1% 2% This file is formatted by: 3% bibtool petsc.bib -- expand.macros=on -- print.line.length=100 -- pass.comments=on 4% 5% If the reference uses PETSc, include a field listing components used, e.g. 6% petsc_uses = {KSP, SNES, TS, TAO}, 7% 8% For journal names, write out the full name, do not define abbreviations 9% 10% There are some additional historical comments below which may be of interest, 11% particularly in terms of notes about particularly impactful publications using PETSc. 12% 13 14% LiteralHTML: 15% LiteralHTML: <H2><center>Research and Publications that make use of PETSc</center></H2> 16% LiteralHTML: 17% LiteralHTML: <a name="nano"><H3><center>Nano-simulations</center></H3> 18% LiteralHTML: 19@article{WalkerNi2011, 20 title = {Anderson acceleration for fixed-point iterations}, 21 author = {Homer F Walker and Peng Ni}, 22 journal = {SIAM Journal on Numerical Analysis}, 23 volume = {49}, 24 number = {4}, 25 pages = {1715--1735}, 26 year = {2011}, 27 publisher = {SIAM} 28} 29@article{Hua2007, 30 title = {Numerical simulation of microdroplet formation in coflowing immiscible liquids}, 31 author = {Hua, Jinsong and Zhang, Baili and Lou, Jing}, 32 journal = {AIChE Journal}, 33 volume = {53}, 34 number = {10}, 35 pages = {2534--2548}, 36 year = {2007}, 37 publisher = {Wiley Online Library} 38} 39@Article{ openblas, 40 title = {OpenBLAS: A High Performance BLAS Library on Loongson 3A CPU}, 41 journal = {Journal of Software}, 42 volume = {22}, 43 pages = {208--216}, 44 year = {2011}, 45 url = {https://www.jos.org.cn/josen/article/abstract/11042}, 46 author = {ZHANG Xian-Yi and WANG Qian and ZHANG Yun-Quan Richard} 47} 48 49@Misc{ openblas-website, 50 title = {{OpenBLAS}}, 51 key = {OpenBLAS}, 52 howpublished = {\url{https://www.openblas.net}} 53} 54 55@Misc{ openacc-website, 56 title = {{OpenACC}}, 57 key = {OpenACC}, 58 howpublished = {\url{https://www.openacc.org}} 59} 60 61@Misc{ bueler2020petsc, 62 title = {PETSc for Partial Differential Equations: Numerical Solutions in C and Python}, 63 author = {Bueler, Ed}, 64 year = {2020}, 65 publisher = {SIAM}, 66 petsc_uses = {KSP} 67} 68 69@TechReport{ petscforgpuexascale, 70 title = {Toward Performance-Portable PETSc for GPU-based Exascale Systems}, 71 author = {Richard Tran Mills and Mark F. Adams and Satish Balay and Jed Brown and Alp Dener 72 and Matthew Knepley and Scott E. Kruger and Hannah~Morgan and Todd Munson and Karl 73 Rupp and Barry F. Smith and Stefano Zampini and Hong Zhang and Junchao Zhang}, 74 institution = {Argonne National Laboratory}, 75 number = {ANL/MCS-P9401-1020}, 76 note = {\url{https://arxiv.org/abs/2011.00715}}, 77 year = {2020}, 78 petsc_uses = {KSP} 79} 80 81@Article{ mills2021, 82 title = {Toward performance-portable {PETS}c for {GPU}-based exascale systems}, 83 journal = {Parallel Computing}, 84 volume = {108}, 85 pages = {102831}, 86 year = {2021}, 87 issn = {0167-8191}, 88 doi = {https://doi.org/10.1016/j.parco.2021.102831}, 89 url = {https://www.sciencedirect.com/science/article/pii/S016781912100079X}, 90 author = {Richard Tran Mills and Mark F. Adams and Satish Balay and Jed Brown and Alp Dener 91 and Matthew Knepley and Scott E. Kruger and Hannah Morgan and Todd Munson and Karl 92 Rupp and Barry F. Smith and Stefano Zampini and Hong Zhang and Junchao Zhang} 93} 94 95@Article{ rupp:2016:pis:2988256.2907944, 96 author = {Karl Rupp and Josef Weinbub and Ansgar J\"{u}ngel and Tibor Grasser}, 97 title = {Pipelined Iterative Solvers with Kernel Fusion for Graphics Processing Units}, 98 journal = {ACM Trans. Math. Softw.}, 99 issue_date = {September 2016}, 100 volume = {43}, 101 number = {2}, 102 month = aug, 103 year = {2016}, 104 issn = {0098-3500}, 105 pages = {11:1--11:27}, 106 articleno = {11}, 107 numpages = {27}, 108 doi = {10.1145/2907944}, 109 acmid = {2907944}, 110 publisher = {ACM}, 111 address = {New York, NY, USA}, 112 keywords = {BiCGStab method, CUDA, GMRES method, GPU, Iterative solvers, OpenCL, conjugate 113 gradient method}, 114 petsc_uses = {KSP} 115} 116 117@Article{ dalcin2011parallel, 118 title = {Parallel distributed computing using python}, 119 author = {Dalcin, Lisandro D and Paz, Rodrigo R and Kler, Pablo A and Cosimo, Alejandro}, 120 journal = {Advances in Water Resources}, 121 volume = {34}, 122 number = {9}, 123 pages = {1124--1139}, 124 year = {2011}, 125 publisher = {Elsevier}, 126 petsc_uses = {KSP} 127} 128 129@Article{ mendezpongaortiz2018, 130 title = {Diffusive molecular dynamics simulations of lithiation of silicon nanopillars}, 131 author = {JP Mendez and M Ponga and M Ortiz}, 132 journal = {Journal of the Mechanics and Physics of Solids}, 133 year = {2018}, 134 petsc_uses = {KSP} 135} 136 137@TechReport{ morgan2020evaluation, 138 title = {Evaluation of {PETS}c on a Heterogeneous Architecture, the {OLCF} {S}ummit 139 System: Part 1: Vector Node Performance}, 140 author = {Morgan, Hannah Mairs and Mills, Richard Tran and Smith, Barry}, 141 year = {2020}, 142 institution = {Argonne National Laboratory}, 143 url = {https://publications.anl.gov/anlpubs/2020/04/159190.pdf}, 144 petsc_uses = {KSP} 145} 146 147@TechReport{ pdeconstrainedspectraladjoints, 148 title = {PDE constrained optimization, error estimation and control with spectral elements 149 using PETSc and TAO}, 150 author = {Oana Marin and Emil Constantinescu and Barry Smith}, 151 type = {Preprint}, 152 number = {ANL/MCS-P9031-1117}, 153 institution = {ANL}, 154 month = nov, 155 year = {2017}, 156 petsc_uses = {KSP} 157} 158 159@InProceedings{ asc2013, 160 author = {S. Abhyankar and B. F. Smith and E. Constantinescu}, 161 title = {Evaluation of overlapping restricted additive Schwarz preconditioning for 162 parallel solution of very large power flow problems}, 163 booktitle = {HiPCNA-PG’13}, 164 year = {2013}, 165 petsc_uses = {KSP} 166} 167 168@InProceedings{ as2013, 169 author = {S. Abhyankar and B. F. Smith}, 170 title = {{PETSc:} An Advanced Math and Computing Framework for Rapidly Developing Parallel 171 Smart Grid Applications}, 172 booktitle = {Proceedings of the IEEE PES General Meeting}, 173 year = {2013}, 174 petsc_uses = {KSP} 175} 176 177@TechReport{ tspaper, 178 title = {{PETSc/TS}: A Modern Scalable {DAE/ODE} Solver Library}, 179 author = {Shrirang Abhyankar and Jed Brown and Emil Constantinescu and Debojyoti Ghosh and 180 Barry F. Smith}, 181 type = {Preprint}, 182 number = {ANL/MCS-P5061-0114}, 183 institution = {ANL}, 184 month = jan, 185 year = {2014}, 186 petsc_uses = {KSP} 187} 188 189@TechReport{ abhyankaretal2018, 190 author = {Shrirang Abhyankar and Jed Brown and Emil M. Constantinescu and Debojyoti Ghosh 191 and Barry F. Smith and Hong Zhang}, 192 title = {{PETSc/TS}: {A} Modern Scalable {ODE/DAE} Solver Library}, 193 journal = {arXiv e-preprints}, 194 eprint = {1806.01437}, 195 archiveprefix = {arXiv}, 196 year = {2018}, 197 petsc_uses = {KSP} 198} 199 200@Article{ zhang2021cams, 201 title = {Optimal checkpointing for adjoint multistage time-stepping schemes}, 202 author = {Hong Zhang and Emil M. Constantinescu}, 203 journal = {arXiv e-preprints}, 204 eprint = {2202.11890}, 205 archiveprefix = {arXiv}, 206 year = {2022}, 207 petsc_uses = {KSP} 208} 209 210@InProceedings{ zhangconstantinescu2021b, 211 title = {Revolve-based adjoint checkpointing for multistage time integration}, 212 author = {Hong Zhang and Emil M. Constantinescu}, 213 booktitle = {Proceedings of the International Conference on Computational Science (ICCS)}, 214 month = jun, 215 year = {2021}, 216 petsc_uses = {KSP} 217} 218 219@Article{ zhang2022tsadjoint, 220 author = {Zhang, Hong and Constantinescu, Emil M. and Smith, Barry F.}, 221 title = {{PETSc TSAdjoint: A Discrete Adjoint ODE Solver for First-Order and Second-Order 222 Sensitivity Analysis}}, 223 journal = {SIAM Journal on Scientific Computing}, 224 volume = {44}, 225 number = {1}, 226 pages = {C1-C24}, 227 year = {2022}, 228 doi = {10.1137/21M140078X}, 229 petsc_uses = {KSP} 230} 231 232@TechReport{ bb2008, 233 author = {Tomasz Blachowicz and Bartlomiej Baron}, 234 title = {A graphical extension for the Windows version of the Parallel Finite Element 235 Micromagnetics Package (MagParExt)}, 236 url = {http://arxiv.org/abs/0807.2655}, 237 year = {2008}, 238 petsc_uses = {KSP} 239} 240 241@Article{ jacvgv2008, 242 author = {R. Y. Jaafar and A Asenjo and O Chubykalo-Fesenko and M Vazquez and E M Gonzalez 243 and J L Vicent}, 244 title = {Field induced vortex dynamics in magnetic Ni nanotriangles}, 245 journal = {Nanotechnology}, 246 volume = {19}, 247 year = {2008}, 248 doi = {10.1088/0957-4484/19/28/285717}, 249 petsc_uses = {KSP} 250} 251 252@Article{ yjdwh2008, 253 author = {Lin Yuan and Jianjun Jiang and Gang Du and Zhongyou Wang and Huahui He}, 254 title = {Micromagnetic Simulation of Magnetic Particles with Surface Anisotropy}, 255 journal = {Journal of the Magnetics Society of Japan}, 256 volume = {32}, 257 year = {2008}, 258 pages = {50-53}, 259 url = {http://www.jstage.jst.go.jp/article/msjmag/32/2_1/32_50/_article}, 260 petsc_uses = {KSP} 261} 262 263@Article{ mtrtrsa2008, 264 author = {D. Makarov and S. Tibus and C. T. Rettner and T. Thomson and B. D. Terris and T. 265 Schrefl and M. Albrecht}, 266 title = {Magnetic strip patterns induced by focused ion beam irradiation}, 267 journal = {J. Appl. Phys.}, 268 volume = {103}, 269 year = {2008}, 270 doi = {10.1063/1.2894587}, 271 petsc_uses = {KSP} 272} 273 274@InProceedings{ tmrttsa2008, 275 author = {S. Tibus and D. Makarov and C. T. Rettner and T. Thomson and B. D. Terris and T. 276 Schrefl and M. Albrecht}, 277 title = {Patterning of magnetic films by focused ion beam irradiation}, 278 booktitle = {Intermag 2008 paper no. CM-05, submitted to IEEE Trans. Magn.}, 279 year = {2008}, 280 petsc_uses = {KSP} 281} 282 283@Article{ yjdbh2007, 284 author = {Lin Yuan and Jianju Jiang and Yongjiang di and Shaowei Bie and Huahui He}, 285 title = {Micromagnetic simulation of the magnetic dispersion angle and effective damping 286 factor for the single-phase soft magnetic films}, 287 journal = {J. Magn. Magn. Mater.}, 288 volume = {320}, 289 number = {7}, 290 pages = {1393-1397}, 291 doi = {10.1016/j.jmmm.2007.11.025}, 292 petsc_uses = {KSP} 293} 294 295@Article{ lxky2007, 296 author = {DENG Lian-wen and HUANG Xiao-zhong and ZH0U Ke-sheng and YANG}, 297 title = {Micromagnetic simulation and experimental study on microwave permeability of 298 nano-magnetic films}, 299 journal = {Transactions of Nonferrous Metals Society of China}, 300 year = {2007}, 301 pages = {756-759}, 302 url = {http://www.ysxbcn.com/icnfm2007/part2B/s0756.pdf}, 303 petsc_uses = {KSP} 304} 305 306@Article{ yjdwh2008a, 307 author = {Lin Yuan and Jianjun Jiang and Gang Du and Zhongyou Wang and Huahui He}, 308 title = {Micromagnetic Simulation of Magnetic Particles with Surface Anisotropy}, 309 journal = {Journal of the Magnetics Society of Japan}, 310 volume = {32}, 311 year = {2008}, 312 pages = {50-53}, 313 doi = {10.3379/msjmag.32.50}, 314 petsc_uses = {KSP} 315} 316 317@Article{ lylw2007, 318 author = {Ching-Ming Lee and L. X. Ye and J. M. Lee and Te-Ho Wu}, 319 title = {Micromagnetic study of magnetization reversal in patterned DyFeCo thin films}, 320 journal = {Phys. Stat. Sol.}, 321 volume = {204}, 322 number = {12}, 323 pages = {4049-4052}, 324 year = {2007}, 325 doi = {10.1002/pssa.200777359}, 326 petsc_uses = {KSP} 327} 328 329@InProceedings{ sg2007, 330 author = {Simon Greaves}, 331 title = {Micromagnetic Simulations of Magnetic Recording Media}, 332 booktitle = {High Performance Computing on Vector Systems 2007}, 333 doi = {10.1007/978-3-540-74384-2_17}, 334 petsc_uses = {KSP} 335} 336 337@Article{ bsc2007, 338 author = {Nadjib Benatmane and Werner Scholz and T.W. Clinton}, 339 title = {Magnetic Configurations and Phase Diagrams of sub-100 nm NiFe Nanorings}, 340 journal = {IEEE Trans. Magn.