shetty}, 35915 title = {A Finitely Convergent Algorithm for Bilinear Programming Problems using Polar 35916 Cuts and Disjunctive Face Cuts}, 35917 journal = {Mathematical Programming}, 35918 year = {1980}, 35919 volume = {19}, 35920 pages = {14--31} 35921} 35922 35923@Article{ sherali.soyster.ea:stackelberg-nash-cournot, 35924 author = {H. D. Sherali and A. L. Soyster and F. H. Murphy}, 35925 title = {{S}tackelberg--{N}ash--{C}ournot Equilibria: Characterization and Computation}, 35926 journal = {Operations Research}, 35927 year = {1983}, 35928 volume = {31}, 35929 pages = {253--276} 35930} 35931 35932@Article{ shi.olafsson.ea:hybrid, 35933 author = {L. Shi and S. \'{O}lafsson and Q. Chen}, 35934 title = {A New Hybrid Optimization Algorithm}, 35935 journal = {Computers and Industrial Engineering}, 35936 year = {1999}, 35937 volume = {36}, 35938 pages = {409--426} 35939} 35940 35941@PhDThesis{ shiau:iterative, 35942 author = {T.--H. Shiau}, 35943 title = {Iterative Linear Programming for Linear Complementarity and Related Problems}, 35944 school = {Computer Sciences Department, University of Wisconsin}, 35945 year = {1983}, 35946 address = {Madison, Wisconsin}, 35947 note = {Technical Report 507} 35948} 35949 35950@InProceedings{ shor:generalized, 35951 crossref = {bachem.grotschel.ea:mathematical}, 35952 author = {N. Z. Shor}, 35953 title = {Generalized Gradient Methods of Nondifferentiable Optimization Employing Space 35954 Dilation Operations}, 35955 pages = {501--529} 35956} 35957 35958@Book{ shor:minimization, 35959 author = {N. Z. Shor}, 35960 title = {Minimization Methods for Nondifferentiable Functions}, 35961 year = {1985}, 35962 publisher = {Springer-Verlag}, 35963 address = {Berlin} 35964} 35965 35966@Article{ shoven.whalley:applied, 35967 author = {J. Shoven and J. Whalley}, 35968 title = {Applied General Equilibrium Models of Taxation and International Trade: 35969 Introduction and Survey}, 35970 journal = {Journal of Economic Literature}, 35971 year = {1984}, 35972 volume = {22}, 35973 pages = {1007--1051} 35974} 35975 35976@Article{ shultz.meyer:interior, 35977 author = {G. L. Shultz and R. R. Meyer}, 35978 title = {An Interior Point Method for Block Angular Optimization}, 35979 journal = {SIAM Journal on Optimization}, 35980 year = {1991}, 35981 volume = {1}, 35982 pages = {583--602} 35983} 35984 35985@Article{ shultz.schnabel.ea:family, 35986 author = {G. A. Shultz and R. B. Schnabel and R. H. Byrd}, 35987 title = {A Family of Trust--Region--Based Algorithms for Unconstrained Minimization}, 35988 journal = {SIAM Journal on Numerical Analysis}, 35989 year = {1985}, 35990 volume = {22}, 35991 pages = {44--67} 35992} 35993 35994@Article{ sibony:methodes, 35995 author = {M. Sibony}, 35996 title = {Methodes iteratives pur les equations et inequations aux derives partielles 35997 nonlineaires de type monotone}, 35998 journal = {Calcolo}, 35999 year = {1970}, 36000 volume = {7}, 36001 pages = {65--183} 36002} 36003 36004@Article{ sidney:optimal, 36005 author = {J. B. Sidney}, 36006 title = {Optimal Single--Machine Scheduling with Earliness and Tardiness Penalties}, 36007 journal = {Operations Research}, 36008 year = {1977}, 36009 volume = {25}, 36010 pages = {62--69} 36011} 36012 36013@Book{ siegel:corba, 36014 author = {J. Siegel}, 36015 title = {{CORBA} - Fundamentals and Programming}, 36016 publisher = {John Wiley \& Sons}, 36017 year = {1996}, 36018 address = {New York, New York} 36019} 36020 36021@TechReport{ simantiraki.shanno:infeasible-interior-point, 36022 author = {E. Simantiraki and D. F. Shanno}, 36023 title = {An infeasible-interior-point algorithm for linear complementarity problems}, 36024 type = {Research Report}, 36025 number = {7-95}, 36026 institution = {Rutgers Center for Operations Research, Rutgers University}, 36027 address = {New Brunswick, New Jersey}, 36028 year = {1995} 36029} 36030 36031@InProceedings{ simantiraki.shanno:infeasible-interior-point*1, 36032 author = {E. Simantiraki and D. F. Shanno}, 36033 title = {An Infeasible-Interior-Point Algorithm for Solving Mixed Complementarity 36034 Problems}, 36035 crossref = {ferris.pang:complementarity}, 36036 pages = {386--404} 36037} 36038 36039@Book{ simpson:artificial, 36040 author = {P. K. Simpson}, 36041 title = {Artificial Neural Systems}, 36042 year = {1990}, 36043 publisher = {Pergamon Press}, 36044 address = {New York} 36045} 36046 36047@Article{ smeers:computable, 36048 author = {Y. Smeers}, 36049 title = {Computable Equilibrium Models and the Restructuring of the {E}uropean Electricity 36050 and Gas Markets}, 36051 journal = {The Energy Journal}, 36052 year = {1997}, 36053 optkey = {}, 36054 optvolume = {18}, 36055 optnumber = {}, 36056 optmonth = {}, 36057 optpages = {1--32}, 36058 optnote = {}, 36059 optannote = {} 36060} 36061 36062@Article{ smith:design, 36063 author = {F. W. Smith}, 36064 title = {Design of Multicategory Pattern Classifiers with Two-Category Classifier Design 36065 Procedures}, 36066 journal = {IEEE Transactions on Computers}, 36067 year = {1969}, 36068 volume = {18}, 36069 pages = {367--372} 36070} 36071 36072@Article{ smith:existence, 36073 author = {M. J. Smith}, 36074 title = {The Existence, Uniqueness and Stability of Traffic Equilibria}, 36075 journal = {Transportation Research}, 36076 year = {1979}, 36077 volume = {13B}, 36078 pages = {295--304} 36079} 36080 36081@Article{ smith:existence*1, 36082 author = {M. J. Smith}, 36083 title = {The existence and calculation of traffic equilibria}, 36084 journal = {Transportation Research}, 36085 volume = {17B}, 36086 year = {1983}, 36087 pages = {291--303} 36088} 36089 36090@Article{ smith:pattern, 36091 author = {F. W. Smith}, 36092 title = {Pattern Classifier Design by Linear Programming}, 36093 journal = {IEEE Transactions on Computers}, 36094 year = {1968}, 36095 volume = {C-17}, 36096 pages = {367--372} 36097} 36098 36099@Article{ solodov.svaiter:projection, 36100 author = {M. V. Solodov and B. F. Svaiter}, 36101 title = {A New Projection Method for Variational Inequality Problems}, 36102 journal = {SIAM Journal on Control and Optimization}, 36103 volume = {37}, 36104 pages = {765--776}, 36105 year = {1999} 36106} 36107 36108@Article{ solodov.tseng:modified, 36109 author = {M. V. Solodov and P. Tseng}, 36110 title = {Modified Projection--Type Methods for Monotone Variational Inequalities}, 36111 year = {1996}, 36112 journal = {SIAM Journal on Control and Optimization}, 36113 pages = {1814--1830}, 36114 volume = {34} 36115} 36116 36117@Article{ solodov:stationary, 36118 author = {M. V. Solodov}, 36119 title = {Stationary Points of Bound Constrained Minimization Reformulations of 36120 Complementarity Problems}, 36121 journal = {Journal of Optimization Theory and Applications, forthcoming}, 36122 year = {1997} 36123} 36124 36125@Article{ spendley.hext.ea:sequential, 36126 author = {W. Spendley and G. R. Hext and F. R. Himsworth}, 36127 title = {Sequential Application of Simplex Designs in Optimization and Evolutionary 36128 Operation}, 36129 journal = {Technometrics}, 36130 year = {1962}, 36131 pages = {441--461}, 36132 volume = {4} 36133} 36134 36135@Article{ spingarn:applications, 36136 author = {J. E. Spingarn}, 36137 title = {Applications of the Method of Partial Inverses to Convex Programming}, 36138 journal = {Mathematical Programming}, 36139 year = {1985}, 36140 volume = {32}, 36141 pages = {199--223} 36142} 36143 36144@Book{ srinivasan.whalley:general, 36145 author = {T. Srinivasan and J. Whalley}, 36146 title = {General Equilibrium Trade Policy Modelling}, 36147 publisher = {MIT Press}, 36148 year = {1986}, 36149 address = {Boston} 36150} 36151 36152@Book{ stackelberg:theory, 36153 author = {H. Van Stackelberg}, 36154 title = {The Theory of Market Economy}, 36155 publisher = {Oxford University Press}, 36156 year = {1952} 36157} 36158 36159@Article{ stavroulakis.panagiotopoulos.ea:rigid, 36160 author = {G. E. Stavroulakis and P. D. Panagiotopoulos and A. M. Al-Fahed}, 36161 title = {On the Rigid Body Displacements and Rotations in Unilateral Contact Problems and 36162 Applications}, 36163 journal = {Computers \& Structures}, 36164 volume = {40}, 36165 year = {1991}, 36166 pages = {599--614} 36167} 36168 36169@Article{ stavroulakis:optimal, 36170 author = {G. E. Stavroulakis}, 36171 title = {Optimal prestress of cracked unilateral structures: finite element analysis of an 36172 optimal control problem for variational inequalities}, 36173 journal = {Computer Methods in Applied Mechanics and Engineering, forthcoming}, 36174 year = {1996} 36175} 36176 36177@Article{ stavroulakis:optimal*1, 36178 author = {G. E. Stavroulakis}, 36179 title = {Optimal prestress of structures with frictional unilateral contact interfaces}, 36180 journal = {Archives of Applied Mechanics, forthcoming}, 36181 year = {1996} 36182} 36183 36184@Book{ steenbrink:optimization, 36185 author = {P. A. Steenbrink}, 36186 title = {Optimization of Transport Networks}, 36187 publisher = {John Wiley \& Sons}, 36188 address = {London, England}, 36189 year = {1974} 36190} 36191 36192@Article{ stephens:asymptotic, 36193 author = {M. A. Stephens}, 36194 title = {Asymptotic Results for Goodness-of-Fit Statistics with Unknown Parameters}, 36195 journal = {Annals of Statistics}, 36196 year = {1976}, 36197 volume = {4}, 36198 pages = {357--369} 36199} 36200 36201@Article{ stephens:edf, 36202 author = {M. A. Stephens}, 36203 title = {{EDF} Statistics for Goodness of Fit and Some Comparisons}, 36204 journal = {Journal of the American Statistical Association}, 36205 year = {1974}, 36206 volume = {69}, 36207 pages = {730--737} 36208} 36209 36210@Article{ stevens:location, 36211 author = {B. H. Stevens}, 36212 title = {Location Theory and Programming Models: The Von Th{\"{u}}nen case}, 36213 journal = {Papers of the Regional Science Association}, 36214 year = {1968}, 36215 volume = {21}, 36216 pages = {19--34} 36217} 36218 36219@Article{ stewart.trinkle:implicit, 36220 author = {D. E. Stewart and J. C. Trinkle}, 36221 