}, 341 volume = {43}, 342 year = {2007}, 343 pages = {2884-2886}, 344 doi = {10.1109/TMAG.2007.892867}, 345 petsc_uses = {KSP} 346} 347 348@Article{ ffbf, 349 author = {T. Fischbacher and M. Franchin and G. Bordignon and H. Fangohr}, 350 title = {A Systematic Approach to Multiphysics Extensions of Finite-Element-Based 351 Micromagnetic Simulations: Nmag.}, 352 journal = {IEEE Trans. Magn. Volume}, 353 volume = {43}, 354 pages = {2896-2898}, 355 doi = {10.1109/TMAG.2007.893843}, 356 petsc_uses = {KSP} 357} 358 359@InBook{ dfssfs2006, 360 author = {R. Dittrich and J. Fidler and D. Suess and W. Schol and H. Forster, T. Schrefl}, 361 chapter = {Computational Aspects of Micromagnetics}, 362 title = {The Science of Hysteresis}, 363 editor = { G. Bertotti and I. Mayergoyz}, 364 url = {http://books.elsevier.com/us/elsevier/us/subindex.asp?maintarget=&isbn=0124808743}, 365 petsc_uses = {KSP} 366} 367 368@InBook{ fss, 369 author = {J. Fidler and T. Schrefl and W. Scholz}, 370 chapter = {Computational Micromagnetics}, 371 title = {Handbook of Theoretical and Computational Nanotechnology}, 372 editor = {M. Rieth and W. Schommers}, 373 url = {http://www.amazon.com/gp/product/158883042X}, 374 petsc_uses = {KSP} 375} 376 377@InBook{ shbsef, 378 author = {Thomas Schrefl and Gino Hrkac and Simon Bance and Dieter Suess and Otmar Ertl and 379 Josef Fidler}, 380 chapter = {Numerical Methods in Micromagnetics (Finite Element Method)}, 381 title = {Handbook of Magnetism and Advanced Magnetic Materials}, 382 editor = {Helmut Kronmueller and Stuart Parkin}, 383 doi = {10.1002/9780470022184.hmm203}, 384 petsc_uses = {KSP} 385} 386 387@InBook{ sfs, 388 author = {D. Suess and J. Fidler and T. Schrefl}, 389 chapter = {Micromagnetic Simulation of magnetic materials}, 390 title = {Handbook of Magnetic Materials}, 391 editor = {K. H. J. Buschow}, 392 url = {http://www.amazon.com/gp/product/0444518509}, 393 petsc_uses = {KSP} 394} 395 396@Article{ fsxzs, 397 author = {J. Fernandez-de-Castro and Xiao Shen and Jianhua Xue and Yuming Zhou and S. 398 Sharma}, 399 title = {Writer Flux Closure and Transition Degradation Mechanism in Perpendicular 400 Recording.}, 401 journal = {IEEE Trans. Magn. Volume}, 402 volume = {43}, 403 pages = {2175-2177}, 404 doi = {10.1109/TMAG.2007.893122}, 405 petsc_uses = {KSP} 406} 407 408@Article{ sb2006, 409 author = {W. Scholz and S. Batra}, 410 title = {Effect of write current waveform on magnetization and head field dynamics of 411 perpendicular recording heads}, 412 journal = {IEEE Trans. Magn.}, 413 volume = {42}, 414 year = {2006}, 415 pages = {2264--2266}, 416 url = {http://magnet.atp.tuwien.ac.at/scholz/projects/papers/ieee/scholz_2006_42_2264.pdf}, 417 petsc_uses = {KSP} 418} 419 420@Article{ bsr2006, 421 author = {S. Batra and W. Scholz and T. Roscamp}, 422 title = {Effect of thermal fluctuation field on the noise performance of a perpendicular 423 recording system}, 424 journal = {J. Appl. Phys.}, 425 volume = {99}, 426 year = {2006}, 427 url = {http://magnet.atp.tuwien.ac.at/scholz/projects/papers/jap/batra_2006_99.pdf}, 428 petsc_uses = {KSP} 429} 430 431@InProceedings{ japios2006, 432 author = {F. Johnson and S. Amancherla and G.J. Parker and L.E. Iorio and P.R. 433 Subramanian}, 434 title = {Micromagnetic simulations of the dependence of domain wall width with grain size 435 in systems with cubic and uniaxial anisotropy.}, 436 booktitle = {Intermag 2006 Conference}, 437 petsc_uses = {KSP} 438} 439 440@Article{ kbmb2006, 441 author = {A. Kaya and M. Benakli and M.L. Mallary and J.A. Bain}, 442 title = {A Micromagnetic Study of the Effect of Spatial Variations in Damping in 443 Perpendicular Recording Heads}, 444 journal = {IEEE Trans. Magn.}, 445 volume = {42}, 446 year = {2006}, 447 pages = {2428--2430}, 448 doi = {10.1109/TMAG.2006.879430}, 449 petsc_uses = {KSP} 450} 451 452@Article{ cclcw2006, 453 author = {C. C. Chang and Y. C. Chang and C. M. Lee and C. C. Chen and J. Wu}, 454 title = {Control of Domain Wall Motion in Permalloy Ring}, 455 journal = {IEEE Trans. Magn.}, 456 volume = {42}, 457 year = {2006}, 458 pages = {2960--2962}, 459 doi = {10.1109/TMAG.2006.878414}, 460 petsc_uses = {KSP} 461} 462 463@Article{ bfmfzczg2007, 464 author = {Richard P. Boardman and Hans Fangohr and Matthew J. Fairman and J. Zimmermann and 465 Simon J. Cox and Alexander A. Zhukov and Peter A.J. de Groot}, 466 title = {Micromagnetic modelling of ferromagnetic cones}, 467 journal = {J. Magn. Magn. Mater.}, 468 volume = {312}, 469 year = {2007}, 470 pages = {234-238}, 471 url = {http://eprints.soton.ac.uk/45900/}, 472 petsc_uses = {KSP} 473} 474 475@PhDThesis{ rb2005, 476 author = {Richard Boardman}, 477 title = {Computer simulation studies of magnetic nanostructures}, 478 school = {Computational Engineering and Design Group, School of Engineering Sciences, 479 University of Southampton, United Kingdom}, 480 year = {2005}, 481 url = {http://www.soton.ac.uk/~rpb/thesis.pdf}, 482 petsc_uses = {KSP} 483} 484 485@InProceedings{ cwwy2006, 486 author = {I-Hsin Chung and Robert E. Walkup and Hui-Fang Wen and Hao Yu}, 487 title = {MPI Performance Analysis Tools on Blue Gene/L}, 488 booktitle = {ACM/IEEE SC 2006 Conference (SC'06)}, 489 year = {2006}, 490 url = {http://sc06.supercomputing.org/schedule/pdf/pap159.pdf}, 491 petsc_uses = {KSP} 492} 493 494@InProceedings{ ch2006, 495 author = {I.-H. Chung and J.K. Hollingsworth}, 496 title = {A Case Study Using Automatic Performance Tuning for Large-Scale Scientific 497 Programs}, 498 booktitle = {High Performance Distributed Computing, 2006 15th IEEE International Symposium}, 499 pages = {45--56}, 500 doi = {10.1109/HPDC.2006.1652135}, 501 petsc_uses = {KSP} 502} 503 504@Article{ lkpl2005, 505 author = {C. K. Lim and Y. S. Kim and N. Y. Park and J. Lee}, 506 title = {Multibit MRAM using a pair of memory cells}, 507 journal = {IEEE Trans. Magn.}, 508 volume = {41}, 509 year = {2005}, 510 pages = {2670-2672}, 511 doi = {10.1109/TMAG.2005.855288}, 512 petsc_uses = {KSP} 513} 514 515@Article{ gscn2005, 516 author = {K. Yu. Guslienko and W. Scholz and R. W. Chantrell and V. Novosad}, 517 title = {Vortex state oscillations in soft magnetic cylindrical dots}, 518 journal = {Phys. Rev. B}, 519 volume = {71}, 520 year = {2005}, 521 doi = {10.1103/PhysRevB.71.144407}, 522 petsc_uses = {KSP} 523} 524 525@PhDThesis{ mda, 526 author = {Massimiliano d'Aquino}, 527 title = {Nonlinear Magnetization Dynamics in Thin-Films and Nanoparticles}, 528 school = { Universita di Napoli Federico II.}, 529 url = {http://www.fedoa.unina.it/148/01/d_Aquino_thesis.pdf}, 530 petsc_uses = {KSP} 531} 532 533@TechReport{ ssdfssf2003, 534 author = {T. Schrefl and W. Scholz and R. Dittrich and H. Forster and D. Suess and M. 535 Stehno and J. Fidler}, 536 title = {Micromagnetic Simulations of Domainstructures in Softmagnetic Thin Films}, 537 url = {http://www.zid.tuwien.ac.at/projekte/2003/03-138-1.html}, 538 petsc_uses = {KSP} 539} 540 541@InProceedings{ sb2006a, 542 author = {W. Scholz and S. Batra}, 543 title = {Effect of write current waveform on magnetization and head field dynamics of 544 perpendicular recording heads}, 545 booktitle = {Intermag 2006 Conference, San Diego, CA, paper no. EF-03}, 546 petsc_uses = {KSP} 547} 548 549@Article{ scholz-batra1, 550 author = {W. Scholz and S. Batra}, 551 title = {Micromagnetic Simulation of Head Field and Write Bubble Dynamics in Perpendicular 552 Recording}, 553 journal = {IEEE Trans. Magn.}, 554 note = {submitted}, 555 year = {2005}, 556 petsc_uses = {KSP} 557} 558 559@Article{ scholz-batra2, 560 author = {W. Scholz and S. Batra}, 561 title = {Micromagnetic Modeling of Head Field Rise Time for High Data-Rate Recording}, 562 journal = {IEEE Trans. Magn.}, 563 volume = {41}, 564 year = {2005}, 565 pages = {702-706}, 566 petsc_uses = {KSP} 567} 568 569@Article{ daquino-scholz1, 570 author = {M. d'Aquino and W. Scholz and T. Schrefl and C. Serpico and J. Fidler}, 571 title = {Micromagnetic Analysis of Fast Precessional Switching}, 572 journal = {J. Magn. Magn. Mater.}, 573 volume = {290-291}, 574 year = {2005}, 575 pages = {510-513}, 576 petsc_uses = {KSP} 577} 578 579@Article{ aq-scholz-fid, 580 author = {M. d'Aquino and W. Scholz and T. Schrefl and C. Serpico and J. Fidler}, 581 title = {Numerical and analytical study of fast precessional switching}, 582 journal = {J. Appl. Phys.}, 583 volume = {95}, 584 year = {2004}, 585 pages = {7055-7057}, 586 petsc_uses = {KSP} 587} 588 589@InProceedings{ gar-tabik-gar, 590 author = {E. M. Garzon and S. Tabik and I. Garcia and A. R. Bretones}, 591 title = {Multiprocessing of the Time Domain Analysis of Thin-Wire Antennas and 592 Scatterers}, 593 booktitle = {12th Euromicro Conference on Parallel, Distributed and Network-Based Processing 594 (PDP'04)}, 595 year = {2004}, 596 pages = {80--}, 597 petsc_uses = {KSP} 598} 599 600@InProceedings{ aq-scholz-mia, 601 author = {M. d'Aquino and W. Scholz and T. Schrefl and C. Serpico and G. Miano}, 602 title = {Analysis of fast precessional switching in magnetic thin films}, 603 booktitle = {Proceedings of PIERS (Progress In Electromagnetic Research Symposium)}, 604 year = {2004}, 605 pages = {257-260}, 606 petsc_uses = {KSP} 607} 608 609@Article{ scholz-fid-seus, 610 author = {W. Scholz and J. Fidler and T. Schrefl and D. Suess and H. Forster and R. 611 Dittrich and V. Tsiantos}, 612 title = {Numerical Micromagnetic Simulation of Fe-Pt Nanoparticles with Multiple Easy 613 Axes}, 614 journal = {J. Magn. Magn. Mater.}, 615 year = {2004}, 616 pages = {1524-1525}, 617 petsc_uses = {KSP} 618} 619 620@Article{ boardman-zimmerman, 621 author = {Richard Boardman and Juergen Zimmermann and Hans Fangohr and Alexander Zhukov and 622 Peter de Groot}, 623 title = {Micromagnetic simulation studies of ferromagnetic part-spheres}, 624 journal = {Journal of Applied Physics}, 625 year = {2005}, 626 petsc_uses = {KSP} 627} 628 629@Article{ lim-kim-park, 630 author = {C. K. Lim and Y. S. Kim and N. Y. Park and J. Lee}, 631 title = {High Density Magnetic Random Access Memory Using a Pair of Asymmetrical Cell}, 632 journal = {IEEE Trans. Magn.}, 633 note = {submitted}, 634 petsc_uses = {KSP} 635} 636 637@Article{ scholz-suess2, 638 author = {W. Scholz and D. Suess and T. Schrefl and and J. Fidler}, 639 title = {Micromagnetic simulation of magnetization reversal in small particles with 640 surface anisotropy}, 641 journal = {J. Appl. Phys.}, 642 volume = {95}, 643 year = {2004}, 644 pages = {6807-6809}, 645 petsc_uses = {KSP} 646} 647 648@Article{ scholz-schrefl1, 649 author = {W. Scholz and T. Schrefl and J. Fidler and T. Matthias and D. Suess and V. 650 Tsiantos}, 651 title = {Micromagnetic simulation of the pinning and depinning process in permanent 652 magnets}, 653 journal = {IEEE Trans. Magn.}, 654 volume = {39}, 655 year = {2003}, 656 pages = {2920-2922}, 657 petsc_uses = {KSP} 658} 659 660@Article{ scholz-guslienko, 661 author = {W. Scholz and K. Y. Guslienko and V. Novosad and D. Suess and T. Schrefl and R. 662 W. Chantrell and J. Fidler}, 663 title = {Transition from single-domain to vortex state in soft magnetic cylindrical 664 nanodots}, 665 journal = {J. Magn. Magn. Mater.}, 666 volume = {266}, 667 year = {2003}, 668 pages = {155-163}, 669 petsc_uses = {KSP} 670} 671 672@Article{ scholz1, 673 author = { W. Scholz and J. Fidler and T. Schrefl and D. Suess and R. Dittrich and H. 674 Forster and V. Tsiantos}, 675 title = {Scalable Parallel Micromagnetic Solvers for Magnetic Nanostructures}, 676 journal = {Comp. Mat. Sci}, 677 year = {2003}, 678 pages = {366--383}, 679 volume = {28}, 680 url = {http://magnet.atp.tuwien.ac.at/scholz/projects/papers/preprint/scholz/cms03/magpar.pdf}, 681 petsc_uses = {KSP} 682} 683 684@PhDThesis{ scholz2, 685 author = {W. Scholz}, 686 title = {Scalable Parallel Micromagnetic Solvers for Magnetic Nanostructures}, 687 school = {Vienna University of Technology, Vienna, Austria}, 688 year = {2003}, 689 petsc_uses = {KSP} 690} 691 692@Article{ scholz3, 693 author = {W. Scholz and D. Suess and R. Dittrich and T. Schrefl and V. Tsiantos and H. 694 Forster and J. Fidler}, 695 title = {Implementation of a high performance parallel finite element micromagnetics 696 package}, 697 journal = {J. Magn. Magn. Mater.}, 698 year = {2004}, 699 url = {http://magnet.atp.tuwien.ac.at/scholz/projects/papers/preprint/scholz/icm2003/scholz_petsc.pdf}, 700 petsc_uses = {KSP} 701} 702 703% LiteralHTML: <td width="100%" colspan="2"><hr size="4" color="#FF5B5B"> </td> 704@InBook{ zhanggladwell1, 705 author = {W. Zhang and I. Gladwell}, 706 chapter = {Performance of MOL for Surface Motion Driven by a Laplacian of Curvature}, 707 editor = {Z. Chen and R.E. Ewing and Z.-C. Shi}, 708 year = {2000}, 709 title = {Numerical Treatment of Multiphase Flows in Porous Media, Lecture Notes in 710 Physics, vol. 552}, 711 publisher = {Springer}, 712 pages = {4190-}, 713 petsc_uses = {KSP} 714} 715 716@Article{ wolf1, 717 author = {A. J. Haslan and D. Moldovan and S. R. Phillpot and V. Yamakov}, 718 title = {Combined Atomistic and Mesoscale simulation of grain growth in nanocrystalline 719 thin films}, 720 journal = {Phil. Mag. A}, 721 year = {2003}, 722 lab = {ANL}, 723 petsc_uses = {KSP} 724} 725 726@Article{ wolf2, 727 author = {A. J. Haslan and D. Moldovan and S. R. Phillpot and H. Gleiter}, 728 title = {Mesoscopic simulation of two dimensional grain growth with anisotropic 729 grain-boundary properties}, 730 journal = {Computational Materials Science}, 731 year = {2001}, 732 volume = {23}, 733 pages = {15--32}, 734 lab = {ANL}, 735 petsc_uses = {KSP} 736} 737 738@Article{ wolf3, 739 author = {D. Moldovan and S. R. Phillpot and A. J. Haslan}, 740 title = {Role of grain rotation in grain growth by mesoscale simulation}, 741 journal = {Phil. Mag. A}, 742 year = {2002}, 743 volume = {82}, 744 pages = {1271--1297}, 745 lab = {ANL}, 746 petsc_uses = {KSP} 747} 748 749% LiteralHTML: <td width="100%" colspan="2"><hr size="4" color="#FF5B5B"> </td> 750@Article{ saut, 751 author = { Olivier Saut}, 752 title = {Bidimensional Study of the Maxwell-Bloch Model in a Nonlinear Crystal}, 753 journal = {SIAM Journal on Scientific Computing}, 754 year = {2004}, 755 note = {submitted}, 756 url = {http://mip.ups-tlse.fr/\~{ }saut/data/sisc04.pdf}, 757 petsc_uses = {KSP} 758} 759 760% LiteralHTML: 761% LiteralHTML: <a name="biology"><H3><center>Biology -- Medical</center></H3> 762% LiteralHTML: 763@InBook{ khanallorenziayachepennec2016, 764 title = {Simulating Patient Specific Multiple Time-Point {MRIs} from a Biophysical Model 765 of Brain Deformation in {Alzheimer's} Disease}, 766 booktitle = {Computational Biomechanics for Medicine: Imaging, Modeling and Computing}, 767 author = {Bishesh Khanal and Marco Lorenzi and Nicholas Ayache and Xavier Pennec}, 768 editor = {Grand R. Joldes and Barry Doyle and Adam Wittek and Poul M.F. Nielsen and Karol 769 Miller}, 770 pages = {167--176}, 771 isbn = {978-3-319-28329-6}, 772 doi = {10.1007/978-3-319-28329-6_15}, 773 publisher = {Springer International Publishing}, 774 year = {2016}, 775 petsc_uses = {KSP} 776} 777 778@Article{ ataseven, 779 author = {Y. Ataseven and Z. Akaliota n-Acar and C.~E. Acar and N. G. Gen\c{c}er}, 780 title = {Parallel implementation of the accelerated BEM approach for EMSI of the human 781 brain}, 782 journal = {Medical and Biological Engineering and Computing}, 783 month = feb, 784 year = {2008}, 785 doi = {10.1007/s11517-008-0316-0}, 786 petsc_uses = {KSP} 787} 788 789@Article{ dennis-eberhart-03, 790 author = {B. H. Dennis and R. C. Eberhart and G. S. Dulikravich and S.W. Radons}, 791 pages = {832-840}, 792 volume = {125}, 793 number = {6}, 794 title = {Finite-element simulation of cooling of realistic 3-D human head and neck}, 795 journal = {J Biomech Eng}, 796 year = {2003}, 797 url = {http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?cmd=Retrieve&db=PubMed&list_uids=14986408&dopt=Citation}, 798 petsc_uses = {KSP} 799} 800 801@Conference{ gu7174parallel, 802 title = {{A parallel reduced-space sequential-quadratic programming algorithm for 803 frequency-domain small animal optical tomography}}, 804 author = {Gu, X. and Kim, H.K. and Masciotti, J. and Hielscher, A.H.}, 805 booktitle = {Proc. of SPIE Vol}, 806 volume = {7174}, 807 number = {717406}, 808 pages = {1}, 809 petsc_uses = {KSP} 810} 811 812@Article{ barchanski2005using, 813 title = {{Using domain decomposition techniques for the calculation of low-frequency 814 electric current densities in high-resolution 3D human anatomy models}}, 815 author = {Barchanski, A. and Clemens, M. and De Gersem, H. and Steiner, T. and Weiland, 816 T.}, 817 journal = {COMPEL: The International Journal for Computation and Mathematics in Electrical 818 and Electronic Engineering}, 819 volume = {24}, 820 number = {2}, 821 pages = {458--467}, 822 issn = {0332-1649}, 823 year = {2005}, 824 publisher = {Emerald Group Publishing Limited}, 825 petsc_uses = {KSP} 826} 827 828@Article{ motrescurienen05, 829 author = {V. C. Motrescu and U. van Rienen}, 830 pages = {227--231}, 831 volume = {3}, 832 title = {Computation of currents induced by ELF electric fields in anisotropic human 833 tissues using the Finite Integration Technique}, 834 journal = {Advances in Radio Science}, 835 year = {2005}, 836 url = {http://www.copernicus.org/URSI/ars/3/ars-3-227.pdf}, 837 petsc_uses = {KSP} 838} 839 840@Article{ motrescurienen04, 841 author = {V. C. Motrescu and U. van Rienen}, 842 pages = {309--313}, 843 volume = {2}, 844 title = {Computation of electrostatic fields in anisotropic human tissues using the Finite 845 Integration Technique (FIT)}, 846 journal = {Advances in Radio Science}, 847 year = {2004}, 848 url = {http://www.copernicus.org/URSI/ars/ARS_2_1/309.pdf}, 849 petsc_uses = {KSP} 850} 851 852@InProceedings{ dbl2, 853 author = {Enzo A. Dari and Mariano I. Cantero and Raul A. Feijoo}, 854 title = {Computational arterial flow modeling using a parallel {Navier-Stokes} solver}, 855 booktitle = {ECCOMAS2000}, 856 year = {2000}, 857 url = {http://146.134.8.133/Feijoo/CModComplexos/Conferencias/ECCOMAS2000/Darie/eccomas.html}, 858 petsc_uses = {KSP} 859} 860 861@Unpublished{ cell, 862 title = {Parallel Simulation Engines for Whole-Cell Models}, 863 author = {Markus Schwehm and Nils Gehlenborg and Hendrik Post and Amelie Stein and Kirstin 864 Weber}, 865 note = {Poster at Second International Conference on Systems Biology (ICSB) 2001}, 866 url = {http://www.icsb-2001.org/Posters/110_schwehm2.pdf}, 867 institution = {University of Tubingen, ZBIT - Zentrum fur Bioinformatik Tubingen}, 868 year = {2001}, 869 petsc_uses = {KSP} 870} 871 872@Article{ barker2010two, 873 title = {Two-level Newton and hybrid Schwarz preconditioners for fluid-structure 874 interaction}, 875 author = {Barker, A.T. and Cai, X.C.}, 876 journal = {SIAM Journal on Scientific Computing}, 877 volume = {32}, 878 number = {4}, 879 pages = {2395--2417}, 880 year = {2010}, 881 publisher = {Society for Industrial and Applied Mathematics}, 882 petsc_uses = {KSP} 883} 884 885@Article{ barker2010scalable, 886 title = {Scalable parallel methods for monolithic coupling in fluid-structure interaction 887 with application to blood flow modeling}, 888 author = {Barker, A.T. and Cai, X.C.}, 889 journal = {Journal of Computational Physics}, 890 volume = {229}, 891 number = {3}, 892 pages = {642--659}, 893 year = {2010}, 894 publisher = {Elsevier}, 895 petsc_uses = {KSP} 896} 897 898@Article{ barker2009nks, 899 title = {NKS for fully coupled fluid-structure interaction with application}, 900 author = {Barker, A.T. and Cai, X.C.}, 901 journal = {Domain Decomposition Methods in Science and Engineering XVIII}, 902 pages = {275--282}, 903 year = {2009}, 904 publisher = {Springer}, 905 petsc_uses = {KSP} 906} 907 908@Article{ mirams2013, 909 author = {Chris Luscombe and Geoff Williams and Jordi Munoz-Muriedas and David J Gavaghan 910 and Yi Cui and Gary R Mirams}, 911 title = {Evaluation of an in silico cardiac safety assay: using ion channel screening data 912 to predict QT interval changes in the rabbit ventricular wedge}, 913 journal = {Journal of pharmacological and toxicological methods}, 914 volume = {68}, 915 number = {1}, 916 pages = {88--96}, 917 year = {2013}, 918 doi = {10.1016/j.vascn.2013.04.004}, 919 petsc_uses = {KSP} 920} 921 922% LiteralHTML: <td width="100%" colspan="2"><hr size="4" color="#FF5B5B"> </td> 923% LiteralHTML: <center><img alt="" 924% LiteralHTML: src="images/spine0l.jpg"></center></p> 925% LiteralHTML: <center><img alt="" 926% LiteralHTML: src="images/vertebra.jpg"></center></p> 927% LiteralHTML:<font color="#FF0000"> 928% LiteralHTML:Treating fractures of the hip and spine is a major medical cost. 929% LiteralHTML:Understanding bone mechanical properties and how they may lead to 930% LiteralHTML:fractures is thus an important medical research activity. PETSc and 931% LiteralHTML:Prometheus have been used for extremely large scale finite element 932% LiteralHTML:simulation of the solid mechanics of a portion of a human spine by a 933% LiteralHTML:team of doctors and computational scientists. This computation was 934% LiteralHTML:a winner of a Gordon Bell Special Prize at SC2004 and ran scalably 935% LiteralHTML:with over 4000 processors.</p> 936% LiteralHTML: </font> 937@Article{ arbenz2008scalable, 938 title = {A scalable multi-level preconditioner for matrix-free $\mu$-finite element 939 analysis of human bone structures}, 940 author = {Arbenz, P. and van Lenthe, G.H. and Mennel, U. and M{\\"u}ller, R. and Sala, M.}, 941 journal = {International Journal for Numerical Methods in Engineering}, 942 volume = {73}, 943 number = {7}, 944 pages = {927--947}, 945 year = {2008}, 946 publisher = {Wiley Online Library}, 947 petsc_uses = {KSP} 948} 949 950@InProceedings{ adams-04, 951 author = {Adams, M.~F. and Bayraktar, H.H. and Keaveny, T.M. and Papadopoulos, P.}, 952 booktitle = {ACM/IEEE Proceedings of SC2004: High Performance Networking and Computing}, 953 title = {Ultrascalable implicit finite element analyses in solid mechanics with over a 954 half a billion degrees of freedom}, 955 note = {Gordon Bell Award}, 956 year = {2004}, 957 petsc_uses = {KSP} 958} 959 960@InProceedings{ adams-03b, 961 author = {Adams, M.~F. and Bayraktar, H.H. and Keaveny, T.M. and Papadopoulos, P.}, 962 title = {Applications of Algebraic Multigrid to Large-Scale Finite Element Analysis of 963 Whole Bone Micro-Mechanics on the IBM SP}, 964 booktitle = {ACM/IEEE Proceedings of SC2003: High Performance Networking and Computing}, 965 year = {2003}, 966 petsc_uses = {KSP} 967} 968 969@InProceedings{ oghattas2002, 970 author = {Volkan Akcelik and George Biros and Omar Ghattas}, 971 title = {Parallel Multiscale {Gauss-Newton-Krylov} Methods For Inverse Wave Propagation}, 972 booktitle = {Procceedings of SC2002}, 973 url = {http://www-2.cs.cmu.edu/\~{ }oghattas/papers/sc2002.pdf}, 974 note = {Winner of SC2002 Best Paper. A parallel algorithm for inverse problems governed 975 by time-dependent PDEs, and scalability results for an inverse wave propagation 976 problem of determining the material field of an acoustic medium. Using the 977 algorithm, they solved a synthetic inverse wave propagation problem though a 978 pelvic bone geometry involving 2.1 million inversion parameters in 3 hours on 256 979 processors.