title = {An Implicit Time-Stepping Scheme for Rigid Body Dynamics with Inelastic 36222 Collisions and {C}oulomb Friction}, 36223 journal = {International Journal for Numerical Methods in Engineering}, 36224 year = {1996}, 36225 volume = {39}, 36226 pages = {2673--2691} 36227} 36228 36229@Book{ stoer.bulirsch:introduction, 36230 author = {J. Stoer and R. Bulirsch}, 36231 title = {Introduction to Numerical Analysis}, 36232 year = {1980}, 36233 publisher = {Springer-Verlag}, 36234 address = {New York} 36235} 36236 36237@Article{ stoer:complexity, 36238 author = {J. Stoer}, 36239 title = {The complexity of an infeasible interior--point path--following method for the 36240 solution of linear programs}, 36241 journal = {Optimization Methods and Software}, 36242 year = {1994}, 36243 volume = {3}, 36244 pages = {1--12} 36245} 36246 36247@Article{ stone:cross-validatory, 36248 author = {M. Stone}, 36249 title = {Cross-validatory choice and assessment of statistical predictions}, 36250 journal = {Journal of the Royal Statistical Society}, 36251 year = {1974}, 36252 volume = {36}, 36253 pages = {111--147} 36254} 36255 36256@Article{ stone.smith.ea:inverse, 36257 author = {R. A. Stone and V. Smith and L. Verhey}, 36258 title = {Inverse Planning for the {G}amma {K}nife}, 36259 journal = {Medical Physics}, 36260 year = {1993}, 36261 volume = {20}, 36262 pages = {865} 36263} 36264 36265@Book{ strang:linear, 36266 author = {G. Strang}, 36267 title = {Linear Algebra and its Applications}, 36268 year = {1980}, 36269 publisher = {Academic Press}, 36270 address = {New York}, 36271 edition = {Second} 36272} 36273 36274@InProceedings{ street.wolberg.ea:nuclear, 36275 author = {W. N. Street and W. H. Wolberg and O. L. Mangasarian}, 36276 title = {Nuclear Feature Extraction for Breast Tumor Diagnosis}, 36277 booktitle = {Biomedical Image Processing and Biomedical Visualization}, 36278 year = {1993}, 36279 publisher = {SPIE--The International Society for Optical Engineering}, 36280 address = {San Jose, California}, 36281 pages = {861--870}, 36282 volume = {1905} 36283} 36284 36285@Article{ subramanian:gauss-newton, 36286 author = {P. K. Subramanian}, 36287 title = {Gauss--{N}ewton Methods for the Complementarity Problem}, 36288 journal = {Journal of Optimization Theory and Applications}, 36289 year = {1993}, 36290 volume = {77}, 36291 pages = {467--482} 36292} 36293 36294@PhDThesis{ subramanian:iterative, 36295 author = {P. K. Subramanian}, 36296 title = {Iterative Methods of Solution for Complementarity Problems}, 36297 year = {1985}, 36298 address = {Madison, Wisconsin}, 36299 school = {Computer Sciences Department, University of Wisconsin} 36300} 36301 36302@TechReport{ subramanian:note, 36303 author = {P. K. Subramanian}, 36304 title = {A Note on Least Two Norm Solutions of Monotone Complementarity Problems}, 36305 institution = {Mathematics Research Center, University of Wisconsin--Madison}, 36306 year = {1985}, 36307 address = {Madison, Wisconsin}, 36308 number = {2844}, 36309 type = {Technical Summary Report} 36310} 36311 36312@TechReport{ suh.gucht:distributed, 36313 author = {J. Y. Suh and D. Van Gucht}, 36314 title = {Distributed Genetic Algorithms}, 36315 institution = {Computer Science Department, Indiana University}, 36316 year = {1987}, 36317 address = {Bloomington}, 36318 number = {225} 36319} 36320 36321@Article{ sun.natori.ea:computational, 36322 author = {S. M. Sun and M. C. Natori and K. C. Park}, 36323 title = {A Computational Procedure for Flexible Beams with Frictional Contact 36324 Constraints}, 36325 journal = {International Journal for Numerical Methods in Engineering}, 36326 volume = {36}, 36327 pages = {3781--3800}, 36328 year = {1993} 36329} 36330 36331@Article{ sun.qi:ncp-functions, 36332 author = {D. Sun and L. Qi}, 36333 title = {On {NCP}-Functions}, 36334 journal = {Computational Optimization and Applications, forthcoming}, 36335 year = {1998} 36336} 36337 36338@Article{ sun.womersley:unconstrained, 36339 author = {D. Sun and R. S. Womersley}, 36340 title = {A new unconstrained differentiable merit function for box constrained variational 36341 inequality problems and a damped {G}auss-{N}ewton method}, 36342 journal = {SIAM Journal on Optimization}, 36343 year = {1999}, 36344 volume = {9}, 36345 pages = {388--413} 36346} 36347 36348@Article{ sun:class, 36349 author = {D. Sun}, 36350 title = {A Class of Iterative Methods for Nonlinear Projection Equations}, 36351 journal = {Journal of Optimization Theory and Applications}, 36352 year = {1996}, 36353 volume = {91}, 36354 pages = {123--140} 36355} 36356 36357@PhDThesis{ sun:monotropic, 36358 author = {J. Sun}, 36359 title = {On Monotropic Piecewise Quadratic Programming}, 36360 school = {University of Washington}, 36361 year = {1986}, 36362 address = {Seattle, Washington} 36363} 36364 36365@Article{ sun:thermal, 36366 author = {D. C. Sun}, 36367 title = {A Thermal Elastic Theory of Piston-Ring and Cylinder-Bore Contact}, 36368 journal = {Journal of Applied Mechanics}, 36369 volume = {58}, 36370 pages = {141--153}, 36371 year = {1991} 36372} 36373 36374@Article{ sundararaghavan.ahmed:minimizing, 36375 author = {P. S. Sundararaghavan and M. U. Ahmed}, 36376 title = {Minimizing the Sum of Absolute Lateness in Single--Machine and Multimachine 36377 Scheduling}, 36378 journal = {Naval Research Logistics Quarterly}, 36379 year = {1984}, 36380 volume = {31}, 36381 pages = {325--333} 36382} 36383 36384@TechReport{ sznajder.gowda:generalizations, 36385 author = {R. Sznajder and M. S. Gowda}, 36386 title = {Generalizations of ${P}_0$-- and ${P}$-- properties; extended vertical and 36387 horizontal {LCP}s}, 36388 institution = {Department of Mathematics, University of Maryland--Baltimore County}, 36389 year = {1992}, 36390 address = {Catonsville, Maryland}, 36391 number = {92--16}, 36392 type = {Research Report} 36393} 36394 36395@Article{ sznajder.gowda:nondegeneracy, 36396 author = {R. Sznajder and M. S. Gowda}, 36397 title = {Nondegeneracy Concepts for Zeros of Piecewise Smooth Functions}, 36398 journal = {Mathematics of Operations Research}, 36399 year = {1998}, 36400 volume = {23}, 36401 pages = {221--238} 36402} 36403 36404@Article{ taji.fukushima.ea:globally, 36405 author = {K. Taji and M. Fukushima and T. Ibaraki}, 36406 title = {A Globally Convergent {N}ewton Method for Solving Strongly Monotone Variational 36407 Inequalities}, 36408 journal = {Mathematical Programming}, 36409 year = {1993}, 36410 volume = {58}, 36411 pages = {369--383} 36412} 36413 36414@Article{ taji.fukushima:optimization, 36415 author = {K. Taji and M. Fukushima}, 36416 title = {Optimization Based Globally Convergent Methods for the Nonlinear Complementarity 36417 Problem}, 36418 journal = {Journal of the Operations Research Society of Japan}, 36419 year = {1994}, 36420 volume = {37}, 36421 pages = {310--331} 36422} 36423 36424@Article{ talbot.patterson.ea:comparative, 36425 author = {F. B. Talbot and J. H. Patterson and W. V. Gehrlein}, 36426 title = {A Comparative Evaluation of Heuristic Line Balancing Techniques}, 36427 journal = {Management Science}, 36428 year = {1986}, 36429 volume = {32}, 36430 pages = {430--454} 36431} 36432 36433@Article{ talman.yamamoto:simplicial, 36434 author = {A. J. J. Talman and Y. Yamamoto}, 36435 title = {A {S}implicial Algorithm for Stationary Point Problems}, 36436 journal = {Mathematics of Operations Research}, 36437 year = {1989}, 36438 volume = {14}, 36439 pages = {383--399} 36440} 36441 36442@InProceedings{ tanese:distributed, 36443 crossref = {schaeffer:third}, 36444 author = {R. Tanese}, 36445 title = {Distributed Genetic Algorithms}, 36446 pages = {434--439} 36447} 36448 36449@InProceedings{ tanese:parallel, 36450 crossref = {grefenstette:genetic}, 36451 author = {R. Tanese}, 36452 title = {Parallel Genetic Algorithms for a Hypercube}, 36453 pages = {177--183} 36454} 36455 36456@Article{ teboulle:entropic, 36457 author = {M. Teboulle}, 36458 title = {Entropic Proximal Mappings with Applications to Nonlinear Programming}, 36459 year = {1992}, 36460 journal = {Mathematics of Operations Research}, 36461 volume = {17}, 36462 pages = {670--690} 36463} 36464 36465@Article{ thuente:duality, 36466 author = {D. J. Thuente}, 36467 title = {Duality Theory for Generalized Linear Programs with Computational Methods}, 36468 journal = {Operations Research}, 36469 year = {1980}, 36470 volume = {28}, 36471 pages = {1005--1011} 36472} 36473 36474@Book{ tikhonov.arsenin:solutions, 36475 author = {A. N. Tikhonov and V. Y. Arsenin}, 36476 title = {Solutions of Ill--Posed Problems}, 36477 year = {1977}, 36478 publisher = {John Wiley \& Sons}, 36479 address = {New York} 36480} 36481 36482@InProceedings{ tin-loi.ferris:complementarity, 36483 author = {F. Tin-Loi and M. C. Ferris}, 36484 title = {Complementarity Problems in Engineering and Mechanics: Models and Solution}, 36485 booktitle = {Computational Mechanics for the Next Millenium}, 36486 key = {79}, 36487 pages = {1029--1036}, 36488 year = {1999}, 36489 editor = {C. M. Wang and K. H. Lee and K. K. Ang}, 36490 volume = {2}, 36491 series = {Proceedings of APCOM '99, Fourth Asia-Pacific Conference on Computational 36492 Mechanics}, 36493 url = {ftp: //ftp.cs.wisc.edu/math-prog/tech-reports/99-02.ps}, 36494 publisher = {Elsevier Science Ltd}, 36495 type = {Mathematical Programming Technical Report}, 36496 institution = {Computer Sciences Department, University of Wisconsin}, 36497 address = {Madison, Wisconsin}, 36498 number = {99-02} 36499} 36500 36501@InProceedings{ tin-loi.ferris:holonomic, 36502 author = {F. Tin-Loi and M. C. Ferris}, 36503 title = {Holonomic Analysis of Quasibrittle Fracture with Nonlinear Softening}, 36504 booktitle = {Advances in Fracture Research}, 36505 year = {1997}, 36506 editor = {B. L. Karihaloo and Y. W. Mai and M. I. Ripley and R. O. Ritchie}, 36507 volume = {2}, 36508 publisher = {Pergamon Press}, 36509 pages = {2183--2190}, 36510 key = {53} 36511} 36512 36513@InProceedings{ tin-loi.ferris:simple, 36514 author = {F. Tin-Loi and M. C. Ferris}, 36515 title = {A Simple Mathematical Programming Method for a Structural Identification 36516 Problem}, 36517 booktitle = {Seventh International Conference on Computing in Civil and Building Engineering 36518 (ICCCBE-VII), Seoul, Korea, 19-21 August}, 36519 editors = {C. K. Choi and C. B. Yun and H. G. Kwak}, 36520 publisher = {Techno-Press}, 36521 address = {Korea}, 36522 year = {1997}, 36523 pages = {511--518}, 36524 key = {59} 36525} 36526 36527@Article{ tin-loi.misa:large, 36528 author = {F. Tin-Loi and J. S. Misa}, 36529 title = {Large displacement elastoplastic analysis of semirigid steel frames}, 36530 journal = {International Journal for Numerical Methods in Engineering}, 36531 volume = {39}, 36532 pages = {741--762}, 36533 year = {1996} 36534} 36535 36536@Article{ tin-loi.pang:elastoplastic, 36537 author = {F. Tin-Loi and J. S. Pang}, 36538 title = {Elastoplastic analysis of structures with nonlinear hardening}, 36539 journal = {Computer Methods in Applied Mechanics and Engineering}, 36540 volume = {107}, 36541 year = {1993}, 36542 pages = {299--312} 36543} 36544 36545@Article{ tin-loi.vimonsatit:nonlinear, 36546 author = {F. Tin-Loi and V. Vimonsatit}, 36547 title = {Nonlinear Analysis of Semi-Rigid Frames: a Parametric Complementarity Approach}, 36548 journal = {Engineering Structures}, 36549 volume = {18}, 36550 year = {1996}, 36551 pages = {115--124} 36552} 36553 36554@Article{ tobin:uniqueness, 36555 author = {R. L. Tobin}, 36556 title = {Uniqueness results and algorithm for Stackelberg-Cournot-Nash equilibria}, 36557 journal = {Annals of Operations Research}, 36558 volume = {34}, 36559 year = {1992}, 36560 pages = {21--36} 36561} 36562 36563@Article{ tobin:variable, 36564 author = {R. L. Tobin}, 36565 title = {A Variable Dimension Solution Approach for the General Spatial Equilibrium 36566 Problem}, 36567 journal = {Mathematical Programming}, 36568 year = {1988}, 36569 volume = {40}, 36570 pages = {33--51} 36571} 36572 36573@Article{ todd.burrell:extension, 36574 author = {M. J. Todd and B. P. Burrell}, 36575 title = {An Extension of {K}armarkar's Algorithm for Linear Programming Using Dual 36576 Variables}, 36577 journal = {Algorithmica}, 36578 year = {1986}, 36579 volume = {1}, 36580 pages = {409--424} 36581} 36582 36583@Book{ todd:computation, 36584 author = {M. J. Todd}, 36585 title = {Computation of Fixed Points and Applications}, 36586 publisher = {Springer-Verlag}, 36587 year = {1976}, 36588 volume = {124}, 36589 series = {Lecture Notes in Economics and Mathematical Systems}, 36590 address = {Heidelberg} 36591} 36592 36593@Article{ todd:note, 36594 author = {M. J. Todd}, 36595 title = {A Note on Computing Equilibria in Economies with Activity Analysis Models of 36596 Production}, 36597 journal = {Journal of Mathematical Economics}, 36598 year = {1976}, 36599 volume = {6}, 36600 pages = {135--144} 36601} 36602 36603@Article{ toint:assesment, 36604 author = {Ph. L. Toint}, 36605 title = {An Assesment of Non--Monotone Linesearch Techniques for Unconstrained 36606 Optimization}, 36607 year = {1996}, 36608 journal = {SIAM Journal on Scientific Computing}, 36609 volume = {17}, 36610 pages = {725=-739} 36611} 36612 36613@TechReport{ toint:assesment*1, 36614 author = {Ph. L. Toint}, 36615 title = {An Assesment of Non--Monotone Linesearch Techniques for Unconstrained 36616 Optimization: The Complete Numerical Results}, 36617 institution = {Department of Mathematics, FUNDP}, 36618 year = {1994}, 36619 number = {94/15}, 36620 address = {Namur, Belgium} 36621} 36622 36623@Article{ toint:global, 36624 author = {Ph. L. Toint}, 36625 title = {Global Convergence of a Class of Trust Region Methods for Nonconvex Minimization 36626 in a {H}ilbert Space}, 36627 journal = {IMA Journal of Numerical Analysis}, 36628 year = {1988}, 36629 volume = {8}, 36630 pages = {231--252} 36631} 36632 36633@Article{ toint:non-monotone, 36634 author = {Ph. L. Toint}, 36635 title = {A Non--Monotone Trust--Region Algorithm for Nonlinear Optimization subject to 36636 Convex Constraints}, 36637 year = {1997}, 36638 journal = {Mathematical Programming}, 36639 volume = {77}, 36640 pages = {69--94} 36641} 36642 36643@InCollection{ toint:transportation, 36644 author = {Ph. L. Toint}, 36645 title = {Transportation Modelling and Operations Research: {A} Fruitful Connection}, 36646 booktitle = {Operations Research and Decision Aid Methodologies in Traffic and Transportation 36647 Management}, 36648 publisher = {Springer-Verlag}, 36649 series = {NATO ASI Series F}, 36650 year = {1997}, 36651 editor = {Ph. L. Toint and M. Labbe and K. Tanczos and G. Laporte} 36652} 36653 36654@Article{ tomlin.welch:finding, 36655 author = {J. Tomlin and J. Welch}, 36656 title = {Finding Duplicate Rows in a Linear Programming Model}, 36657 journal = {Operations Research Letters}, 36658 year = {1986}, 36659 volume = {5}, 36660 number = {1}, 36661 pages = {7--11} 36662} 36663 36664@Article{ torczon:convergence, 36665 author = {V. Torczon}, 36666 title = {On the Convergence of the Multidirectional Search Algorithm}, 36667 journal = {SIAM Journal on Optimization}, 36668 year = {1991}, 36669 volume = {1}, 36670 pages = {123--145} 36671} 36672 36673@Article{ torczon:convergence*1, 36674 author = {V. Torczon}, 36675 title = {On the Convergence of Pattern Search Algorithms}, 36676 journal = {SIAM Journal on Optimization}, 36677 year = {1997}, 36678 volume = {7}, 36679 pages = {1--25} 36680} 36681 36682@Misc{ torma.rutherford:general, 36683 author = {H. Torma and T. Rutherford}, 36684 title = {A General Equilibrium Assessment of {F}inland's Grand Tax Reform}, 36685 year = {1992}, 36686 howpublished = {Working Paper 15/1992}, 36687 note = {Department of Economics and Management, University of Jyvaskyla, Finland} 36688} 36689 36690@Article{ trinkle.pang.ea:dynamic, 36691 author = {J. C. Trinkle and J. S. Pang and S. Sudarsky and G. Lo}, 36692 title = {On Dynamic Multi-Rigid-Body Contact Problems}, 36693 journal = {Zeitschrift f{\"{u}}r Angewandte Mathematik und Mechanik}, 36694 year = {1997}, 36695 pages = {267--279}, 36696 volume = {77} 36697} 36698 36699@InProceedings{ trinkle.pang:dynamic, 36700 author = {J. C. Trinkle and J. S. Pang}, 36701 title = {Dynamic multi-rigid-body systems with concurrent distributed contacts friction}, 36702 book = {{IEEE} International Conference on Robotics and Automation}, 36703 pages = {2276--2281}, 36704 year = {1997} 36705} 36706 36707@TechReport{ tseng.bertsekas:convergence, 36708 author = {P. Tseng and D. P. Bertsekas}, 36709 title = {On the Convergence of the Exponential Multiplier Method for Convex Programming}, 36710 institution = {Laboratory for Information and Decision Systems, Massachusetts Institute of 36711 Technology}, 36712 year = {1990}, 36713 type = {technical report}, 36714 number = {LIDS-P-1995}, 36715 address = {Cambridge, MA} 36716} 36717 36718@Article{ tseng.yamashita.ea:equivalence, 36719 author = {P. Tseng and N. Yamashita and M. Fukushima}, 36720 title = {Equivalence of Complementarity Problems to Differentiable Minimization: a Unified 36721 Approach}, 36722 year = {1996}, 36723 journal = {SIAM Journal on Optimization}, 36724 volume = {6}, 36725 pages = {446--460} 36726} 36727 36728@Article{ tseng:applications, 36729 author = {P. Tseng}, 36730 title = {Applications of a splitting algorithm to decomposition in convex programming and 36731 variational inequalities}, 36732 journal = {SIAM Journal on Control and Optimization}, 36733 year = {1991}, 36734 volume = {29}, 36735 pages = {119--138} 36736} 36737 36738@Article{ tseng:dual, 36739 author = {P. Tseng}, 36740 title = {Dual Ascent Methods for Problems with Strictly Convex Costs and Linear 36741 Constraints: a Unified Approach}, 36742 journal = {SIAM Journal on Control and Optimization}, 36743 year = {1990}, 36744 volume = {28}, 36745 pages = {214--242} 36746} 36747 36748@Article{ tseng:dual*1, 36749 author = {P. Tseng}, 36750 title = {Dual Ascent Methods with Strictly Convex Costs and Linear Constraints: {A} 36751 Unified Approach}, 36752 journal = {SIAM Journal on Control and Optimization}, 36753 year = {1990}, 36754 volume = {28}, 36755 pages = {214--242} 36756} 36757 36758@Article{ tseng:dual*2, 36759 author = {P. Tseng}, 36760 title = {Dual Coordinate Ascent Methods for Non--Strictly Convex Minimization}, 36761 journal = {Mathematical Programming}, 36762 year = {1993}, 36763 volume = {59}, 36764 pages = {231--248} 36765} 36766 36767@Article{ tseng:fortified-descent, 36768 author = {P. Tseng}, 36769 title = {Fortified-Descent Simplicial Search Method: a General Approach}, 36770 journal = {SIAM Journal on Optimization}, 36771 volume = {10}, 36772 pages = {269--288}, 36773 year = {2000} 36774} 36775 36776@Article{ tseng:growth, 36777 author = {P. Tseng}, 36778 title = {Growth Behavior of a Class of Merit Functions for the Nonlinear Complementarity 36779 Problem}, 36780 journal = {Journal of Optimization Theory and Applications}, 36781 volume = {89}, 36782 year = {1996}, 36783 pages = {17--37} 36784} 36785 36786@Unpublished{ tseng:matlab, 36787 author = {P. Tseng}, 36788 title = {Matlab Implementations of Complementarity Codes}, 36789 year = {1995}, 36790 note = {Private Communication} 36791} 36792 36793@Article{ ursescu:multifunctions, 36794 author = {C. Ursescu}, 36795 title = {Multifunctions with closed convex graph}, 36796 journal = {Czech. Math. J.