}, 980 year = {2002}, 981 petsc_uses = {KSP} 982} 983 984% LiteralHTML: <a name="biology:cardiology"> 985% LiteralHTML: <td width="100%" colspan="2"><hr size="4" color="#FF5B5B"> </td> 986% LiteralHTML: <center><img alt="" 987% LiteralHTML: src="images/heart.jpg"> 988% LiteralHTML: <img alt="" 989% LiteralHTML: src="images/pump.jpg"></center></p> 990% LiteralHTML: 991% LiteralHTML:<font color="#FF0000"> 992% LiteralHTML: Arrhythmias are disorders of the regular rhythmic beating of the 993% LiteralHTML: heart; they are the cause of the majority of sudden cardiac 994% LiteralHTML: deaths. The heart beat is controlled by electrical signals moving 995% LiteralHTML: through the heart. PETSc has been used by several research groups to 996% LiteralHTML: simulate the electronic behavior of the heart in an attempt to more 997% LiteralHTML: fully understand the developments of arrhthmias.</p> 998% LiteralHTML:</font> 999@InProceedings{ oghattas2000, 1000 author = {J. Antaki and G. Belloch and O. Ghattas and I. Malcevic and G. Miller and N. 1001 Walkington}, 1002 title = {A Parallel Dynamic-Mesh Lagrangian Method for Simulation of Flows with Dynamic 1003 Interfaces}, 1004 booktitle = {Procceedings of SC2000}, 1005 url = {http://www.cs.cmu.edu/\~{ }oghattas/papers/sc2000/sc2000.pdf}, 1006 note = {Blood flow modeling at the microscale including effects on individual blood 1007 cells, for designing heart assist pumps, etc.}, 1008 year = {2000}, 1009 petsc_uses = {KSP} 1010} 1011 1012@InBook{ cfps2006, 1013 author = {P. Colli Franzone and L. F. Pavarino and G. Savare}, 1014 editor = {A. Quarteroni et al.}, 1015 title = {Complex Systems in Biomedicine}, 1016 chapter = {Computational Electrocardiology: mathematical and numerical modeling}, 1017 publisher = {Springer-Verlag}, 1018 pages = {187--241}, 1019 year = {2006}, 1020 petsc_uses = {KSP} 1021} 1022 1023@InProceedings{ cfpst2007, 1024 author = {P. Colli Franzone and L. F. Pavarino and S. Scacchi and B. Taccardi}, 1025 title = {Determining recovery times from transmembrane action potentials and unipolar 1026 electrograms in normal heart tissue}, 1027 booktitle = {FIMH07}, 1028 publisher = {Springer-Verlag}, 1029 volume = {4466}, 1030 pages = {139--149}, 1031 year = {2007}, 1032 petsc_uses = {KSP} 1033} 1034 1035@Article{ seemann2010framework, 1036 title = {{Framework for Modular, Flexible and Efficient Solving the Cardiac Bidomain 1037 Equations Using PETSc}}, 1038 author = {Seemann, G. and Sachse, FB and Karl, M. and Weiss, DL and Heuveline, V. and 1039 D{\\"o}ssel, O.}, 1040 journal = {Progress in Industrial Mathematics at ECMI 2008}, 1041 pages = {363--369}, 1042 year = {2010}, 1043 publisher = {Springer}, 1044 petsc_uses = {KSP} 1045} 1046 1047@InProceedings{ pft2005, 1048 author = {Luca F. Pavarino and Piero Colli Franzone and Bruno Taccardi}, 1049 title = {Monodomain Simulations of Excitation and Recovery in Cardiac Blocks with 1050 Intramural Heterogeneity}, 1051 booktitle = {Functional Imaging and modeling of the Heart (FIMH05)}, 1052 pages = {267--277}, 1053 editors = {A. Frangi et al.}, 1054 publisher = {Springer, Lecture Notes in Computer Science (LNCS), v. 3504}, 1055 year = {2005}, 1056 petsc_uses = {KSP} 1057} 1058 1059@Article{ bgcp2005, 1060 author = {Boyce E. Griffith and Charles S. Peskin}, 1061 title = {On the order of accuracy of the immersed boundary method: Higher order 1062 convergence rates for sufficiently smooth problems}, 1063 journal = {Journal of Computational Physics}, 1064 year = {2005}, 1065 volume = {208}, 1066 pages = {75--105}, 1067 petsc_uses = {KSP} 1068} 1069 1070@Article{ griffith2007adaptive, 1071 title = {An adaptive, formally second order accurate version of the immersed boundary 1072 method}, 1073 author = {Griffith, B.E. and Hornung, R.D. and McQueen, D.M. and Peskin, C.S.}, 1074 journal = {Journal of Computational Physics}, 1075 volume = {223}, 1076 number = {1}, 1077 pages = {10--49}, 1078 year = {2007}, 1079 publisher = {Elsevier}, 1080 petsc_uses = {KSP} 1081} 1082 1083@PhDThesis{ griffith05, 1084 author = {Boyce Griffith}, 1085 title = {Simulating the blood-muscle-valve mechanics of the heart by an adaptive and 1086 parallel version of the immersed boundary method}, 1087 school = {New York University}, 1088 year = {2005}, 1089 petsc_uses = {KSP} 1090} 1091 1092@PhDThesis{ murillo, 1093 author = {Maria S. Murillo}, 1094 title = {Parallel Algorithms and Software for Time-Dependent System of Nonlinear Partial 1095 Differential Equations with an Application in Computational Biology}, 1096 school = {University of Colorado at Boulder}, 1097 year = {2002}, 1098 petsc_uses = {KSP} 1099} 1100 1101@Article{ spv2004, 1102 author = {Rodrigo Weber Dos Santos and G. Plank and S. Bauer}, 1103 title = {Parallel multigrid preconditioner for the cardiac bidomain model}, 1104 journal = {IEEE Trans. Biomed. Eng}, 1105 year = {2004}, 1106 volume = {51}, 1107 pages = {1960--1968}, 1108 petsc_uses = {KSP} 1109} 1110 1111@Article{ vphl2003, 1112 author = {E. J. Vigmond and M. Hughes and G. Plank, L.J. Leon}, 1113 title = { Computational Tools for Modeling Electrical Activity in Cardiac Tissue}, 1114 journal = {J. Electrocardiol.}, 1115 year = {2003}, 1116 volume = {36}, 1117 pages = {69--74}, 1118 petsc_uses = {KSP} 1119} 1120 1121@InProceedings{ spbv2003, 1122 author = {Rodrigo Weber Dos Santos and G. Plank and S. Bauer and and E.J. Vigmond}, 1123 title = {Preconditioning Techniques for the Bidomain Equations}, 1124 booktitle = {Proceedings of the 15th International Conference on Domain Decomposition 1125 Methods}, 1126 pages = {571--580}, 1127 publisher = {Springer, Lecture Notes in Computational Science and Engineering (LNCSE).}, 1128 note = {}, 1129 url = {http://www.ddm.org/DD15/proceedings-dd15.html}, 1130 year = {2003}, 1131 petsc_uses = {KSP} 1132} 1133 1134@Article{ franz-pavir-04, 1135 author = {P. Colli Franzone and L.~F. Pavarino}, 1136 title = {A parallel solver for reaction-diffusion systems in computational 1137 electrocardiology}, 1138 journal = {Mathematical Models and Methods in Applied Sciences}, 1139 year = {2004}, 1140 volume = {14}, 1141 number = {6}, 1142 pages = {883--912}, 1143 petsc_uses = {KSP} 1144} 1145 1146@Article{ franz-pavir-05, 1147 author = {P. Colli Franzone and L.~F. Pavarino and B. Taccardi}, 1148 title = {Simulating patterns of excitation, repolarization and action potential 1149 durationwith cardiac Bidomain and Monodomain models}, 1150 journal = {Mathematical Biosciences}, 1151 year = {2005}, 1152 volume = {197}, 1153 number = {1}, 1154 pages = {35--66}, 1155 petsc_uses = {KSP} 1156} 1157 1158@Article{ franz-pavir-06, 1159 author = {P. Colli Franzone and L.~F. Pavarino and B. Taccardi}, 1160 title = {Effects of transmural electrical heterogeneities and electrotonic interactions on 1161 the dispersion of cardiac repolarization and action potential duration: a 1162 simulation study}, 1163 journal = {Mathematical Biosciences}, 1164 year = {2006}, 1165 volume = {204}, 1166 number = {1}, 1167 pages = {132--165}, 1168 petsc_uses = {KSP} 1169} 1170 1171@InProceedings{ colli-franz-sim, 1172 author = {P. Colli-Franzone and L.F. Pavarino and B. Taccardi}, 1173 title = {MODELING ANISOTROPIC AND HETEROGENEOUS CARDIAC MODELS: PARALLEL SIMULATIONS}, 1174 booktitle = {MEDICON and HEALTH TELEMATICS 2004, Health in the Information Society, X 1175 Mediterranean Conference on Medical and Biological Engineering}, 1176 url = {http://cluster.mat.unimi.it/doc/Progetti/Pavarino-LF.pdf}, 1177 year = {2004}, 1178 petsc_uses = {KSP} 1179} 1180 1181@InProceedings{ pf2003, 1182 author = {Luca F. Pavarino and Piero Colli Franzone}, 1183 title = {Parallel Solution of Cardiac Reaction-Diffusion Models}, 1184 booktitle = {Proceedings of the 15th International Conference on Domain Decomposition 1185 Methods}, 1186 pages = {669--776}, 1187 publisher = {Springer, Lecture Notes in Computational Science and Engineering (LNCSE).}, 1188 note = {}, 1189 url = {http://www.ddm.org/DD15/proceedings-dd15.html}, 1190 year = {2003}, 1191 petsc_uses = {KSP} 1192} 1193 1194@Article{ maria-is04, 1195 author = {Maria Murillo and Xiao-Chuan Cai}, 1196 title = {A fully implicit parallel algorithm for simulating the non-linear electrical 1197 activity of the heart}, 1198 journal = {Numerical Linear Algebra with Applications}, 1199 year = {2004}, 1200 volume = {11}, 1201 pages = {261 - 277}, 1202 url = {http://www3.interscience.wiley.com/cgi-bin/abstract/107632540/ABSTRACT}, 1203 petsc_uses = {KSP} 1204} 1205 1206@Article{ murli2007monitoring, 1207 title = {{Monitoring and Migration of a PETSc-based Parallel Application for Medical 1208 Imaging in a Grid computing PSE}}, 1209 author = {Murli, A. and Boccia, V. and Carracciuolo, L. and D’Amore, L. and Laccetti, G. 1210 and Lapegna, M.}, 1211 journal = {Grid-Based Problem Solving Environments}, 1212 pages = {421--432}, 1213 year = {2007}, 1214 publisher = {Springer}, 1215 petsc_uses = {KSP} 1216} 1217 1218@Article{ carracciuolo:2006:tpc, 1219 author = {Carracciuolo, L. and D'Amore, L. and Murli, A.}, 1220 title = {Towards a parallel component for imaging in PETSc programming environment: a case 1221 study in 3-D echocardiography}, 1222 journal = {Parallel Comput.}, 1223 volume = {32}, 1224 issue = {1}, 1225 month = jan, 1226 year = {2006}, 1227 issn = {0167-8191}, 1228 pages = {67--83}, 1229 numpages = {17}, 1230 doi = {10.1016/j.parco.2005.09.001}, 1231 acmid = {1141218}, 1232 publisher = {Elsevier Science Publishers B. V.}, 1233 address = {Amsterdam, The Netherlands, The Netherlands}, 1234 keywords = {Distributed software environment, Image denoising, Non linear PDE, Parallel 1235 component}, 1236 petsc_uses = {KSP} 1237} 1238 1239@Article{ damore2011integration, 1240 title = {Integration of emerging computer technologies for an efficient image sequences 1241 analysis}, 1242 journal = {Integrated Computer-Aided Engineering }, 1243 volume = {18}, 1244 number = {4}, 1245 pages = {365 - 378}, 1246 year = {2011}, 1247 note = {}, 1248 issn = {1875-8835}, 1249 doi = {10.3233/ICA-2011-0382}, 1250 url = {http://iospress.metapress.com/content/KM614806M50TKVP7}, 1251 author = {L. D'Amore and D. Casaburi and A. Galletti and L. Marcellino and A. Murli}, 1252 keywords = {Image sequence, pipe and filters, parallel computing, multicore processors}, 1253 petsc_uses = {KSP} 1254} 1255 1256@InProceedings{ eth_biwi_00721, 1257 author = {K. Burckhardt and D. Szczerba and J. Brown and K. Muralidhar and and G. 1258 Székely}, 1259 title = {Fast Implicit Simulation of Oscillatory Flow in Human Abdominal Bifurcation using 1260 a Schur Complement Preconditioner}, 1261 booktitle = {Euro-Par 2009 Parallel Processing}, 1262 year = {2009}, 1263 month = aug, 1264 pages = {747-759}, 1265 volume = {5704}, 1266 editor = {H. Sips and D. Epema and and H.-X. Lin}, 1267 series = {Lecture Notes in Computer Science}, 1268 publisher = {Springer}, 1269 keywords = {Aortic aneurysm, flow simulation, streamline diffusion FEM, indefinite matrix, 1270 parallel Krylov solver}, 1271 petsc_uses = {KSP} 1272} 1273 1274% LiteralHTML: <a name="biology:imagingandsurgery"> 1275% LiteralHTML: <td width="100%" colspan="2"><hr size="4" color="#FF5B5B"> </td> 1276% LiteralHTML: <center><img alt="" 1277% LiteralHTML: src="images/brain.jpg"></center> 1278@Article{ ganser2004deformable, 1279 title = {A deformable digital brain atlas system according to Talairach and Tournoux}, 1280 author = {Ganser, K.A. and Dickhaus, H. and Metzner, R. and Wirtz, C.R.}, 1281 journal = {Medical Image Analysis}, 1282 volume = {8}, 1283 number = {1}, 1284 pages = {3--22}, 1285 year = {2004}, 1286 publisher = {Elsevier}, 1287 petsc_uses = {KSP} 1288} 1289 1290@Unpublished{ taccsurgery, 1291 title = {TACC supercomputer performs laser cancer surgery on canine}, 1292 url = {http://www.tacc.utexas.edu/research/users/features/dynamic.php?m_b_c=laser}, 1293 note = {In April, the Lonestar supercomputer at the Texas Advanced Computing Center in 1294 Austin performed laser surgery on a dog in Houston without the intervention of a 1295 surgeon. The treatment was developed collaboratively by computational experts from 1296 the Institute for Computational Engineering and Sciences (ICES) at UT-Austin, 1297 leading technologists from the M.D. Anderson Cancer Center in Houston, and 1298 cyberinfrastructure specialists and systems from TACC. Using precise lasers, 1299 state-of-the-art thermal imaging technology, and advanced computational methods, 1300 dynamic, data-driven treatments are being pursued as a minimally invasive 1301 alternative to the standard treatment of cancer.}, 1302 petsc_uses = {KSP} 1303} 1304 1305@Article{ ffhbresso2008, 1306 author = {Yusheng Feng and David Fuentes and Andrea Hawkins and Jon Bass and Marissa 1307 Nichole Rylander and Andrew Elliott and Anil Shetty and R. Jason Stafford and J. 1308 Tinsley Oden}, 1309 title = {Nanoshell-Mediated Laser Surgery Simulation for Prostate Cancer Treatment}, 1310 journal = {Engineering with Computers}, 1311 note = {Special issue on Computational Bioengineering}, 1312 year = {2008}, 1313 url = {http://www.tacc.utexas.edu/research/users/features/laser_surgery.pdf}, 1314 petsc_uses = {KSP} 1315} 1316 1317@TechReport{ dobbhbbbdeffghkkps2008, 1318 author = {K. R. Diller and J. T. Oden and C. Bajaj and J. C. Browne and J. Hazle and I. 1319 Babu{\v{s}}ka and J. Bass and L. Bidaut and L. Demkowicz and A. Elliott and Y. 1320 Feng and D. Fuentes and S. Goswami and A. Hawkins and S. Khoshnevis and B. Kwon 1321 and S. Prudhomme and R. J. Stafford}, 1322 title = {Computational Infrastructure for the Real-Time Patient-Specific Treatment of 1323 Cancer}, 1324 year = {2008}, 1325 institution = {University of Texas at Austin}, 1326 url = {http://www.tacc.utexas.edu/research/users/features/cancer.pdf}, 1327 petsc_uses = {KSP} 1328} 1329 1330@Article{ ogdb2004, 1331 author = {A.A. Oberai and N.H. Gokhale and M.M. Doyley and J.C.Bamber}, 1332 title = {Evaluation of the Adjoint Equation Based Algorithm for Elasticity Imaging}, 1333 journal = {Physics in Medicine and Biology}, 1334 year = {2004}, 1335 volume = {49}, 1336 pages = {2955--2947}, 1337 petsc_uses = {KSP} 1338} 1339 1340@InProceedings{ majumdar11, 1341 author = {A. Majumdar and A. Birnbaum and D. Choi and A. Trivedi and S. K. Warfield and K. 1342 Baldridge and P. Krysl}, 1343 title = {A Dynamic Data Driven Grid System for Intra-Operative Image Guided Neurosurgery}, 1344 booktitle = {ICCS 2005}, 1345 pages = {672--679}, 1346 editor = {V.S. Sunderam et al.}, 1347 year = {2005}, 1348 petsc_uses = {KSP} 1349} 1350 1351@Conference{ sermesant-etal:03, 1352 author = {Sermesant, M. and Clatz, O. and Li, Z. and Lanteri, S. and Delingette, H. and 1353 Ayache, H.}, 1354 title = {A parallel implementation of non-rigid registration using a volumetric 1355 biomechanical model}, 1356 booktitle = {Second International Workshop on Biomedical Image Registration {WBIR'03}}, 1357 address = {Philadelphia, PA, USA}, 1358 publisher = {Springer-Verlag}, 1359 editor = {Gee, J.C. and Maintz, J.B.A. and Vannier, M.W.}, 1360 series = {Lecture Notes in Computer Science}, 1361 volume = {2717}, 1362 pages = {398-407}, 1363 date = {june 23-24}, 1364 year = {2003}, 1365 url = {ftp://ftp-sop.inria.fr/epidaure/Publications/Sermesant/WBIR2003Sermesant.pdf}, 1366 petsc_uses = {KSP} 1367} 1368 1369@Conference{ sermesant-etal:04, 1370 author = {J. Rexilius and S.K. Warfield and C.R.G. Guttmann and X. Wei and R. Benson and L. 1371 Wolfson and M. Shenton and H. Handels and R. Kikinis}, 1372 title = {A Novel Nonrigid Registration Algorithm And Applications}, 1373 booktitle = {Medical Image Computing and Computer-Assisted Intervention - MICCAI 2001}, 1374 address = {Philadelphia, PA, USA}, 1375 publisher = {Springer-Verlag}, 1376 editor = {Gee, J.C. and Maintz, J.B.A. and Vannier, M.W.}, 1377 series = {Lecture Notes in Computer Science}, 1378 volume = {2208}, 1379 pages = {923}, 1380 year = {2003}, 1381 url = {http://www.springerlink.com/app/home/contribution.asp?wasp=6pgwnvthup0amt7g9j4k&referrer=parent&backto=issue,105,251;journal,1191,1949;linkingpublicationresults,1:105633,1}, 1382 petsc_uses = {KSP} 1383} 1384 1385@Article{ warfield-haker-talos-05, 1386 author = {Simon K. Warfield and Steven J. Haker and Ion-Florin Talos and Corey A. Kemper 1387 and Neil Weisenfeld and Andrea U.J. Mewes and Daniel Goldberg-Zimring and Kelly H. 1388 Zou and Carl-Fredrik Westin and William M. Wells and Clare M.C. Tempany and 1389 Alexandra Golby and Peter M. Black and Ferenc A. Jolesz and Ron Kikinis}, 1390 title = {Capturing intraoperative deformations: research experience at Brigham and Women's 1391 hospital}, 1392 journal = {Medical Image Analysis}, 1393 url = {http://splweb.bwh.harvard.edu:8000/pages/papers/warfield/capturing-intraoperative-deformations-MIA2005.pdf}, 1394 year = {2005}, 1395 petsc_uses = {KSP} 1396} 1397 1398@Article{ brain3, 1399 author = {Simon K. Warfield and Florin Talos and Alida Tei and Arya Nabavi and Matthieu 1400 Ferrant and Peter McL. Black and Ferenc A. Jolesz and Ron Kikinis}, 1401 title = {Real-Time Registration of Volumetic Brain {MRI} by Biomechanical Simulation of 1402 Deformation during Image Guided Neurosurgery}, 1403 journal = {Computing and Visualization in Science}, 1404 url = {http://splweb.bwh.harvard.edu:8000/pages/ppl/warfield/papers/2002/warfield-2002-cvs-appeared.pdf}, 1405 year = {2002}, 1406 petsc_uses = {KSP} 1407} 1408 1409@Article{ brain2, 1410 author = {Matthieu Ferrant and Arya Nabavi and Benoit Macq and Ferenc A. Jolesz and Ron 1411 Kikinis and Simon K. Warfield}, 1412 title = {Registration of {3D} Intraoperative {MR} Images of the Brain using a Finite 1413 Element Biomechanical Model}, 1414 journal = {IEEE Transactions on Medical Imaging}, 1415 url = {http://splweb.bwh.harvard.edu:8000/pages/papers/ferrant/tmi2001.pdf}, 1416 year = {2001}, 1417 petsc_uses = {KSP} 1418} 1419 1420@InProceedings{ brain1, 1421 author = {Simon K. Warfield and Matthieu Ferrant and Xavier Gallez and Arya Nabavi and 1422 Ferenc A. Jolesz and Ron Kikinis}, 1423 title = {Real-Time Biomechanical Simulation of Volumetric Brain Deformation for Image 1424 Guided Neurosurgery}, 1425 booktitle = {Proceedings of SC2000}, 1426 url = {http://www.sc2000.org/techpapr/papers/pap.pap230.pdf}, 1427 year = {2000}, 1428 petsc_uses = {KSP} 1429} 1430 1431@Article{ vanne06, 1432 author = {V. Kolehmainen and A. Vanne and S. Siltanen and S. Jarvenpaa and J.P. Kaipio and 1433 M. Lassas and M. Kalke}, 1434 title = {Parallelized Bayesian inversion for three-dimensional dental X-ray imaging}, 1435 journal = {IEEE Transactions on Medical Imaging}, 1436 volume = {25}, 1437 number = {2}, 1438 month = feb, 1439 year = {2006}, 1440 pages = {218--228}, 1441 petsc_uses = {KSP} 1442} 1443 1444@InProceedings{ knepleybardhan2015, 1445 title = {Work/Precision Tradeoffs in Continuum Models of Biomolecular Electrostatics}, 1446 author = {Matthew G. Knepley and Jaydeep P. Bardhan}, 1447 booktitle = {Proceedings of ASME 2015 International Mechanical Engineering Congress \& 1448 Exposition}, 1449 volume = {9}, 1450 pages = {V009T12A04}, 1451 doi = {10.1115/IMECE2015-53579}, 1452 year = {2015}, 1453 petsc_uses = {KSP} 1454} 1455 1456@InProceedings{ bardhanknepley2015, 1457 title = {Multiscale models and approximation algorithms for protein electrostatics}, 1458 author = {Jaydeep P. Bardhan and Matthew G. Knepley}, 1459 booktitle = {Boundary Elements and Other Mesh Reduction Methods XXXVIII}, 1460 volume = {61}, 1461 pages = {163--174}, 1462 url = {http://www.witpress.com/Secure/elibrary/papers/BEM38/BEM38013FU1.pdf}, 1463 doi = {10.2495/BEM380131}, 1464 publisher = {WIT Press}, 1465 year = {2015}, 1466 petsc_uses = {KSP} 1467} 1468 1469% LiteralHTML: 1470% LiteralHTML: <a name="fusion"><H3><center>Fusion</center></H3> 1471% LiteralHTML: 1472@InProceedings{ adamsbrennanknepleywang2022, 1473 title = {{Landau} collision operator in the {CUDA} programming model applied to thermal 1474 quench plasmas}, 1475 author = {Mark. F. Adams and Dylan P. Brennan and Matthew G. Knepley and Peng Wang}, 1476 booktitle = {36th IEEE International Parallel \& Distributed Processing Symposium Conference 1477 (IPDPS '22)}, 1478 doi = {10.1109/IPDPS53621.2022.00020}, 1479 year = {2022}, 1480 petsc_uses = {DMPlex} 1481} 1482 1483@Misc{ adamsknepleybrennan2021, 1484 title = {Runaway Electron Generation with High-Performance, Structure Preserving 1485 Discretization of Fokker-Plank-Landau}, 1486 author = {Mark F. Adams and Matthew G. Knepley and Dylan Brennan}, 1487 year = {2021}, 1488 petsc_uses = {KSP} 1489} 1490 1491@Article{ adamshirvijokiknepleybrownisaacmills2017, 1492 title = {{Landau} Collision Integral Solver with Adaptive Mesh Refinement on Emerging 1493 Architectures}, 1494 author = {Mark F. Adams and Eero Hirvijoki and Matthew G. Knepley and Jed Brown and Tobin 1495 Isaac and Richard Mills}, 1496 journal = {SIAM Journal on Scientific Computing}, 1497 volume = {39}, 1498 number = {6}, 1499 pages = {C452--C465}, 1500 doi = {10.1137/17M1118828}, 1501 eprint = {1702.08880}, 1502 year = {2017}, 1503 petsc_uses = {KSP} 1504} 1505 1506@Article{ pusztayknepleyadams2022, 1507 title = {Conservative Projection Between FEM and Particle Bases}, 1508 author = {Joseph V. Pusztay and Matthew G. Knepley and Mark F. Adams}, 1509 journal = {SIAM Journal on Scientific Computing}, 1510 volume = {44}, 1511 number = {4}, 1512 pages = {C310--C319}, 1513 doi = {10.1137/21M145407}, 1514 year = {2022} 1515} 1516 1517@Article{ hirvijoki2017, 1518 author = {Eero Hirvijoki and Mark F. Adams}, 1519 title = {Conservative discretization of the {Landau} collision integral}, 1520 journal = {Physics of Plasmas}, 1521 volume = {24}, 1522 number = {3}, 1523 pages = {032121}, 1524 doi = {10.1063/1.4979122}, 1525 year = {2017}, 1526 petsc_uses = {KSP} 1527} 1528 1529@Article{ mollenadamsknepleyhagerchang2021, 1530 title = {Implementation of higher-order velocity mapping between marker particles and grid 1531 in the particle-in-cell code XGC}, 1532 author = {Albert Moll\'en and Mark F. Adams and Matthew G. Knepley and Robert Hager and C. 1533 S. Chang}, 1534 journal = {Journal of Plasma Physics}, 1535 eprint = {2012.11764}, 1536 doi = {10.1017/S0022377821000441}, 1537 year = {2021}, 1538 petsc_uses = {KSP} 1539} 1540 1541@Article{ lsmh2014, 1542 author = {M. Landreman and H. M. Smith and A. Mollen and P. Helander}, 1543 title = {Comparison of particle trajectories and collision operators for collisional 1544 transport in nonaxisymmetric plasmas}, 1545 journal = { Physics of Plasmas}, 1546 volume = {21}, 1547 year = {2014}, 1548 petsc_uses = {KSP} 1549} 1550 1551@Article{ lpcep2014, 1552 author = {M. Landreman and F. I Parra and P. J. Catto and D. Ernst and I. Pusztai}, 1553 title = {Radially global delta-f computation of neoclassical phenomena in a tokamak 1554 pedestal}, 1555 journal = {Plasma Physics and Controlled Fusion}, 1556 volume = {56}, 1557 year = {2014}, 1558 petsc_uses = {KSP} 1559} 1560 1561@Article{ facets-scidac08, 1562 title = {First Results from Core-Edge Parallel Composition in the {FACETS} Project}, 1563 author = {J. Cary and J. Candy and R. Cohen and S. Krasheninnikov and D. McCune and D. 1564 Estep and J. Larson and A. Malony and A. Pankin and P. Worley and J. Carlsson and 1565 A. Hakim and P. Hamill and S. Kruger and M. Miah and S. Muzsala and A. Pletzer and 1566 S. Shasharina and D. Wade-Stein and N. Wang and S. Balay and L. McInnes and H. 1567 Zhang and T. Casper and L. Diachin and T. Epperly and T. Rognlien and M. Fahey and 1568 J. Cobb and A. Morris and S. Shende and G. Hammett and K. Indireshkumar and D. 1569 Stotler and A. Pigarov}, 1570 journal = {J. Phys.: Conf. Ser.