}, 36797 year = {1975}, 36798 volume = {35}, 36799 pages = {438--441} 36800} 36801 36802@TechReport{ vaidya:algorithm, 36803 author = {P. M. Vaidya}, 36804 title = {An Algorithm for Linear Programming which Requires 36805 {O}($((m+n)n^2+(m+n)^{1.5})${L}) arithmetic operations}, 36806 institution = {AT\&T Bell Laboratories}, 36807 year = {1987}, 36808 address = {Murray Hill, New Jersey} 36809} 36810 36811@Article{ val:unloading, 36812 author = {P. Du Val}, 36813 title = {The Unloading Problem for Plane Curves}, 36814 journal = {American Journal of Mathematics}, 36815 year = {1940}, 36816 volume = {62}, 36817 pages = {307--311} 36818} 36819 36820@InCollection{ valentine:problem, 36821 author = {F. A. Valentine}, 36822 title = {The Problem of {L}agrange with Differential Inequalities as Added Side 36823 Conditions}, 36824 booktitle = {Contributions to the Calculus of Variations, 1933--1937}, 36825 year = {1937}, 36826 publisher = {University of Chicago Press}, 36827 address = {Chicago}, 36828 pages = {407--448} 36829} 36830 36831@Article{ valle.poch.ea:comparison, 36832 author = {M. del Valle and M. Poch and J. Alonso and J. Bartroli}, 36833 title = {Comparison of the {P}owell and Simplex Methods in the Optimization of 36834 Flow-Injection Systems}, 36835 journal = {Analytica Chimica Acta}, 36836 year = {1990}, 36837 volume = {241}, 36838 pages = {31--42} 36839} 36840 36841@Article{ vandenberghe.demoor.ea:generalized, 36842 author = {L. Vandenberghe and B. L. {De~Moor} and J. Vandewalle}, 36843 title = {The generalized linear complementarity problem applied to the complete analysis 36844 of resistive piecewise-linear circuits}, 36845 journal = {IEEE Transactions on Circuits and Systems}, 36846 volume = {36}, 36847 year = {1989}, 36848 pages = {1382--1391} 36849} 36850 36851@Article{ vanderbei.meketon.ea:modification, 36852 author = {R. J. Vanderbei and M. S. Meketon and B. A. Freedman}, 36853 title = {A Modification of {K}armarkar's Algorithm}, 36854 journal = {Algorithmica}, 36855 year = {1986}, 36856 volume = {1}, 36857 pages = {395--407} 36858} 36859 36860@Article{ vanderbei:affine-scaling, 36861 author = {R. J. Vanderbei}, 36862 title = {Affine--Scaling for Linear Programs with Free Variables}, 36863 journal = {Mathematical Programming}, 36864 year = {1989}, 36865 volume = {43}, 36866 pages = {31--44} 36867} 36868 36869@Article{ vanroy.wolsey:solving, 36870 author = {T. J. Van~Roy and L. A. Wolsey}, 36871 title = {Solving Mixed Integer 0-1 Programs by Automatic Reformulation}, 36872 journal = {Operations Research}, 36873 volume = {35}, 36874 pages = {45--57}, 36875 year = {1987} 36876} 36877 36878@Book{ vapnik:nature, 36879 author = {V. N. Vapnik}, 36880 title = {The Nature of Statistical Learning Theory}, 36881 publisher = {John Wiley \& Sons}, 36882 address = {New York}, 36883 year = {1996} 36884} 36885 36886@Book{ varian:microeconomic, 36887 author = {Hal R. Varian}, 36888 title = {Microeconomic Analysis}, 36889 year = {1978}, 36890 publisher = {W.W. Norton \& Company}, 36891 address = {New York, New York} 36892} 36893 36894@Article{ verhey:immobilizing, 36895 author = {L. J. Verhey}, 36896 title = {Immobilizing and Positioning Patients for Radiotherapy}, 36897 journal = {Seminars in Radiation Oncology}, 36898 year = {1995}, 36899 volume = {5}, 36900 number = {2}, 36901 pages = {100--113} 36902} 36903 36904@Article{ vinante.pintos:differentiable, 36905 author = {C. Vinante and S. Pintos}, 36906 title = {On Differentiable Exact Penalty Functions}, 36907 journal = {Journal of Optimization Theory and Applications}, 36908 year = {1986}, 36909 volume = {50}, 36910 pages = {479--493} 36911} 36912 36913@Article{ vlach:scheduling, 36914 author = {M. Vlach}, 36915 title = {On Scheduling with Earliness and Tardiness Penalties}, 36916 journal = {Methods of Operations Research}, 36917 year = {1983}, 36918 volume = {45}, 36919 pages = {367--375} 36920} 36921 36922@InCollection{ wacker:summary, 36923 author = {H.--J. Wacker}, 36924 title = {A Summary of the Developments on Imbedding Methods}, 36925 booktitle = {Continuation Methods}, 36926 year = {1978}, 36927 editor = {H.--J. Wacker}, 36928 publisher = {Academic Press}, 36929 address = {New York}, 36930 pages = {1--35} 36931} 36932 36933@Article{ wakefield.tin-loi:large, 36934 author = {R. R. Wakefield and F. Tin-Loi}, 36935 title = {Large Scale Nonholonomic Elastoplastic Analysis using a Linear Complementarity 36936 Formulation}, 36937 journal = {Computer Methods in Applied Mechanics and Engineering}, 36938 volume = {84}, 36939 year = {1990}, 36940 pages = {229--242} 36941} 36942 36943@Article{ wakefield.tin-loi:large*1, 36944 author = {R. R. Wakefield and F. Tin-Loi}, 36945 title = {Large Displacement Elastoplastic Analysis of Frames using an Iterative {LCP} 36946 Approach}, 36947 journal = {International Journal Mechanical Science}, 36948 volume = {33}, 36949 year = {1991}, 36950 pages = {379--391} 36951} 36952 36953@Article{ walker:implementation, 36954 author = {H. F. Walker}, 36955 title = {Implementation of the {GMRES} method using {H}ouseholder transformations}, 36956 journal = {SIAM Journal on Scientific Computing}, 36957 volume = {9}, 36958 year = {1988}, 36959 pages = {152--163} 36960} 36961 36962@Book{ wall.schwartz:programming, 36963 author = {L. Wall and R. L. Schwartz}, 36964 title = {Programming Perl}, 36965 publisher = {O'Reilly and Associates, Inc.}, 36966 address = {Sebastopol, CA}, 36967 year = {1991} 36968} 36969 36970@Book{ walras:elements, 36971 author = {L. Walras}, 36972 title = {Elements of Pure Economics}, 36973 publisher = {Allen and Unwin}, 36974 year = {1954}, 36975 address = {London} 36976} 36977 36978@Article{ wang.monteiro.ea:interior, 36979 author = {T. Wang and R. D. C. Monteiro and J. S. Pang}, 36980 title = {An Interior Point Potential Reduction Method for Constrained Equations}, 36981 journal = {Mathematical Programming}, 36982 volume = {74}, 36983 pages = {159--196}, 36984 year = {1996} 36985} 36986 36987@Article{ wardi:stochastic, 36988 author = {Y. Wardi}, 36989 title = {A Stochastic Steepest-Descent Algorithm}, 36990 journal = {Journal of Optimization Theory and Applications}, 36991 year = {1988}, 36992 volume = {59}, 36993 pages = {307--323} 36994} 36995 36996@Article{ wardi:stochastic*1, 36997 author = {Y. Wardi}, 36998 title = {Stochastic Algorithms for with {A}rmijo Stepsizes for Minimization of Functions}, 36999 journal = {Journal of Optimization Theory and Applications}, 37000 year = {1990}, 37001 volume = {64}, 37002 pages = {399--417} 37003} 37004 37005@Article{ wardrop:theoretical, 37006 author = {J. G. Wardrop}, 37007 title = {Some Theoretical Aspects of Road Traffic Research}, 37008 journal = {Proceeding of the Institute of Civil Engineers, Part {II}}, 37009 year = {1952}, 37010 pages = {325--378} 37011} 37012 37013@Article{ warga:minimizing, 37014 author = {J. Warga}, 37015 title = {Minimizing certain convex functions}, 37016 journal = {Journal of SIAM on Applied Mathematics}, 37017 year = {1963}, 37018 volume = {11}, 37019 pages = {588--593} 37020} 37021 37022@Article{ watson.billups.ea:hompack, 37023 author = {L. T. Watson and S. C. Billups and A. P. Morgan}, 37024 title = {Algorithm 652: {HOMPACK}: {A} Suite of Codes for Globally Convergent Homotopy 37025 Algorithms}, 37026 journal = {{ACM} Transactions on Mathematical Software}, 37027 year = {1987}, 37028 volume = {13}, 37029 pages = {281--310} 37030} 37031 37032@Article{ watson.billups.ea:slow, 37033 author = {L. T. Watson and S. C. Billups and C. Y. Wang}, 37034 title = {Slow Viscous Flow in a Syringe}, 37035 journal = {Journal of Biomechanical Engineering}, 37036 year = {1986}, 37037 volume = {108}, 37038 pages = {317--323} 37039} 37040 37041@Article{ watson:discrete, 37042 author = {G. A. Watson}, 37043 title = {Discrete $\ell_1$ approximation by rational functions}, 37044 journal = {IMA Journal of Numerical Analysis}, 37045 year = {1984}, 37046 volume = {4}, 37047 pages = {275--288} 37048} 37049 37050@Article{ watson:solving, 37051 author = {L. T. Watson}, 37052 title = {Solving the nonlinear complementarity problem by a homotopy method}, 37053 journal = {SIAM Journal on Control and Optimization}, 37054 year = {1979}, 37055 volume = {17}, 37056 pages = {36--46} 37057} 37058 37059@Article{ webb:optimum, 37060 author = {S. Webb}, 37061 title = {Optimum Parameters in a Model of Tumor Control Probability including Interpatient 37062 Heterogeneity}, 37063 journal = {Physics in Medicine and Biology}, 37064 year = {1994}, 37065 volume = {39}, 37066 pages = {1895--1914} 37067} 37068 37069@Book{ webb:physics, 37070 author = {S. Webb}, 37071 title = {The Physics of Conformal Radiotherapy: Advances in Technology}, 37072 publisher = {Institute of Physics Publishing Ltd.}, 37073 year = {1997}, 37074 optaddress = {Philadelphia} 37075} 37076 37077@InBook{ webb:theory, 37078 author = {S. Webb}, 37079 editor = {E. Sternick}, 37080 title = {The Theory and Practice of Intensity Modulated Radiation Therapy}, 37081 chapter = {Inverse Planning for IMRT: the Role of Simulated Annealing}, 37082 publisher = {Advanced Medical Publishing}, 37083 year = {1997} 37084} 37085 37086@Book{ weiss.kulikowski:computer, 37087 author = {S. M. Weiss and C. A. Kulikowski}, 37088 title = {Computer Systems that Learn}, 37089 year = {1991}, 37090 publisher = {Morgan Kaufmann Publishers, Inc}, 37091 address = {San Mateo, California} 37092} 37093 37094@PhDThesis{ werbos:beyond, 37095 author = {P. J. Werbos}, 37096 title = {Beyond Regression: New Tools for Prediction and Analysis in the Behaviorial 37097 Sciences}, 37098 year = {1974}, 37099 school = {Harvard University} 37100} 37101 37102@InCollection{ wets:convergence, 37103 author = {R. J.-B. Wets}, 37104 title = {Convergence of Convex Functions, Variational Inequalites, and Convex Optimization 37105 Problems}, 37106 booktitle = {Variational Inequalites and Complementarity Problems}, 37107 year = {1980}, 37108 editor = {R. W. Cottle and F. Giannessi and J.--L. Lions}, 37109 publisher = {John Wiley \& Sons}, 37110 address = {New York}, 37111 pages = {375--403} 37112} 37113 37114@InCollection{ wets:large, 37115 author = {R. J.