}, 1571 volume = {125}, 1572 year = {2008}, 1573 pages = {012040}, 1574 url = {http://www.iop.org/EJ/abstract/1742-6596/125/1/012040}, 1575 petsc_uses = {KSP} 1576} 1577 1578@Article{ facets-scidac09, 1579 title = {Concurrent, Parallel, Multiphysics Coupling in the {FACETS} Project}, 1580 author = {J. Cary and J. Candy and J. Cobb and R. H. Cohen and T. Epperly and D. Estep and 1581 S. Krasheninnikov and A. Malony and D. McCune and L. McInnes and A. Pankin and S. 1582 Balay and J. Carlsson and M. R. Fahey and R. Groebner and A. Hakim and S. Kruger 1583 and M. Miah and A. Pletzer and S. Shasharina and S. Vadlamani and D. Wade-Stein 1584 and T. Rognlien and A. Morris and S. Shende and G. W. Hammett and K. Indireshkumar 1585 and A. Pigarov and H. Zhang}, 1586 journal = {J. Phys.: Conf. Ser.}, 1587 volume = {180}, 1588 year = {2009}, 1589 pages = {012056}, 1590 url = {http://iopscience.iop.org/1742-6596/180/1/012056}, 1591 petsc_uses = {KSP} 1592} 1593 1594@InProceedings{ facets-scidac10, 1595 title = {Coupled Whole Device Simulations of Plasma Transport in Tokamaks with the 1596 {FACETS} Code}, 1597 author = {A. Hakim and J. Cary and J. Candy and J. Cobb and R. Cohen and T. Epperly and D. 1598 Estep and S. Krasheninnikov and A. Malony and D McCune and L.C. McInnes and A. 1599 Pankin and S. Balay J. Carlsson and M. Fahey and R. Groebner and S. Kruger and M. 1600 Miah and A. Pletzer and S. Shasharina and S. Vadlamani and D. Wade-Stein and T. 1601 Rognlein and A. Morris and S. Shende and G. Hammett and K. Indareshkumar and A. 1602 Pigarov and H. Zhang}, 1603 booktitle = {Proceedings of SciDAC 2010 Conference}, 1604 year = {2010}, 1605 url = {http://computing.ornl.gov/workshops/scidac2010/papers/fusion_a_hakim.pdf}, 1606 petsc_uses = {KSP} 1607} 1608 1609@InProceedings{ facets-fec2010, 1610 title = {Concurrent, Parallel, Coupled Core-Edge Simulations of Pedestal Formation Using 1611 the {FACETS} Framework}, 1612 author = {J. Cary and A. Hakim and A. Pletzer and M. Miah and S. Kruger and S. Shasharina 1613 and S. Vadlamani and J. Carlsson and A. Pankin and T. Rognlien and R. Cohen and D. 1614 McCune and K. Indireshkumar and A. Pigarov and L.C. McInnes and H. Zhang}, 1615 booktitle = {Proceedings of the 23rd annual IAEA Fusion Energy Conference (FEC 2010), Daejon, 1616 Republic of Korea}, 1617 year = {2010}, 1618 petsc_uses = {KSP} 1619} 1620 1621@InProceedings{ facets-epdp2010, 1622 title = {{FACETS}: A Framework for Parallel Coupling of Fusion Components}, 1623 author = {J. Cary and A. Hakim and M. Miah and S. Kruger and A. Pletzer and S. Shasharina 1624 and S. Vadlamani and A. Pankin and R. Cohen and T. Epperly and T. Rognlien and R. 1625 Groebner and S. Balay and L. McInnes and H. Zhang}, 1626 booktitle = {Proceedings of Euromicro PDP 2010 (The 18th Euromicro International Conference on 1627 Parallel, Distributed and Network-Based Computing), Pisa, Italy}, 1628 year = {2010}, 1629 petsc_uses = {KSP} 1630} 1631 1632@Article{ carlssoncary09, 1633 author = {Johan Carlsson, John R. Cary}, 1634 title = {The hypersecant Jacobian approximation for quasi-Newton solves of sparse 1635 nonlinear systems}, 1636 journal = {arXiv}, 1637 year = {2009}, 1638 note = {http://arxiv.org/abs/0905.1054}, 1639 url = {http://arxiv.org/pdf/0905.1054v1}, 1640 petsc_uses = {KSP} 1641} 1642 1643@InProceedings{ oshahjs2006, 1644 author = {F. Ogando and A. Signell and J.A. Heikkinen and M. Aspn\"as and S. Henriksson and 1645 S.J. Janhunen and T.P. Kiviniemi}, 1646 title = {Performance enhancements to ELMFIRE gyrokinetic code leading to new ranges of 1647 application}, 1648 booktitle = {33rd EPS Conference on Plasma Phys.}, 1649 year = {2006}, 1650 url = {http://epsppd.epfl.ch/Roma/pdf/P4_153.pdf}, 1651 note = {European fusion code}, 1652 petsc_uses = {KSP} 1653} 1654 1655@Article{ zhu2006, 1656 author = {P. Zhu and A. Bhattacharjee and K. Germaschewski}, 1657 title = {Intermediate nonlinear evolution of the Parker instability: Formation of 1658 convection-induced discontinuities and absence of finite-time singularities}, 1659 journal = {Phys. Rev. Lett.}, 1660 volume = {96}, 1661 number = {065001}, 1662 year = {2006}, 1663 doi = {10.1103/PhysRevLett.96.065001}, 1664 petsc_uses = {KSP} 1665} 1666 1667@InProceedings{ ppc2005, 1668 author = {B. Philip and M. Pernice and L.Chacon}, 1669 title = {Solution of Reduced Resistive Magnetohydrodynamics using Implicit Adaptive Mesh 1670 Refinement}, 1671 booktitle = {Proceedings of the 16th International Conference on Domain Decomposition 1672 methods}, 1673 year = {2005}, 1674 lab = {LANL}, 1675 petsc_uses = {KSP} 1676} 1677 1678@Article{ pp2005, 1679 author = {M. Pernice and B. Philip}, 1680 title = {Solution of Equilibrium Radiation Diffusion Problems using Adaptive Mesh 1681 Refinement}, 1682 year = {2005}, 1683 journal = {SIAM J. of Sci. Comput.}, 1684 lab = {LANL}, 1685 petsc_uses = {KSP} 1686} 1687 1688@Article{ gt2004, 1689 author = {A. H. Glasser and X. Z. Tang}, 1690 title = {The SEL macroscopic modeling code}, 1691 year = {2004}, 1692 journal = {Computer Physics Communications}, 1693 pages = {237--243}, 1694 volume = {164}, 1695 lab = {LANL}, 1696 petsc_uses = {KSP} 1697} 1698 1699@Article{ nl2006, 1700 author = {Y. Nishimura and Z.Lin}, 1701 title = {A finite element mesh in a tokamak edge geometry}, 1702 year = {2006}, 1703 journal = {Contributions to Plasma Physics}, 1704 volume = {22}, 1705 lab = {PPPL}, 1706 petsc_uses = {KSP} 1707} 1708 1709@Article{ nlle2004, 1710 author = {Y. Nishimura and Z.Lin and J.Lewandowski and S.Ethier}, 1711 title = {A finite element Poisson solver for gyrokinetic particle simulations in a global 1712 field aligned mesh}, 1713 year = {2006}, 1714 journal = {J. Comput. Phys.}, 1715 volume = {214}, 1716 pages = {657}, 1717 lab = {PPPL}, 1718 petsc_uses = {KSP} 1719} 1720 1721@InProceedings{ lnlle2004, 1722 author = {J.L.V Lewandowski and Y.Nishimura and W.W.Lee and Z.Lin and S. Ethier}, 1723 title = {Global gyrokinetic Particle-in-cell Simulations with Trapped Electrons}, 1724 booktitle = {Sherwood Fusion Theory Conference, Missoula, MT}, 1725 year = {2004}, 1726 url = {http://www.sherwoodtheory.org/sherwood04/program/1e15.pdf}, 1727 lab = {PPPL}, 1728 petsc_uses = {KSP} 1729} 1730 1731@InProceedings{ nlclew2004, 1732 author = {Y. Nishimura and Z.Lin and L.Chen and J.Lewandowski and S.Ethier and W. Wang}, 1733 title = {Electromagnetic gyrokinetic simulation with a fluid-kinetic hybrid electron 1734 model}, 1735 booktitle = {Sherwood Fusion Theory Conference, Missoula, MT}, 1736 year = {2004}, 1737 url = {http://www.sherwoodtheory.org/sherwood04/program/1C32.pdf}, 1738 lab = {PPPL}, 1739 petsc_uses = {KSP} 1740} 1741 1742@Article{ tb1, 1743 author = {X.~Z.~Tang and A.~H.~Boozer}, 1744 title = {Numerical studies of a steady state axisymmetric co-axial helicity injection 1745 plasma}, 1746 journal = {Physics of Plasmas}, 1747 year = {2004}, 1748 pages = {171--185}, 1749 volume = {11}, 1750 lab = {LANL}, 1751 petsc_uses = {KSP} 1752} 1753 1754@Unpublished{ nlcw, 1755 title = {Inclusion of electromagnetic effects into gyrokinetic particle simulations}, 1756 author = {Y. Nishimura and Z.Lin and L.Chen and W. Wang}, 1757 note = {American Physical Society 45th Annual Meeting Division of Plasma Physics, 1758 Albuquerque, New Mexico, October 2003}, 1759 year = {2003}, 1760 petsc_uses = {KSP} 1761} 1762 1763@TechReport{ tang2001, 1764 author = {X. Z. Tang and G. Y. Fu and S. C. Jardin and L. L. Lowe and W. Park and H. R. 1765 Strauss}, 1766 title = {Resistive Magnetohydrodynamics Simulation of Fusion Plasmas}, 1767 year = {2001}, 1768 institution = {Princeton Plasma Physics Laboratory}, 1769 number = {PPPL-3532}, 1770 url = {http://www.pppl.gov/pub_report/2001/PPPL-3532.pdf}, 1771 note = {Presented at 10th Society for Industrial and Applied Mathematics (SIAM) 1772 Conference on Parallel Processing for Scientific Computing, Portsmouth, Virginia, 1773 March 12-14, 2001.}, 1774 lab = {PPPL}, 1775 petsc_uses = {KSP} 1776} 1777 1778% LiteralHTML: 1779% LiteralHTML: <a name="geosciences"><H3><center>Geosciences</center></H3> 1780% LiteralHTML: 1781@Article{ valerathomasgarciacastillo2019, 1782 author = {Manuel Valera and Mary P. Thomas and Mariangel Garcia and Jose E. Castillo}, 1783 title = {Parallel Implementation of a {PETSc-Based} Framework for the General Curvilinear 1784 Coastal Ocean Model}, 1785 journal = {Journal of Marine Science and Engineering}, 1786 volume = {7}, 1787 number = {6}, 1788 article-number= {185}, 1789 url = {https://www.mdpi.com/2077-1312/7/6/185}, 1790 issn = {2077-1312}, 1791 doi = {10.3390/jmse7060185}, 1792 year = {2019}, 1793 petsc_uses = {KSP} 1794} 1795 1796@Article{ furuichimat2015, 1797 title = {Implicit solution of the material transport in Stokes flow simulation: Toward 1798 thermal convection simulation surrounded by free surface}, 1799 author = {Mikito Furuichi and Dave A May}, 1800 journal = {Computer Physics Communications}, 1801 volume = {192}, 1802 pages = {1--11}, 1803 year = {2015}, 1804 petsc_uses = {KSP} 1805} 1806 1807@Article{ sharplesmoresivelicjadamecmay2016, 1808 title = {Simulating faults and plate boundaries with a transversely isotropic plasticity 1809 model}, 1810 author = {Wendy Sharples and Louis N Moresi and Mirko Velic and Margarete A Jadamec and 1811 Dave A May}, 1812 journal = {Physics of the Earth and Planetary Interiors}, 1813 volume = {252}, 1814 pages = {77--90}, 1815 year = {2016}, 1816 petsc_uses = {KSP} 1817} 1818 1819@Article{ spiegelmanmaywilson2016, 1820 title = {On the solvability of incompressible Stokes with viscoplastic rheologies in 1821 geodynamics}, 1822 author = {Marc Spiegelman and Dave A May and Cian R Wilson}, 1823 journal = {Geochemistry, Geophysics, Geosystems}, 1824 volume = {17}, 1825 number = {6}, 1826 pages = {2213--2238}, 1827 year = {2016}, 1828 petsc_uses = {KSP} 1829} 1830 1831@Article{ buiteretal2016, 1832 title = {Benchmarking numerical models of brittle thrust wedges}, 1833 author = {Susanne JH Buiter and Guido Schreurs and Markus Albertz and Taras V Gerya and 1834 Boris Kaus and Walter Landry and Laetitia {Le Pourhiet} and Yury Mishin and David 1835 L Egholm and Michele Cooke and Bertrand Maillot and Cedric Thieulot and Tony Crook 1836 and Dave May and Pauline Souloumiac and Christopher Beaumont}, 1837 journal = {Journal of structural geology}, 1838 volume = {92}, 1839 pages = {140--177}, 1840 year = {2016}, 1841 petsc_uses = {KSP} 1842} 1843 1844@Article{ afanasievboehmdrielkrischerrietmannmayknepleyfichtner2019, 1845 title = {Modular and flexible spectral-element waveform modelling in two and three 1846 dimensions}, 1847 author = {Michael Afanasiev and Christian Boehm and Martin van Driel and Lion Krischer and 1848 Max Rietmann and Dave A. May and Matthew G. Knepley and Andreas Fichtner}, 1849 journal = {Geophysical Journal International}, 1850 volume = {216}, 1851 number = {3}, 1852 pages = {1675--1692}, 1853 doi = {10.1093/gji/ggy469}, 1854 year = {2019}, 1855 petsc_uses = {KSP} 1856} 1857 1858@Article{ haplaknepleyafanasievboehmdrielkrischerfichtner2020, 1859 title = {Fully Parallel Mesh {I/O} using {PETSc} {DMPlex} with an Application to Waveform 1860 Modeling}, 1861 author = {Vaclav Hapla and Matthew G. Knepley and Michael Afanasiev and Christian Boehm and 1862 Martin van Driel and Lion Krischer and Andreas Fichtner}, 1863 journal = {SIAM Journal on Scientific Computing}, 1864 volume = {43}, 1865 number = {2}, 1866 pages = {C127--C153}, 1867 eprint = {http://arxiv.org/abs/2004.08729}, 1868 doi = {10.1137/20M1332748}, 1869 year = {2021}, 1870 petsc_uses = {KSP} 1871} 1872 1873@Article{ parsani2021, 1874 title = {High-order accurate entropy-stable discontinuous collocated Galerkin methods with 1875 the summation-by-parts property for compressible CFD frameworks: Scalable SSDC 1876 algorithms and flow solver}, 1877 author = {Matteo Parsani and Radouan Boukharfane and Irving Reyna Nolasco and David C. {Del 1878 Rey Fernández} and Stefano Zampini and Bilel Hadri and Lisandro Dalcin}, 1879 journal = {Journal of Computational Physics}, 1880 volume = {424}, 1881 pages = {109844}, 1882 issn = {0021-9991}, 1883 doi = {https://doi.org/10.1016/j.jcp.2020.109844}, 1884 url = {http://www.sciencedirect.com/science/article/pii/S0021999120306185}, 1885 year = {2021}, 1886 petsc_uses = {KSP} 1887} 1888 1889@Article{ ambartsumyanbouakaramthanhghattaskeyesstadlerturkiyyahzampini2020, 1890 title = {Hierarchical matrix approximations of {Hessians} arising in inverse problems 1891 governed by {PDEs}}, 1892 author = {I. Ambartsumyan and W. Bouakaram and Than Bui-Thanh and Omar Ghattas and David 1893 Keyes and Georg Stadler and George Turkiyyah and Stefano Zampini}, 1894 journal = {SIAM Journal of Scientific Computing}, 1895 volume = {42}, 1896 number = {5}, 1897 pages = {A3397--A3426}, 1898 year = {2020} 1899} 1900 1901@Article{ zampinibouakaramturkiyyahkniokeyes2022, 1902 title = {H2Opus: a distributed memory {multi-GPU} software for non-local operators}, 1903 author = {Stefano Zampini and W. Bouakaram and George Turkiyyah and O. Knio and David E. 1904 Keyes}, 1905 journal = {Advances on Computational Mathematics}, 1906 note = {In press}, 1907 year = {2022} 1908} 1909 1910@Article{ dassizampiniscacchi2022, 1911 title = {Robust and scalable adaptive {BDDC} preconditioners for virtual element 1912 discretizations of elliptic equations in mixed form}, 1913 author = {F. Dassi and Stefano Zampini and S. Scacchi}, 1914 journal = {Computer Methods in Applied Mechanics and Engineering}, 1915 volume = {391}, 1916 pages = {114620}, 1917 year = {2022} 1918} 1919 1920@Article{ youngoppenheimdimant2017, 1921 author = {Matthew A. Young and Meers M. Oppenheim and Yakov S. Dimant}, 1922 title = {Hybrid simulations of coupled Farley-Buneman/gradient drift instabilities in the 1923 equatorial E region ionosphere}, 1924 journal = {Journal of Geophysical Research: Space Physics}, 1925 volume = {122}, 1926 number = {5}, 1927 issn = {2169-9402}, 1928 doi = {10.1002/2017JA024161}, 1929 pages = {5768--5781}, 1930 year = {2017}, 1931 petsc_uses = {KSP} 1932} 1933 1934@Article{ rioussetpatylillisfillingimenglandwithershale2013, 1935 title = {Three-dimensional multifluid modeling of atmospheric electrodynamics in Mars' 1936 dynamo region}, 1937 author = {Jeremy A Riousset and Carol S Paty and Robert J Lillis and Matthew O Fillingim 1938 and Scott L England and Paul G Withers and John P M Hale}, 1939 journal = {Journal of Geophysical Research: Space Physics}, 1940 volume = {118}, 1941 number = {6}, 1942 pages = {3647--3659}, 1943 year = {2013}, 1944 publisher = {Wiley Online Library}, 1945 petsc_uses = {KSP} 1946} 1947 1948@Article{ chien2016representation, 1949 title = {Representation of topography by partial steps using the immersed boundary method 1950 in a vector vorticity equation model (VVM)}, 1951 author = {Chien, Mu-Hua and Wu, Chien-Ming}, 1952 journal = {Journal of Advances in Modeling Earth Systems}, 1953 year = {2016}, 1954 publisher = {Wiley Online Library}, 1955 petsc_uses = {KSP} 1956} 1957 1958@Article{ berger2015parallel, 1959 title = {Parallel preconditioners for monolithic solution of shear bands}, 1960 author = {Berger-Vergiat, Luc and McAuliffe, Colin and Waisman, Haim}, 1961 journal = {Journal of Computational Physics}, 1962 year = {2015}, 1963 publisher = {Elsevier}, 1964 petsc_uses = {KSP} 1965} 1966 1967@Article{ may2015496, 1968 title = {A scalable, matrix-free multigrid preconditioner for finite element 1969 discretizations of heterogeneous {S}tokes flow }, 1970 journal = {Computer Methods in Applied Mechanics and Engineering }, 1971 volume = {290}, 1972 number = {0}, 1973 pages = {496--523}, 1974 year = {2015}, 1975 issn = {0045-7825}, 1976 doi = {10.1016/j.cma.2015.03.014}, 1977 author = {D.A. May and J. Brown and L. {Le Pourhiet}}, 1978 petsc_uses = {KSP} 1979} 1980 1981@Article{ isaacknepley2017, 1982 title = {Support for Non-conformal Meshes in {PETSc}'s {DMPlex} Interface}, 1983 author = {Tobin Isaac and Matthew G. Knepley}, 1984 journal = {ACM Transaction on Mathematical Software}, 1985 eprint = {1508.02470}, 1986 note = {In review}, 1987 year = {2017}, 1988 petsc_uses = {KSP} 1989} 1990 1991@Article{ knepleylangegorman2017, 1992 title = {Unstructured Overlapping Mesh Distribution in Parallel}, 1993 author = {Matthew G. Knepley and Michael Lange and Gerard J. Gorman}, 1994 journal = {ArXiv e-prints}, 1995 eprint = {1506.06194}, 1996 year = {2017}, 1997 petsc_uses = {DMPlex} 1998} 1999 2000@Article{ langemitchellknepleygorman2015, 2001 title = {Efficient mesh management in {Firedrake} using {PETSc-DMPlex}}, 2002 author = {Michael Lange and Lawrence Mitchell and Matthew G. Knepley and Gerard J. Gorman}, 2003 journal = {SIAM Journal on Scientific Computing}, 2004 volume = {38}, 2005 number = {5}, 2006 pages = {S143--S155}, 2007 eprint = {http://arxiv.org/abs/1506.07749}, 2008 doi = {10.1137/15M1026092}, 2009 year = {2016}, 2010 petsc_uses = {DMPlex} 2011} 2012 2013@InProceedings{ langeknepleygorman2015, 2014 title = {Flexible, Scalable Mesh and Data Management using {PETSc DMPlex}}, 2015 author = {Michael Lange and Matthew G. Knepley and Gerard J. Gorman}, 2016 booktitle = {Proceedings of the Exascale Applications and Software Conference}, 2017 month = apr, 2018 url = {http://www.easc2015.ed.ac.uk/sites/default/files/attachments/EASC15Proceedings.pdf}, 2019 year = {2015}, 2020 petsc_uses = {DMPlex} 2021} 2022 2023@InProceedings{ wallworkknepleybarralpiggott2022, 2024 title = {Parallel Metric-Based Mesh Adaptation in {PETSc} using {ParMmg}}, 2025 author = {Joseph G. Wallwork and Matthew G. Knepley and Nicolas Barral and Matthew D. 2026 Piggott}, 2027 booktitle = {SIAM International Meshing Roundtable Workshop 2022}, 2028 editor = {Trevor Robinson}, 2029 month = jan, 2030 address = {Seattle, WA}, 2031 pages = {1--5}, 2032 url = {http://imr.sandia.gov/papers/imr31/2026_imr31RJ_Wallwork.pdf}, 2033 year = {2022}, 2034 petsc_uses = {DMPlex} 2035} 2036 2037@InProceedings{ timalsinaknepley2023, 2038 title = {Tetrahedralization of a Hexahedral Mesh}, 2039 author = {Aman Timalsina and Matthew G. Knepley}, 2040 booktitle = {SIAM International Meshing Roundtable Workshop 2023}, 2041 year = {2023}, 2042 petsc_uses = {DMPlex} 2043} 2044 2045@Article{ farrellknepleywechsungmitchell2020, 2046 title = {{PCPATCH}: software for the topological construction of multigrid relaxation 2047 methods}, 2048 author = {Patrick E Farrell and Matthew G Knepley and Lawrence Mitchell and Florian 2049 Wechsung}, 2050 journal = {ACM Transaction on Mathematical Software}, 2051 eprint = {http://arxiv.org/abs/1912.08516}, 2052 volume = {47}, 2053 number = {3}, 2054 pages = {1--22}, 2055 year = {2021}, 2056 petsc_uses = {KSP,DMPlex} 2057} 2058 2059@Article{ farrellmitchellscottwechsung2022, 2060 title = {Robust multigrid methods for nearly incompressible elasticity using macro 2061 elements}, 2062 author = {Patrick E Farrell and Lawrence Mitchell and L Ridgway Scott and Florian 2063 Wechsung}, 2064 journal = {IMA Journal of Numerical Analysis}, 2065 issn = {0272-4979}, 2066 doi = {10.1093/imanum/drab083}, 2067 url = {https://doi.org/10.1093/imanum/drab083}, 2068 year = {2022}, 2069 petsc_uses = {KSP,DMPlex} 2070} 2071 2072@Misc{ firedrakeproject, 2073 title = {{The Firedrake project}}, 2074 author = {David A Ham and Firedrake Team}, 2075 url = {http://firedrakeproject.org}, 2076 year = {2022}, 2077 petsc_uses = {KSP} 2078} 2079 2080@Article{ rathgeberhammitchelllangeluporinimcraeberceamarkallkelly2016, 2081 title = {Firedrake: automating the finite element method by composing abstractions}, 2082 author = {Florian Rathgeber and David A Ham and Lawrence Mitchell and Michael Lange and 2083 Fabio Luporini and Andrew TT McRae and Gheorghe-Teodor Bercea and Graham R Markall 2084 and Paul HJ Kelly}, 2085 journal = {ACM Transactions on Mathematical Software (TOMS)}, 2086 volume = {43}, 2087 number = {3}, 2088 pages = {24}, 2089 year = {2016}, 2090 petsc_uses = {KSP} 2091} 2092 2093@Article{ mitchellmuller2016, 2094 title = {High level implementation of geometric multigrid solvers for finite element 2095 problems: Applications in atmospheric modelling}, 2096 author = {Lawrence Mitchell and Eike Hermann M{\"u}ller}, 2097 journal = {Journal of Computational Physics}, 2098 volume = {327}, 2099 pages = {1--18}, 2100 year = {2016}, 2101 petsc_uses = {KSP} 2102} 2103 2104@Article{ mcraeberceamitchellhamcotter2016, 2105 title = {Automated generation and symbolic manipulation of tensor product finite 2106 elements}, 2107 author = {Andrew TT McRae and Gheorghe-Teodor Bercea and Lawrence Mitchell and David A Ham 2108 and Colin J Cotter}, 2109 journal = {SIAM Journal on Scientific Computing}, 2110 volume = {38}, 2111 number = {5}, 2112 pages = {S25--S47}, 2113 year = {2016}, 2114 petsc_uses = {KSP} 2115} 2116 2117@Article{ berceamcraehammitchellrathgebernardiluporinikelly2016, 2118 title = {A structure-exploiting numbering algorithm for finite elements on extruded 2119 meshes, and its performance evaluation in {Firedrake}}, 2120 author = {Gheorghe-Teodor Bercea and Andrew TT McRae and David A Ham and Lawrence Mitchell 2121 and Florian Rathgeber and L. Nardi and Fabio Luporini and Paul HJ Kelly}, 2122 journal = {Geoscientific Model Development}, 2123 volume = {9}, 2124 number = {10}, 2125 pages = {3803--3815}, 2126 doi = {10.5194/gmd-9-3803-2016}, 2127 year = {2016}, 2128 petsc_uses = {KSP} 2129} 2130 2131@InProceedings{ markallrathgebermitchellloriantbertollihamkelly2013, 2132 author = {Graham R. Markall and Florian Rathgeber and Lawrence Mitchell and Nicolas Loriant 2133 and Carlo Bertolli and David A. Ham and Paul HJ Kelly}, 2134 editor = {Julian Martin Kunkel and Thomas Ludwig and Hans Werner Meuer}, 2135 title = {Performance-Portable Finite Element Assembly Using {PyOP2} and {FEniCS}}, 2136 booktitle = {Proceedings of 28th International Supercomputing Conference, ISC 2013}, 2137 publisher = {Springer Berlin Heidelberg}, 2138 pages = {279--289}, 2139 isbn = {978-3-642-38750-0}, 2140 doi = {10.1007/978-3-642-38750-0_21}, 2141 year = {2013}, 2142 petsc_uses = {KSP} 2143} 2144 2145@Article{ kirbymitchell2017, 2146 title = {Solver composition across the {PDE}/linear algebra barrier}, 2147 author = {Robert C Kirby and Lawrence Mitchell}, 2148 journal = {arXiv preprint arXiv:1706.01346}, 2149 year = {2017}, 2150 petsc_uses = {KSP} 2151} 2152 2153@Article{ saibaba2012application, 2154 title = {Application of hierarchical matrices to linear inverse problems in 2155 geostatistics}, 2156 author = {Saibaba, Arvind Krishna and Ambikasaran, Sivaram and Yue Li, J and Kitanidis, 2157 Peter K and Darve, Eric F}, 2158 journal = {Oil and Gas Science and Technology-Revue de l'IFP-Institut Francais du Petrole}, 2159 volume = {67}, 2160 number = {5}, 2161 pages = {857}, 2162 year = {2012}, 2163 petsc_uses = {KSP} 2164} 2165 2166@Article{ collignonkausmayfernandez14, 2167 author = {Collignon, M. and Kaus, B. and May, D.A. and Fern\'andez, N.}, 2168 title = {Influences of surface processes on fold growth during {3-D} detachment folding}, 2169 journal = {Geochem Geophy Geosy}, 2170 year = {2014}, 2171 petsc_uses = {KSP} 2172} 2173 2174@Article{ fernandezkaus14, 2175 author = {Fern\'andez, N. and Kaus, B.