-B. Wets}, 37116 title = {Large Scale Linear Programming Techniques in Stochastic Programming}, 37117 booktitle = {Numerical Techniques for Stochastic Optimization}, 37118 publisher = {Springer-Verlag}, 37119 year = {1988}, 37120 editor = {Yu. M. Ermoliev and R. J. -B. Wets}, 37121 address = {Berlin}, 37122 pages = {65--93} 37123} 37124 37125@Article{ white:asymptotic, 37126 author = {H. White}, 37127 title = {Some asymptotic results for learning in single hidden-layer feedforward network 37128 models}, 37129 journal = {Journal of the American Stattistical Association}, 37130 year = {1989}, 37131 volume = {84}, 37132 number = {408}, 37133 pages = {1003--1013} 37134} 37135 37136@Article{ white:learning, 37137 author = {H. White}, 37138 title = {Learning in artificial neural networks{:} {A} statistical perspective}, 37139 journal = {Neural Computation}, 37140 year = {1989}, 37141 volume = {1}, 37142 pages = {425--461} 37143} 37144 37145@InProceedings{ whitley.starkweather.ea:scheduling, 37146 crossref = {schaeffer:third}, 37147 author = {D. Whitley and T. Starkweather and D. Fuquay}, 37148 title = {Scheduling Problems and Travelling Salesmen: The Genetic Edge Recombination 37149 Operator}, 37150 pages = {133--140} 37151} 37152 37153@Book{ williams:model, 37154 author = {H. P. Williams}, 37155 title = {Model Building in Mathematical Programming}, 37156 publisher = {John Wiley \& Sons}, 37157 year = {1990}, 37158 edition = {Third} 37159} 37160 37161@Book{ wilmott.dewynne.ea:option, 37162 author = {P. Wilmott and J. Dewynne and S. Howison}, 37163 title = {Option Pricing}, 37164 publisher = {Oxford Financial Press}, 37165 year = {1993}, 37166 address = {Oxford, England} 37167} 37168 37169@PhDThesis{ wilson:simplicial, 37170 author = {R. B. Wilson}, 37171 title = {A Simplicial Algorithm for Concave Programming}, 37172 year = {1963}, 37173 address = {Boston, MA}, 37174 school = {Graduate School of Business Administration, Harvard University} 37175} 37176 37177@TechReport{ wolberg.bennett.ea:breast, 37178 author = {W. H. Wolberg and K. P. Bennett and O. L. Mangasarian}, 37179 title = {Breast Cancer Diagnosis and Prognostic Determination from Cell Analysis}, 37180 institution = {Departments of Surgery and Human Oncology and Computer Sciences, University of 37181 Wisconsin}, 37182 year = {1992}, 37183 address = {Madison, WI 53706}, 37184 type = {Manuscript} 37185} 37186 37187@Article{ wolberg.mangasarian:multisurface, 37188 author = {W. H. Wolberg and O. L. Mangasarian}, 37189 title = {Multisurface Method of Pattern Separation for Medical Diagnosis Applied to Breast 37190 Cytology}, 37191 journal = {Proceedings of the National Academy of Sciences,U.S.A.}, 37192 year = {1990}, 37193 volume = {87}, 37194 pages = {9193--9196} 37195} 37196 37197@Unpublished{ wolberg.mangasarian:wbcd, 37198 author = {W. H. Wolberg and O. L. Mangasarian}, 37199 title = {{WBCD: Wisconsin Breast Cancer Database}}, 37200 year = {1991}, 37201 note = {Computer Sciences Department, University of Wisconsin, Madison, ftp: //ftp. cs. 37202 wisc.edu/math-prog/cpo-dataset/machine-learn/cancer1/} 37203} 37204 37205@Article{ wolberg.street.ea:breast, 37206 author = {W. H. Wolberg and W. N. Street and O. L. Mangasarian}, 37207 title = {Breast Cytology Diagnosis via Digital Image Analysis}, 37208 journal = {Analytical and Quantitative Cytology and Histology}, 37209 year = {1993}, 37210 volume = {15}, 37211 number = {6}, 37212 pages = {396--404} 37213} 37214 37215@Unpublished{ wolberg.street.ea:wdbc, 37216 author = {W. H. Wolberg and W. N. Street and O. L. Mangasarian}, 37217 title = {{WDBC: Wisconsin Diagnostic Breast Cancer Database}}, 37218 year = {1995}, 37219 note = {Computer Sciences Department, University of Wisconsin, Madison, ftp: //ftp. 37220 cs.wisc.edu/math-prog/cpo-dataset/machine-learn/WDBC/} 37221} 37222 37223@Unpublished{ wolberg.street.ea:wpbc, 37224 author = {W. H. Wolberg and W. N. Street and O. L. Mangasarian}, 37225 title = {{WPBC: Wisconsin Prognostic Breast Cancer Database}}, 37226 year = {1995}, 37227 note = {Computer Sciences Department, University of Wisconsin, Madison, ftp: //ftp. 37228 cs.wisc.edu/math-prog/cpo-dataset/machine-learn/WPBC/} 37229} 37230 37231@Book{ wolsey:integer, 37232 author = {L. A. Wolsey}, 37233 title = {Integer Programming}, 37234 publisher = {John Wiley \& Sons}, 37235 year = {1998}, 37236 address = {New York, NY} 37237} 37238 37239@Article{ womersley:local, 37240 author = {R. S. Womersley}, 37241 title = {Local Properties of Algorithms for Minimizing Composite Functions}, 37242 journal = {Mathematical Programming}, 37243 year = {1985}, 37244 volume = {32}, 37245 pages = {69--89} 37246} 37247 37248@Article{ woo.sanders.ea:peacock, 37249 author = {S. Y. Woo and M. Sanders and W. Grant and E. B. Butler}, 37250 title = {Does the ``peacock'' have anything to do with radiotherapy?}, 37251 journal = {International Journal of Radiation Oncology, Biology and Physics}, 37252 year = {1994}, 37253 volume = {29}, 37254 number = {1}, 37255 pages = {213--214} 37256} 37257 37258@Article{ wright.ralph:superlinear, 37259 author = {S. J. Wright and D. Ralph}, 37260 title = {A Superlinear Infeasible--Interior--Point Algorithm for Monotone Complementarity 37261 Problems}, 37262 year = {1996}, 37263 journal = {Mathematics of Operations Research}, 37264 volume = {21}, 37265 pages = {815--838} 37266} 37267 37268@TechReport{ wright.zhang:superquadratic, 37269 author = {S. J. Wright and Y. Zhang}, 37270 title = {A Superquadratic Infeasible--Interior--Point Method for linear complementarity 37271 problems}, 37272 institution = {Argonne National Laboratory}, 37273 year = {1994}, 37274 annote = {revised}, 37275 number = {MCS--P418--0294}, 37276 address = {Argonne, Illinois}, 37277 type = {Preprint} 37278} 37279 37280@TechReport{ wright:dynfgm, 37281 author = {S. E. Wright}, 37282 title = {{DYNFGM}: Dynamic Finite Generation Method}, 37283 institution = {Department of Mathematics, University of Washington}, 37284 year = {1989}, 37285 address = {Seattle, Washington} 37286} 37287 37288@Article{ wright:infeasible-interior-point, 37289 author = {S. J. Wright}, 37290 title = {An Infeasible--Interior--Point Algorithm for Linear Complementarity Problems}, 37291 journal = {Mathematical Programming}, 37292 volume = {67}, 37293 pages = {29--51}, 37294 year = {1994} 37295} 37296 37297@Article{ wright:path-following, 37298 author = {S. J. Wright}, 37299 title = {A Path--Following Infeasible--Interior--Point Algorithm for Linear 37300 Complementarity Problems}, 37301 journal = {Optimization Methods and Software}, 37302 year = {1993}, 37303 volume = {2}, 37304 pages = {79--106} 37305} 37306 37307@TechReport{ wright:path-following*1, 37308 author = {S. J. Wright}, 37309 title = {A Path--Following Infeasible--Interior--Point Algorithm for Linear and Quadratic 37310 Problems}, 37311 institution = {Argonne National Laboratory}, 37312 year = {1993}, 37313 number = {MCS--P401--1293}, 37314 address = {Argonne, Illinois} 37315} 37316 37317@Book{ wright:primal-dual, 37318 author = {S. J. Wright}, 37319 title = {Primal--Dual Interior--Point Methods}, 37320 year = {1997}, 37321 publisher = {SIAM}, 37322 address = {Philadelphia, Pennsylvania} 37323} 37324 37325@TechReport{ wright:reduced, 37326 author = {S. J. Wright}, 37327 title = {On Reduced Convex QP Formulations of Monotone LCP Problems}, 37328 institution = {Argonne National Laboratory}, 37329 year = {2000}, 37330 number = {MCS--P808--0400}, 37331 address = {Argonne, Illinois} 37332} 37333 37334@Article{ wright:solution, 37335 author = {S. J. Wright}, 37336 title = {Solution of Discrete--Time Optimal Control Problems on Parallel Computers}, 37337 journal = {Parallel Computing}, 37338 year = {1990}, 37339 volume = {16}, 37340 pages = {221--238} 37341} 37342 37343@Article{ wu.bourland:morphology, 37344 author = {Q. J. Wu and J. D. Bourland}, 37345 title = {Morphology-guided radiosurgery treatment planning and optimization for multiple 37346 isocenters}, 37347 journal = {Medical Physics}, 37348 year = {1999}, 37349 volume = {26}, 37350 number = {10}, 37351 pages = {2151--2160} 37352} 37353 37354@Misc{ wunderling:soplex, 37355 author = {R. Wunderling}, 37356 title = {{SOPLEX}: The Sequential Object-Oriented Simplex Class Library}, 37357 howpublished = {http://www.zib.de/Optimization/Software/Soplex/} 37358} 37359 37360@Article{ xiao.harker:nonsmooth, 37361 author = {B. Xiao and P. T. Harker}, 37362 title = {A Nonsmooth {N}ewton Method for Variational Inequalities: {I}: Theory}, 37363 journal = {Mathematical Programming}, 37364 year = {1994}, 37365 volume = {65}, 37366 pages = {151--194} 37367} 37368 37369@Article{ xiao.harker:nonsmooth*1, 37370 author = {B. Xiao and P. T. Harker}, 37371 title = {A Nonsmooth {N}ewton Method for Variational Inequalities: {II}: Numerical 37372 Results}, 37373 journal = {Mathematical Programming}, 37374 year = {1994}, 37375 volume = {65}, 37376 pages = {195--216} 37377} 37378 37379@Article{ xiao.zhou:nonmonotone, 37380 author = {Y. Xiao and F. J. Zhou}, 37381 title = {Nonmonotone Trust Region Methods with Curvilinear Paths in Unconstrained 37382 Minimization}, 37383 journal = {Computing}, 37384 year = {1992}, 37385 volume = {48}, 37386 pages = {303--317} 37387} 37388 37389@TechReport{ xiao:global, 37390 author = {B. Xiao}, 37391 title = {Global {N}ewton methods for nonlinear problems and variational inequalities: a 37392 {B}-differentiable equation approach}, 37393 type = {{Ph.D. Thesis}}, 37394 year = {1990}, 37395 institution = {Department of Decision Sciences, The Warton School, University of Pennsylvania}, 37396 address = {Philadelphia, PA} 37397} 37398 37399@Article{ xu.burke:polynomial, 37400 author = {S. Xu and J. V. Burke}, 37401 title = {A Polynomial Time Interior-Point Path-Following Algorithm for {LCP} based on 37402 {C}hen-{H}arker-{K}anzow Smoothing Techniques}, 37403 year = {1999}, 37404 journal = {Mathematical Programming}, 37405 volume = {86}, 37406 pages = {91--104} 37407} 37408 37409@TechReport{ xu:global, 37410 author = {S. Xu}, 37411 title = {The Global Linear Convergence of an Infeasible Non-Interior Path-Following 37412 Algorithm for Complementarity Problems with Uniform {P}-Functions}, 37413 institution = {Department of Mathematics, University of Washington}, 37414 year = {1996}, 37415 type = {Technical Report}, 37416 address = {Seattle, WA} 37417} 37418 37419@Article{ yajima.konno:efficient, 37420 author = {Y. Yajima and H. Konno}, 37421 title = {Efficient Algorithms for Solving Rank Two and Rank Three Bilinear Programming 37422 Problems}, 37423 journal = {Journal of Global Optimization}, 37424 year = {1991}, 37425 volume = {1:1}, 37426 pages = {155--171} 37427} 37428 37429@Article{ yamamoto:path-following, 37430 author = {Y. Yamamoto}, 37431 title = {A Path--Following Algorithm for Stationary Point Problems}, 37432 journal = {Journal of Operations Society of Japan}, 37433 year = {1987}, 37434 volume = {30}, 37435 pages = {181--198} 37436} 37437 37438@Article{ yamashita.fukushima:modified, 37439 author = {N. Yamashita and M. Fukushima}, 37440 title = {Modified {N}ewton Methods for Solving a Semismooth Reformulation of Monotone 37441 Complementarity Problems}, 37442 journal = {Mathematical Programming}, 37443 year = {1997}, 37444 volume = {76}, 37445 pages = {469--492} 37446} 37447 37448@Article{ yamashita.fukushima:stationary, 37449 author = {N. Yamashita and M. Fukushima}, 37450 title = {On Stationary Points of the Implicit Lagrangian for Nonlinear Complementarity 37451 Problems}, 37452 journal = {Journal of Optimization Theory and Applications}, 37453 volume = {84}, 37454 pages = {653--663}, 37455 year = {1995} 37456} 37457 37458@Article{ yamashita.taji.ea:unconstrained, 37459 author = {N. Yamashita and K. Taji and M. Fukushima}, 37460 title = {Unconstrained Optimization Reformulations of Variational Inequality Problems}, 37461 journal = {Journal of Optimization Theory and Applications}, 37462 year = {1997}, 37463 volume = {92}, 37464 pages = {439--456} 37465} 37466 37467@TechReport{ yamashita:properties, 37468 author = {N. Yamashita}, 37469 title = {Some Properties of the Restricted {NCP}-Functions for the Nonlinear 37470 Complementarity Problem}, 37471 institution = {Department of Applied Mathematics and Physics, Kyoto University}, 37472 year = {1996}, 37473 type = {Technical Report}, 37474 address = {Kyoto, Japan} 37475} 37476 37477@Article{ yang.mackie.ea:investigation, 37478 author = {J. N. Yang and T. R. Mackie and P. Reckwerdt and J. O. Deasy and B. R. 37479 Thomadsen}, 37480 title = {An investigation of tomotherapy beam delivery}, 37481 journal = {Medical Physics}, 37482 year = {1997}, 37483 volume = {24}, 37484 number = {3}, 37485 pages = {425--436} 37486} 37487 37488@Article{ yan.shu.ea:clinical, 37489 author = {Y. Yan and H. Shu and X. Bao}, 37490 title = {Clinical Treatment Planning Optimization by {P}owell's method for {G}amma Unit 37491 Treatmen System}, 37492 journal = {International Journal of Radiation Oncology, Biology and Physics}, 37493 year = {1997}, 37494 volume = {39}, 37495 pages = {247--254} 37496} 37497 37498@Article{ yau.gao:obstacle, 37499 author = {S. T. Yau and Y. Gao}, 37500 title = {Obstacle problem for von {K}arm\'an equations}, 37501 journal = {Advances in Applied Mathematics}, 37502 volume = {13}, 37503 year = {1992}, 37504 pages = {123--141} 37505} 37506 37507@Article{ ye.tse:extension, 37508 author = {Y. Ye and E. Tse}, 37509 title = {An Extension of {K}armarkar's Projective Algorithm for Convex Quadratic 37510 Programming}, 37511 journal = {Mathematical Programming}, 37512 year = {1989}, 37513 volume = {44} 37514} 37515 37516@Article{ ye:affine, 37517 author = {Y. Ye}, 37518 title = {On affine scaling algorithms for nonconvex quadratic programming}, 37519 journal = {Mathematical Programming}, 37520 year = {1992}, 37521 volume = {56}, 37522 pages = {285--300} 37523} 37524 37525@PhDThesis{ ye:interior, 37526 author = {Y. Ye}, 37527 title = {Interior Algorithms for Linear, Quadratic, and Linearly Constrained Convex 37528 Programming}, 37529 year = {1987}, 37530 address = {Stanford, California}, 37531 school = {Department of Engineering--Economic Systems, Stanford University} 37532} 37533 37534@Book{ ye:interior*1, 37535 author = {Y. Ye}, 37536 title = {Interior-Point Algorithms: Theory and Analysis}, 37537 publisher = {John Wiley \& Sons}, 37538 year = {1997}, 37539 address = {New York, NY} 37540} 37541 37542@Article{ yu:convergence, 37543 author = {W. --C. Yu}, 37544 title = {The Convergence Property of the Simplex Evolutionary Techniques}, 37545 journal = {Scientia Sinica, Special issue of Mathematics}, 37546 year = {1979}, 37547 volume = {1}, 37548 pages = {68--77} 37549} 37550 37551@Article{ yu.schell:genetic, 37552 author = {Y. Yu and M. C. Schell}, 37553 title = {A Genetic Algorithm for the Optimization of Prostate Implants}, 37554 journal = {Medical Physics}, 37555 year = {1996}, 37556 volume = {23}, 37557 pages = {2085--2091} 37558} 37559 37560@Article{ yuan:superlinear, 37561 author = {Y. Yuan}, 37562 title = {On the Superlinear Convergence of a Trust Region Algorithm for Nonmooth 37563 Optimization}, 37564 journal = {Mathematical Programming}, 37565 year = {1985}, 37566 volume = {31}, 37567 pages = {269--285} 37568} 37569 37570@Book{ zangwill:nonlinear, 37571 author = {W. I. Zangwill}, 37572 title = {Nonlinear Programming: {A} Unified Approach}, 37573 year = {1969}, 37574 publisher = {Prentice-Hall, Inc}, 37575 address = {Englewood Cliffs, New Jersey} 37576} 37577 37578@TechReport{ zangwill:nonlinear*1, 37579 author = {W. I. Zangwill}, 37580 title = {Nonlinear Programming by Sequential Unconstrained Maximization}, 37581 institution = {Center for Research in Management Science, University of California}, 37582 year = {1965}, 37583 address = {Berkeley}, 37584 number = {131}, 37585 type = {Working Paper} 37586} 37587 37588@Article{ zangwill:nonlinear*2, 37589 author = {W. I. Zangwill}, 37590 title = {Nonlinear Programming via Penalty Functions}, 37591 journal = {Management Science}, 37592 year = {1967}, 37593 volume = {13}, 37594 pages = {344--358} 37595} 37596 37597@TechReport{ zenios.censor:massively, 37598 author = {S. A. Zenios and Y. Censor}, 37599 title = {Massively Parallel Row-Action Algorithms for some Nonlinear Transportation 37600 Problems}, 37601 institution = {decision sciences department, Wharton School, University of Pennsylvania}, 37602 year = {1990}, 37603 type = {report}, 37604 number = {89-09-10}, 37605 address = {Philadelphia, PA} 37606} 37607 37608@Article{ zenios.lasken:nonlinear, 37609 author = {S. A. Zenios and R. A. Lasken}, 37610 title = {Nonlinear Network Optimization on a Massively Parallel {C}onnection {M}achine}, 37611 journal = {Annals of Operations Research}, 37612 year = {1988}, 37613 volume = {14}, 37614 pages = {147--163} 37615} 37616 37617@Article{ zenios.mulvey:distributed, 37618 author = {S. A. Zenios and J. M. Mulvey}, 37619 title = {A Distributed Algorithm for Convex Network Optimization Problems}, 37620 journal = {Parallel Computing}, 37621 year = {1988}, 37622 volume = {6}, 37623 pages = {43--56} 37624} 37625 37626@TechReport{ zenios.neilsen:massively, 37627 author = {S. A. Zenios and S. Neilsen}, 37628 title = {Massively Parallel Algorithms for Singly Constrained Nonlinear Programs}, 37629 institution = {Decision Sciences Department, Wharton School, University of Pennsylvania}, 37630 year = {1990}, 37631 type = {report}, 37632 number = {90-03-01}, 37633 address = {Philadelphia, PA} 37634} 37635 37636@TechReport{ zenios.qi.ea:comparative, 37637 author = {S. A. Zenios and R. Qi and E. D. Chajakis}, 37638 title = {A Comparative Study of Parallel Dual Coordinate Ascent Implementations for 37639 Nonlinear Network Optimization}, 37640 institution = {Decision Sciences Department, Wharton School, University of Pennsylvania}, 37641 year = {1990}, 37642 type = {report}, 37643 number = {89-10-02}, 37644 address = {Philadelphia, PA} 37645} 37646 37647@Article{ zhang.kim.ea:improved, 37648 author = {J. Zhang and N.--H. Kim and L. Lasdon}, 37649 title = {An Improved Successive Linear Programming Algorithm}, 37650 year = {1985}, 37651 journal = {Management Science}, 37652 volume = {31}, 37653 pages = {1312--1331} 37654} 37655 37656@Article{ zhang.tapia.ea:superlinear, 37657 author = {Y. Zhang and R. A. Tapia and F. Potra}, 37658 title = {On the Superlinear Convergence of Interior Points Algorithms for a general class 37659 of problems}, 37660 journal = {SIAM Journal on Optimization}, 37661 year = {1993}, 37662 volume = {3}, 37663 number = {?}, 37664 pages = {413--422}, 37665} 37666 37667@Article{ zhang.tapia:superlinearly, 37668 author = {Y. Zhang and R. A. Tapia}, 37669 title = {A superlinearly convergent polynomial primal-dual interior-point algorirthm for 37670 linear programming}, 37671 journal = {SIAM Journal on Optimization}, 37672 year = {1993}, 37673 volume = {3}, 37674 pages = {118--133} 37675} 37676 37677@TechReport{ zhang.zhang:superlinear, 37678 author = {Y. Zhang and D. Zhang}, 37679 title = {Superlinear convergence of infeasible interior-point methods for linear 37680 programming}, 37681 institution = {Department of Mathematics and Statistics, University of Maryland}, 37682 year = {1992}, 37683 number = {92-15}, 37684 address = {Baltimore County, Maryland} 37685} 37686 37687@Article{ zhang:convergence, 37688 author = {Yin Zhang}, 37689 title = {On the Convergence of a Class of Infeasible Interior--Point Methods for the 37690 Horizontal Linear Complementarity Problem}, 37691 journal = {SIAM Journal on Optimization}, 37692 year = {1994}, 37693 volume = {4}, 37694 pages = {208--227} 37695} 37696 37697@Article{ zhang:convergence*1, 37698 author = {Y. Zhang}, 37699 title = {On the convergence of a class of infeasible interior-point methods for the 37700 horizontal linear complementarity problem}, 37701 journal = {SIAM Journal on Optimization}, 37702 year = {1994}, 37703 volume = {4}, 37704 pages = {208--227} 37705} 37706 37707@Article{ zhu.rockafellar:primal-dual, 37708 author = {C. Y. Zhu and R. T. Rockafellar}, 37709 title = {Primal-Dual Projected Gradient Algorithms for Extended Linear-Quadratic 37710 Programming}, 37711 journal = {SIAM Journal on Optimization}, 37712 year = {1993}, 37713 volume = {3}, 37714 pages = {751--783} 37715} 37716 37717@Article{ zhu:modified, 37718 author = {C. Y. Zhu}, 37719 title = {Modified Proximal Point Algorithm for Extended Linear--Quadratic Programming}, 37720 journal = {Computational Optimization and Applications}, 37721 year = {1992}, 37722 volume = {2}, 37723 pages = {182--205} 37724} 37725 37726@Article{ zhu:primal-dual, 37727 author = {C. Y. Zhu}, 37728 title = {On the Primal--Dual Steepest Descent Algorithm for Extended Linear--Quadratic 37729 Programming}, 37730 journal = {SIAM Journal on Optimization}, 37731 year = {1995}, 37732 volume = {5}, 37733 pages = {114--128} 37734} 37735 37736@Book{ zoutendijk:methods, 37737 author = {G. Zoutendijk}, 37738 title = {Methods of Feasible Directions}, 37739 year = {1960}, 37740 publisher = {Elsevier Publishing Company}, 37741 address = {Amsterdam} 37742} 37743 37744@Article{ zowe.kurcyusz:regularity, 37745 author = {J. Zowe and S. Kurcyusz}, 37746 title = {Regularity and Stability for Mathematical Programming in {B}anach Spaces}, 37747 journal = {Applied Mathematics and Optimization}, 37748 year = {1979}, 37749 volume = {5}, 37750 pages = {49--62} 37751} 37752 37753@InProceedings{ zowe:nondifferentiable, 37754 author = {J. Zowe}, 37755 title = {Nondifferentiable Optimization}, 37756 booktitle = {Computational Mathematical Programming}, 37757 year = {1985}, 37758 editor = {K. Schittkowski}, 37759 publisher = {Springer-Verlag}, 37760 address = {Berlin} 37761} 37762 37763@Proceedings{ bachem.grotschel.ea:mathematical, 37764 booktitle = {Mathematical Programming: The State of the Art, Bonn 1982}, 37765 title = {Mathematical Programming: The State of the Art, Bonn 1982}, 37766 year = {1983}, 37767 editor = {A. Bachem and M. Gr{\"{o}}tchel and B. Korte}, 37768 publisher = {Springer Verlag}, 37769 address = {Berlin} 37770} 37771 37772@Proceedings{ belew.booker:fourth, 37773 year = {1991}, 37774 editor = {R. K. Belew and L. B. Booker}, 37775 publisher = {Morgan Kaufmann Publishers, Inc}, 37776 address = {San Mateo, California}, 37777 booktitle = {Proceedings of the Fourth International Conference on Genetic Algorithms} 37778} 37779 37780@Proceedings{ coleman.li:large-scale, 37781 year = {1990}, 37782 editor = {T. F. Coleman and Y. Li}, 37783 publisher = {SIAM}, 37784 address = {Philadelphia, Pennsylvania}, 37785 note = {Proceedings of the Workshop on Large-Scale Numerical Optimization, Cornell 37786 University, Ithaca, New York, October 19-20, 1989}, 37787 booktitle = {Large-Scale Numerical Optimization} 37788} 37789 37790@Book{ davis:genetic, 37791 title = {Genetic Algorithms and Simulated Annealing}, 37792 year = {1987}, 37793 editor = {L. D. Davis}, 37794 publisher = {Pitman}, 37795 address = {London}, 37796 booktitle = {Genetic Algorithms and Simulated Annealing} 37797} 37798 37799@Proceedings{ ferris.pang:complementarity, 37800 title = {Complementarity and Variational Problems: State of the Art}, 37801 booktitle = {Complementarity and Variational Problems: State of the Art}, 37802 year = {1997}, 37803 key = {57}, 37804 editor = {M. C. Ferris and J. S. Pang}, 37805 publisher = {SIAM Publications}, 37806 address = {Philadelphia, Pennsylvania} 37807} 37808 37809@Proceedings{ ferris.mangasarian.ea:complementarity, 37810 title = {Complementarity: Applications, Algorithms and Extensions}, 37811 booktitle = {Complementarity: Applications, Algorithms and Extensions}, 37812 year = {2001}, 37813 key = {95}, 37814 editor = {M. C. Ferris and O.L. Mangasarian and J. S. Pang}, 37815 publisher = {Kluwer Academic Publishers}, 37816 address = {Dordrecht, The Netherlands} 37817} 37818 37819@Proceedings{ florian:traffic, 37820 title = {Traffic Equilibrium Methods}, 37821 year = {1976}, 37822 editor = {M. Florian}, 37823 publisher = {Springer-Verlag}, 37824 address = {Berlin} 37825} 37826 37827@Proceedings{ grefenstette:genetic, 37828 title = {Genetic Algorithms and their Applications: Proceedings of the Second 37829 International Conference on Genetic Algorithms}, 37830 year = {1987}, 37831 editor = {J. J. Grefenstette}, 37832 publisher = {Lawrence Erlbaum Associates}, 37833 address = {Hillsdale, New Jersey}, 37834 booktitle = {Genetic Algorithms and their Applications: Proceedings of the Second 37835 International Conference on Genetic Algorithms} 37836} 37837 37838@Proceedings{ mangasarian.meyer.ea:nonlinear*2, 37839 booktitle = {Nonlinear Programming}, 37840 volume = {2}, 37841 editor = {O. L. Mangasarian and R. R. Meyer and S. M. Robinson}, 37842 publisher = {Academic Press}, 37843 address = {New York}, 37844 year = {1975} 37845} 37846 37847@Proceedings{ mangasarian.meyer.ea:nonlinear*3, 37848 booktitle = {Nonlinear Programming}, 37849 volume = {3}, 37850 editor = {O. L. Mangasarian and R. R. Meyer and S. M. Robinson}, 37851 publisher = {Academic Press}, 37852 address = {London}, 37853 year = {1978} 37854} 37855 37856@Proceedings{ robinson:local, 37857 title = {Local Structure of Feasible Sets in Nonlinear Programming, {P}art~{I}: 37858 Regularity}, 37859 year = {1983}, 37860 editor = {V. Pereyra and A. Reinoza}, 37861 publisher = {Springer-Verlag}, 37862 address = {Berlin}, 37863 author = {S. M. Robinson}, 37864 pages = {240--251}, 37865 series = {Numerical Methods: Proceedings, Caracas 1982} 37866} 37867 37868@Proceedings{ schaeffer:third, 37869 year = {1989}, 37870 editor = {J. D. Schaeffer}, 37871 publisher = {Morgan Kaufmann Publishers, Inc}, 37872 address = {San Mateo, California}, 37873 booktitle = {Proceedings of the Third International Conference on Genetic Algorithms} 37874} 37875 37876@Book{ vanderbei:linear, 37877 author = {R. J. Vanderbei}, 37878 title = {Linear Programming: Foundations and Extensions}, 37879 year = {1997}, 37880 publisher = {Kluwer Academic Publishers}, 37881 address = {Boston, Massachusetts} 37882} 37883 37884@Book{ dfobook, 37885 title = {Introduction to Derivative-Free Optimization}, 37886 publisher = {Society for Industrial and Applied Mathematics}, 37887 year = {2009}, 37888 author = {Andrew R. Conn and Katya Scheinberg and Lu\'is N. Vicente}, 37889 series = {MPS/SIAM Series on Optimization}, 37890 address = {Philadelphia, PA, USA}, 37891 isbn = {0-89871-460-5} 37892} 37893 37894@Article{ unedf0, 37895 author = {{Kortelainen}, M. and {Lesinski}, T. and {Mor{\'e}}, J. and {Nazarewicz}, W. and 37896 {Sarich}, J. and {Schunck}, N. and {Stoitsov}, M.~V. and {Wild}, S.~M.}, 37897 title = {Nuclear Energy Density Optimization}, 37898 journal = {Physical Review C}, 37899 year = {2010}, 37900 volume = {82}, 37901 number = {2}, 37902 pages = {024313}, 37903 doi = {10.1103/PhysRevC.82.024313} 37904} 37905 37906@Article{ hestenes1969multiplier, 37907 title = {Multiplier and gradient methods}, 37908 author = {Hestenes, Magnus R}, 37909 journal = {Journal of optimization theory and applications}, 37910 volume = {4}, 37911 number = {5}, 37912 pages = {303--320}, 37913 year = {1969}, 37914 publisher = {Springer} 37915} 37916 37917@Article{ powell1969method, 37918 title = {A method for nonlinear constraints in minimization problems}, 37919 author = {Powell, Michael JD}, 37920 journal = {Optimization}, 37921 pages = {283--298}, 37922 year = {1969}, 37923 publisher = {Academic Press} 37924} 37925 37926@Book{ nocedal2006numerical, 37927 title = {Numerical optimization}, 37928 author = {Nocedal, Jorge and Wright, Stephen}, 37929 year = {2006}, 37930 publisher = {Springer Science \& Business Media} 37931} 37932 37933@Article{ rockafellar1974augmented, 37934 title = {Augmented Lagrange multiplier functions and duality in nonconvex programming}, 37935 author = {Rockafellar, R Tyrrell}, 37936 journal = {SIAM Journal on Control}, 37937 volume = {12}, 37938 number = {2}, 37939 pages = {268--285}, 37940 year = {1974}, 37941 publisher = {SIAM} 37942} 37943 37944@Article{ bacuta2006, 37945 title = {A unified approach for Uzawa algorithms}, 37946 author = {Constantin Bacuta}, 37947 journal = {SIAM Journal on Numerical Analysis}, 37948 volume = {44}, 37949 number = {6}, 37950 pages = {2633--2649}, 37951 year = {2006} 37952} 37953 37954@Article{ manteuffelrugesouthworth2018, 37955 title = {Nonsymmetric algebraic multigrid based on local approximate ideal restriction 37956 (AIR)}, 37957 author = {Thomas A Manteuffel and John Ruge and Ben S Southworth}, 37958 journal = {SIAM Journal on Scientific Computing}, 37959 volume = {40}, 37960 number = {6}, 37961 pages = {A4105--A4130}, 37962 year = {2018} 37963} 37964 37965@Article{ manteuffelmunzenmaierrugesouthworth2019, 37966 title = {Nonsymmetric reduction-based algebraic multigrid}, 37967 author = {Thomas A Manteuffel and Steffen M\"unzenmaier and John Ruge and Ben S Southworth}, 37968 journal = {SIAM Journal on Scientific Computing}, 37969 volume = {41}, 37970 number = {5}, 37971 pages = {S242--S268}, 37972 year = {2019} 37973} 37974 37975@PhDThesis{ sivas2021, 37976 title = {Preconditioning of HDG for the Navier–Stokes Equations}, 37977 author = {Abdullah Ali Sivas}, 37978 department = {Applied Mathematics}, 37979 institution = {University of Waterloo}, 37980 year = {2021} 37981} 37982 37983@Article{ brookshughes1982, 37984 title = {Streamline upwind/{Petrov-Galerkin} formulations for convection dominated flows 37985 with particular emphasis on the incompressible {Navier-Stokes} equations}, 37986 author = {Alexander N Brooks and Thomas JR Hughes}, 37987 journal = {Computer methods in applied mechanics and engineering}, 37988 volume = {32}, 37989 number = {1-3}, 37990 pages = {199--259}, 37991 year = {1982}, 37992 publisher = {Elsevier} 37993} 37994 37995@InProceedings{ suhisaac2020, 37996 title = {Evaluation of a minimally synchronous algorithm for 2: 1 octree balance}, 37997 author = {Hansol Suh and Tobin Isaac}, 37998 booktitle = {SC20: International Conference for High Performance Computing, Networking, 37999 Storage and Analysis}, 38000 pages = {1--12}, 38001 year = {2020}, 38002 organization = {IEEE} 38003} 38004 38005@Misc{ alauzet2010, 38006 title = {Metric-Based Anisotropic Mesh Adaptation}, 38007 author = {Fr\'{e}d\'{e}ric Alauzet}, 38008 howpublished = {\url{https://pages.saclay.inria.fr/frederic.alauzet/cours/cea2010_V3.pdf}}, 38009 year = {2010} 38010} 38011 38012@Article{ chan1994qmrcgs, 38013 title = {A quasi-minimal residual variant of the {Bi-CGSTAB} algorithm for nonsymmetric 38014 systems}, 38015 author = {Chan, Tony F and Gallopoulos, Efstratios and Simoncini, Valeria and Szeto, Tedd 38016 and Tong, Charles H}, 38017 journal = {SIAM Journal on Scientific Computing}, 38018 volume = {15}, 38019 number = {2}, 38020 pages = {338--347}, 38021 year = {1994}, 38022 publisher = {SIAM} 38023} 38024 38025@Article{ ghai2019comparison, 38026 title = {A comparison of preconditioned {K}rylov subspace methods for large-scale 38027 nonsymmetric linear systems}, 38028 author = {Ghai, Aditi and Lu, Cao and Jiao, Xiangmin}, 38029 journal = {Numerical Linear Algebra with Applications}, 38030 volume = {26}, 38031 number = {1}, 38032 pages = {e2215}, 38033 year = {2019}, 38034 publisher = {Wiley Online Library} 38035} 38036 38037@Article{ mishrasalacknepley2022, 38038 title = {On the order of accuracy for finite difference approximations of partial 38039 differential equations using stencil composition}, 38040 author = {Abhishek Mishra and David Salac and Matthew G. Knepley}, 38041 journal = {International Journal on Numerical Methods in Engineering}, 38042 note = {Submitted}, 38043 year = {2022} 38044} 38045 38046@Article{ nathawaniknepley2022, 38047 title = {Droplet formation simulation using mixed finite elements}, 38048 author = {Darsh K. Nathawani and Matthew G. Knepley}, 38049 journal = {Physics of Fluids}, 38050 volume = {34}, 38051 pages = {064105}, 38052 doi = {10.1063/5.0089752}, 38053 year = {2022} 38054} 38055 38056@InProceedings{ nathawaniknepley2022b, 38057 title = {Simulating Paraffin Wax Droplets Using Mixed Finite Element Method}, 38058 author = {Darsh K. Nathawani and Matthew G. Knepley}, 38059 booktitle = {Proceeedings of the International Conference on Computational Fluid Dynamics 11 38060 (ICCFD11)}, 38061 editor = {Christoph Brehm and Shishir Pandya}, 38062 number = {4103}, 38063 year = {2022} 38064} 38065 38066@Article{ nathawaniknepley2023, 38067 title = {One-dimensional model to simulate shear-induced droplet formation}, 38068 author = {Darsh K. Nathawani and Matthew G. Knepley}, 38069 journal = {International Journal of Multiphase Flow}, 38070 note = {Submitted}, 38071 year = {2023} 38072} 38073 38074@InProceedings{ georgalisnathawaniknepleypatra2023, 38075 title = {Uncertainty Quantification of Shear-induced Paraffin Droplet Pinch-off in Hybrid Rocket Motors}, 38076 author = {Georgios Georgalis and Darsh K. Nathawani and Matthew G. Knepley and Abani 38077 Patra}, 38078 booktitle = {AIAA SciTech 2024}, 38079 note = {Accepted}, 38080 year = {2023} 38081} 38082 38083@Article{ brownbarrabeamsghaffariknepleymosesshakeristengelthompsonzhang2022, 38084 title = {Performance Portable Solid Mechanics via Matrix-Free $p$-Multigrid}, 38085 author = {Jed Brown and Valeria Barra and Natalie Beams and Leila Ghaffari and Matthew 38086 Knepley and William Moses and Rezgar Shakeri and Karen Stengel and Jeremy L. 38087 Thompson and Junchao Zhang}, 38088 doi = {10.48550/ARXIV.2204.01722}, 38089 url = {https://arxiv.org/abs/2204.01722}, 38090 publisher = {arXiv}, 38091 note = {Submitted}, 38092 year = {2022} 38093} 38094 38095@InCollection{ mayknepley2023, 38096 title = {Numerical Modeling of Subduction}, 38097 author = {Dave A. May and Matthew G. Knepley}, 38098 booktitle = {Dynamics of Plate Tectonics and Mantle Convection}, 38099 editor = {João C. Duarte}, 38100 pages = {539-571}, 38101 isbn = {978-0-323-85733-8}, 38102 doi = {https://doi.org/10.1016/B978-0-323-85733-8.00020-2}, 38103 url = {https://www.sciencedirect.com/science/article/pii/B9780323857338000202}, 38104 year = {2023} 38105} 38106 38107@Article{ adamsknepley2023, 38108 title = {A bespoke multigrid approach for magnetohydrodynamics models of magnetized 38109 plasmas in {PETSc}}, 38110 author = {Mark F. Adams and Matthew G. Knepley}, 38111 url = {https://arxiv.org/abs/2302.10242}, 38112 note = {In preparation}, 38113 year = {2023}, 38114 petsc_uses = {DMPlex} 38115} 38116 38117@Article{ finnknepleypusztayadams2023, 38118 title = {A Numerical Study of {Landau} Damping with {PETSc-PIC}}, 38119 author = {Daniel S. Finn and Matthew G. Knepley and Joseph V. Pusztay and Mark F. Adams}, 38120 url = {https://arxiv.org/abs/2303.12620}, 38121 journal = {Communications in Applied Mathematics and Computational Science}, 38122 note = {Accepted}, 38123 year = {2023} 38124} 38125 38126@Article{ eggersdupont1994, 38127 title = {Drop formation in a one-dimensional approximation of the {Navier--Stokes} 38128 equation}, 38129 author = {Jens Eggers and Todd F. Dupont}, 38130 journal = {Journal of fluid mechanics}, 38131 volume = {262}, 38132 pages = {205--221}, 38133 year = {1994}, 38134 publisher = {Cambridge University Press} 38135} 38136 38137@PhDThesis{ pusztaythesis2023, 38138 title = {A Particle Basis Vlasov-Poisson-Landau Solver for Plasma Simulation in PETSc}, 38139 author = {Joseph V. Pusztay}, 38140 type = {{PhD} thesis}, 38141 school = {University at Buffalo, Department of Computer Science and Engineering}, 38142 address = {Buffalo, NY}, 38143 month = may, 38144 year = {2022} 38145} 38146 38147@PhDThesis{ finnthesis2023, 38148 title = {Structure-Preserving Particle-In-Cell Methods for the Vlasov-Poisson-Landau 38149 System}, 38150 author = {Daniel S. Finn}, 38151 type = {{PhD} thesis}, 38152 school = {University at Buffalo, Program in Computational and Data-Enabled Science and 38153 Engineering}, 38154 address = {Buffalo, NY}, 38155 month = may, 38156 year = {2023} 38157} 38158 38159@PhDThesis{ nathawanithesis2023, 38160 title = {Droplet Formation: One-dimensional Mathematical Model and Computations}, 38161 author = {Darsh Kiritbhai Nathawani}, 38162 type = {{PhD} thesis}, 38163 school = {University at Buffalo, Program in Computational and Data-Enabled Science and 38164 Engineering}, 38165 address = {Buffalo, NY}, 38166 month = may, 38167 year = {2023} 38168} 38169 38170@article{MckayEriksonKozdon2019, 38171 title = {A computational method for earthquake cycles within anisotropic media}, 38172 author = {Maricela Best Mckay and Brittany A Erickson and Jeremy E Kozdon}, 38173 journal = {Geophysical Journal International}, 38174 volume = {219}, 38175 number = {2}, 38176 pages = {816--833}, 38177 year = {2019}, 38178} 38179 38180article{EricksonOReillyNordstrom2019, 38181 title = {Accuracy of stable, high-order finite difference methods for hyperbolic systems with non-smooth wave speeds}, 38182 author = {Brittany A Erickson and Ossian O’Reilly and Jan Nordstr{\"o}m}, 38183 journal = {Journal of Scientific Computing}, 38184 volume = {81}, 38185 pages = {2356--2387}, 38186 year = {2019}, 38187} 38188 38189@article{KozdonEricksonWilcox2021, 38190 title = {Hybridized summation-by-parts finite difference methods}, 38191 author = {Jeremy E Kozdon and Brittany A Erickson and Lucas C Wilcox}, 38192 journal = {Journal of Scientific Computing}, 38193 volume = {87}, 38194 number = {3}, 38195 pages = {85}, 38196 year = {2021}, 38197} 38198 38199@article{SEAS2022, 38200 title = {Community-driven code comparisons for three-dimensional dynamic modeling of sequences of earthquakes and aseismic slip}, 38201 author = {Junle Jiang and Brittany A Erickson and Val{\`e}re R Lambert and Jean-Paul Ampuero and Ryosuke Ando and Sylvain D Barbot and Camilla Cattania and Luca Dal Zilio and Benchun Duan and Eric M Dunham and Alice-Agnes Gabriel and Nadia Lapusta and Duo Li and Meng Li and Dunyu Liu and Yajing Liu and So Ozawa and Casper Pranger and Ylona van Dinther}, 38202 journal = {Journal of Geophysical Research: Solid Earth}, 38203 volume = {127}, 38204 number = {3}, 38205 pages = {e2021JB023519}, 38206 year = {2022}, 38207} 38208 38209@article{EricksonKozdonHarvey2022, 38210 title = {A non-stiff summation-by-parts finite difference method for the scalar wave equation in second order form: Characteristic boundary conditions and nonlinear interfaces}, 38211 author = {Brittany A Erickson and Jeremy E Kozdon and Tobias Harvey}, 38212 journal = {Journal of Scientific Computing}, 38213 volume = {93}, 38214 number = {1}, 38215 pages = {17}, 38216 year = {2022}, 38217} 38218 38219@article{RuckerEriksonKarlstromLeeGopalakrishnan2022, 38220 title = {A Computational Framework for Time-Dependent Deformation in Viscoelastic Magmatic Systems}, 38221 author = {Cody Rucker and Brittany A Erickson and Leif Karlstrom and Brian Lee and Jay Gopalakrishnan}, 38222 journal = {Journal of Geophysical Research: Solid Earth}, 38223 volume = {127}, 38224 number = {9}, 38225 pages = {e2022JB024506}, 38226 year = {2022}, 38227} 38228 38229@article{HarveyEriksonKozdon2023, 38230 title = {A High-order Accurate Summation-by-Parts Finite Difference Method for Fully-dynamic Earthquake Sequence Simulations within Sedimentary Basins}, 38231 author = {Tobias W Harvey and Brittany A Erickson and Jeremy E Kozdon}, 38232 journal = {Journal of Geophysical Research: Solid Earth}, 38233 pages = {e2022JB025357}, 38234 year = {2023}, 38235} 38236 38237@article{SEAS2023, 38238 title = {Incorporating full elastodynamic effects and dipping fault geometries in community code verification exercises for simulations of earthquake sequences and aseismic slip {(SEAS)}}, 38239 author = {Brittany A Erickson and Junle Jiang and Val{\`e}re Lambert and Sylvain D Barbot and Mohamed Abdelmeguid and Martin Almquist and Jean-Paul Ampuero and Ryosuke Ando and Camilla Cattania and Alexandre Chen and Luca Dal Zilio and Shuai Deng and Eric M. Dunham and Ahmed E. Elbanna and Alice‐Agnes Gabriel and Tobias W. Harvey and Yihe Huang and Yoshihiro Kaneko and Jeremy E. Kozdon and Nadia Lapusta and Duo Li and Meng Li and Chao Liang and Yajing Liu and So Ozawa and Andrea Perez‐Silva and Casper Pranger and Paul Segall and Yudong Sun and Prithvi Thakur and Carsten Uphoff and Ylona van Dinther and Yuyun Yang}, 38240 journal = {Bulletin of the Seismological Society of America}, 38241 volume = {113}, 38242 number = {2}, 38243 pages = {499--523}, 38244 year = {2023}, 38245} 38246