}, 2176 title = {Fold interaction and wavelength selection in 3D models of multilayer detachment 2177 folding}, 2178 journal = {Tectonophysics}, 2179 year = {2014}, 2180 petsc_uses = {KSP} 2181} 2182 2183@Article{ baumannkauspopov14, 2184 author = {Baumann, T. and Kaus, B. J. P. and Popov, A.}, 2185 title = {Constraining effective rheology through parallel joint geodynamic inversion}, 2186 journal = {Tectonophysics}, 2187 year = {2014}, 2188 petsc_uses = {KSP} 2189} 2190 2191@Article{ lechmannschmalholzhetenyimaykaus14, 2192 author = {Lechmann, S. M. and Schmalholz, S. M. and Hetenyi, G. and May, D. A. and Kaus, B. 2193 J. P.}, 2194 title = {Quantifying the impact of mechanical layering and underthrusting on the dynamics 2195 of the modern {India-Asia} collisional system with {3-D} numerical models}, 2196 journal = { Journal of Geophysical Research - Solid Earth}, 2197 year = {2014}, 2198 petsc_uses = {KSP} 2199} 2200 2201@InBook{ fernandezkaus14b, 2202 author = {Fern\'andez N. and Kaus B.J.P.}, 2203 title = {Analytical and numerical investigation of 3D multilayer detachment}, 2204 booktitle = {Mathematics of Planet Earth}, 2205 editor = {Pardo-Ig\'uzquiza E. and Guardiola-Albert C. and Heredia J. and Moreno-Merino L. 2206 and Dur\'an J.J. and Vargas-Guzman J.A.}, 2207 publisher = {Springer}, 2208 year = {2014}, 2209 petsc_uses = {KSP} 2210} 2211 2212@Article{ hossein-hsueh-etal-2014a, 2213 author = {Hossein, M.Z. and Hsueh, C.-J. and Bourdin, B. and Bhattacharya, K.}, 2214 journal = {J. Mech. Phys. Solids}, 2215 pages = {320--348}, 2216 title = {Effective toughness of heterogeneous media}, 2217 volume = {71}, 2218 year = {2014}, 2219 petsc_uses = {KSP} 2220} 2221 2222@Unpublished{ leon-baldelli-bourdin-2014a, 2223 author = {Le\'{o}n Baldelli, A.A. and Bourdin, B.}, 2224 month = aug, 2225 note = {Submitted.}, 2226 title = {On the asymptotic derivation of Winkler-type energies from {3D} elasticity}, 2227 year = {2014}, 2228 petsc_uses = {KSP} 2229} 2230 2231@Article{ leon-baldelli-babadjian-etal-2013a, 2232 author = {Leòn-Baldelli, A. A. and Babadjian, J.-F. and Bourdin, B. and Henao, D. and 2233 Maurini, C.}, 2234 journal = {J. Mech. Phys. Solids}, 2235 pages = {15-32}, 2236 title = {A Variational Model For Fracture And Delamination Of Thin Films}, 2237 volume = {70}, 2238 year = {2014}, 2239 petsc_uses = {KSP} 2240} 2241 2242@Article{ mesgarnejad-bourdin-etal-2014a, 2243 author = {Mesgarnejad, A. and Bourdin, B. and Khonsari, M. M.}, 2244 journal = {Comp. Methods Appl. Mech. Engng.}, 2245 title = {Validation simulations for the variational approach to fracture}, 2246 volume = {Submitted}, 2247 year = {2014}, 2248 petsc_uses = {KSP} 2249} 2250 2251@InProceedings{ bourdin-chukwudozie-etal-2013a, 2252 author = {Bourdin, B. and Chukwudozie, C. and Yoshioka, K.}, 2253 booktitle = {Proceedings of the 38th Workshop on Geothermal Reservoir Engineering Stanford 2254 University, Stanford, CA}, 2255 title = {A Variational Approach To The Modeling And Numerical Simulation Of Hydraulic 2256 Fracturing Under In-Situ Stresses}, 2257 year = {2013}, 2258 petsc_uses = {KSP} 2259} 2260 2261@Article{ maurini-bourdin-etal-2012a, 2262 author = {Maurini, C. and Bourdin, B. and Gauthier, G. and Lazarus, V.}, 2263 journal = {Int. J. Fracture}, 2264 number = {1-2}, 2265 pages = {75-91}, 2266 title = {Crack patterns obtained by unidirectional drying of a colloidal suspension in a 2267 capillary tube: experiments and numerical simulations using a two-dimensional 2268 variational approach}, 2269 volume = {184}, 2270 year = {2013}, 2271 petsc_uses = {KSP} 2272} 2273 2274@Article{ mesgarnejad-bourdin-etal-2013a, 2275 author = {Mesgarnejad, A. and Bourdin, B. and Khonsari, M.M.}, 2276 journal = {J. Mech. Phys Solids}, 2277 number = {11}, 2278 pages = {2360--2379}, 2279 title = {A variational approach to the fracture of brittle thin films under out of plane 2280 loading}, 2281 volume = {61}, 2282 year = {2013}, 2283 petsc_uses = {KSP} 2284} 2285 2286@InProceedings{ bourdin-chukwudozie-etal-2012a, 2287 author = {Bourdin, B. and Chukwudozie, C. and Yoshioka, K.}, 2288 booktitle = {Proceedings of the 2012 SPE Annual Technical Conference and Exhibition}, 2289 title = {A Variational Approach to the Numerical Simulation of Hydraulic Fracturing}, 2290 volume = {SPE 159154}, 2291 year = {2012}, 2292 petsc_uses = {KSP} 2293} 2294 2295@Article{ millerdawsonfarthinghouhuangkeeskelleylangtangen13, 2296 author = {Cass T. Miller and Clint N. Dawson and Matthew W. Farthing and Thomas Y. Hou and 2297 Jingfang Huang and Christopher E. Kees and C.T. Kelley and Hans Petter 2298 Langtangen}, 2299 title = {Numerical simulation of water resources problems: Models, methods, and trends}, 2300 journal = {Advances in Water Resources}, 2301 volume = {51}, 2302 number = {0}, 2303 pages = {405--437}, 2304 year = {2013}, 2305 note = {35th Year Anniversary Issue}, 2306 issn = {0309-1708}, 2307 doi = {10.1016/j.advwatres.2012.05.008}, 2308 petsc_uses = {KSP} 2309} 2310 2311@Article{ scheltingamyerspietrzak10, 2312 author = {Terwisscha van Scheltinga, ArjenD. and Myers, PaulG. and Pietrzak, JulieD.}, 2313 title = {A finite element sea ice model of the Canadian Arctic Archipelago}, 2314 journal = {Ocean Dynamics}, 2315 volume = {60}, 2316 number = {6}, 2317 pages = {1539-1558}, 2318 year = {2010}, 2319 issn = {1616-7341}, 2320 doi = {10.1007/s10236-010-0356-5}, 2321 publisher = {Springer-Verlag}, 2322 keywords = {Ocean modelling; Unstructured meshes; Sea ice; Arctic Ocean; Canadian Arctic 2323 Archipelago; Freshwater flux}, 2324 language = {English}, 2325 petsc_uses = {KSP} 2326} 2327 2328@InBook{ destefanoandreasisecchi13, 2329 author = {M. De Stefano and F. Golfré Andreasi and A. Secchi}, 2330 title = {Towards preconditioned nonlinear conjugate gradients for generic geophysical 2331 inversions}, 2332 booktitle = {SEG Technical Program Expanded Abstracts 2013}, 2333 chapter = {626}, 2334 pages = {3226--3230}, 2335 doi = {10.1190/segam2013-0244.1}, 2336 url = {http://library.seg.org/doi/abs/10.1190/segam2013-0244.1}, 2337 eprint = {http://library.seg.org/doi/pdf/10.1190/segam2013-0244.1}, 2338 petsc_uses = {KSP} 2339} 2340 2341@Article{ pourhiethuetmaylabroussejolivet12, 2342 author = {L. {Le Pourhiet} and B. Huet and D. A. May and L. Labrousse and L. Jolivet}, 2343 title = {Kinematic interpretation of the 3D shapes of metamorphic core complexes}, 2344 journal = {Geochem. Geophys. Geosyst.}, 2345 volume = {13}, 2346 pages = {Q09002}, 2347 year = {2012}, 2348 doi = {10.1029/2012GC004271}, 2349 petsc_uses = {KSP} 2350} 2351 2352@Article{ lechmannmaykausschmalholz11, 2353 author = {S. M. Lechmann and D. A. May and B. J. P. Kaus and S. M. Schmalholz}, 2354 title = {Comparing thin-sheet models with {3-D} multilayer models for continental 2355 collision}, 2356 journal = {Geophysical Journal International}, 2357 volume = {187}, 2358 pages = {10--33}, 2359 year = {2011}, 2360 doi = {10.1111/j.1365-246X.2011.05164.x}, 2361 petsc_uses = {KSP} 2362} 2363 2364@Article{ stefano:r69, 2365 author = {Michele De Stefano and Federico Golfr\'{e} Andreasi and Simone Re and Massimo 2366 Virgilio and Fred F. Snyder}, 2367 collaboration = {}, 2368 title = {Multiple-domain, simultaneous joint inversion of geophysical data with 2369 application to subsalt imaging}, 2370 publisher = {SEG}, 2371 year = {2011}, 2372 journal = {Geophysics}, 2373 volume = {76}, 2374 number = {3}, 2375 pages = {R69-R80}, 2376 keywords = {geophysical image processing; inverse problems; seismology}, 2377 doi = {10.1190/1.3554652}, 2378 petsc_uses = {KSP} 2379} 2380 2381@Article{ stefano:806, 2382 author = {Michele De Stefano}, 2383 collaboration = {}, 2384 title = {Simultaneous joint inversion for susceptibility and velocity}, 2385 publisher = {SEG}, 2386 year = {2011}, 2387 journal = {SEG Technical Program Expanded Abstracts}, 2388 volume = {30}, 2389 number = {1}, 2390 pages = {806-810}, 2391 keywords = {3D; imaging; inversion; magnetics; multiparameter}, 2392 doi = {10.1190/1.3628198}, 2393 petsc_uses = {KSP} 2394} 2395 2396@Article{ mayknepley2011, 2397 author = {Dave A. May and Matthew G. Knepley}, 2398 title = {Optimal, scalable forward models for computing gravity anomalies}, 2399 journal = {Geophysical Journal International}, 2400 volume = {187}, 2401 number = {1}, 2402 pages = {161--177}, 2403 url = {http://arxiv.org/abs/1107.5951}, 2404 note = {\url{http://arxiv.org/abs/1107.5951}}, 2405 year = {2011}, 2406 petsc_uses = {KSP} 2407} 2408 2409@InProceedings{ bourdinknepleymaurini2010, 2410 author = {Blaise Bourdin and Matthew G. Knepley and C. Maurini}, 2411 title = {Numerical Simulation of Reservoir Stimulation - A Variational Approach}, 2412 booktitle = {Proceedings of the 37th Stanford Geothermal Workshop}, 2413 url = {https://es.stanford.edu/ERE/pdf/IGAstandard/SGW/2011/bourdin.pdf}, 2414 note = {\url{https://es.stanford.edu/ERE/pdf/IGAstandard/SGW/2011/bourdin.pdf}}, 2415 address = {Stanford, CA}, 2416 year = {2010}, 2417 petsc_uses = {KSP} 2418} 2419 2420@InProceedings{ bourdinknepleymaurini2010b, 2421 author = {Blaise Bourdin and Matthew G. Knepley and C. Maurini}, 2422 title = {Secondary Thermal Cracks in {EGS}: a Variational Approach}, 2423 booktitle = {Proceedings of the 34th Annual Meeting of the Geothermal Resources Council}, 2424 url = {https://www.math.lsu.edu/~bourdin/Biography_assets/Bourdin-Knepley-Maurini-2010.pdf}, 2425 note = {\url{https://www.math.lsu.edu/~bourdin/Biography_assets/Bourdin-Knepley-Maurini-2010.pdf}}, 2426 address = {Sacramento, CA}, 2427 year = {2010}, 2428 petsc_uses = {KSP} 2429} 2430 2431@Article{ chen2007full, 2432 title = {Full 3D tomography for the crustal structure of the Los Angeles region}, 2433 author = {Chen, P. and Zhao, L. and Jordan, T.H.}, 2434 journal = {Bulletin of the Seismological Society of America}, 2435 volume = {97}, 2436 number = {4}, 2437 pages = {1094}, 2438 year = {2007}, 2439 publisher = {Seismol Soc America}, 2440 petsc_uses = {KSP} 2441} 2442 2443@Article{ brown2010ens, 2444 author = {Brown, Jed}, 2445 affiliation = {Versuchsanstalt für Wasserbau, Hydrologie und Glaziologie (VAW), ETH Zürich, 2446 Zürich, Switzerland}, 2447 title = {Efficient Nonlinear Solvers for Nodal High-Order Finite Elements in {3D}}, 2448 journal = {Journal of Scientific Computing}, 2449 publisher = {Springer Netherlands}, 2450 issn = {0885-7474}, 2451 keyword = {Mathematics and Statistics}, 2452 pages = {48-63}, 2453 volume = {45}, 2454 issue = {1}, 2455 doi = {10.1007/s10915-010-9396-8}, 2456 year = {2010}, 2457 petsc_uses = {KSP} 2458} 2459 2460@PhDThesis{ brown2011, 2461 title = {Computational methods for ice flow simulation}, 2462 author = {Jed Brown}, 2463 school = {ETH Z{\"u}rich}, 2464 year = {2011}, 2465 petsc_uses = {KSP} 2466} 2467 2468@Article{ brown2013tmeice, 2469 title = {Achieving textbook multigrid efficiency for hydrostatic ice flow}, 2470 author = {Jed Brown and Barry F. Smith and Aron Ahmadia}, 2471 journal = {SIAM Journal on Scientific Computing}, 2472 volume = {35}, 2473 number = {2}, 2474 year = {2013}, 2475 pages = {359--375}, 2476 doi = {10.1137/110834512}, 2477 note = {Also preprint ANL/MCS-P743-1298}, 2478 petsc_uses = {KSP} 2479} 2480 2481@InProceedings{ brown2013quasinewton, 2482 author = {Jed Brown and Peter Brune}, 2483 title = {Low-rank quasi-{N}ewton updates for robust {J}acobian lagging in {N}ewton-type 2484 methods}, 2485 year = {2013}, 2486 booktitle = {International Conference on Mathematics and Computational Methods Applied to 2487 Nuclear Science and Engineering}, 2488 pages = {2554--2565}, 2489 petsc_uses = {KSP} 2490} 2491 2492@Misc{ spiegelman-siampp10, 2493 title = {Block Preconditioners and Advanced Software for Multiphysics Problems in Solid 2494 Earth Geodynamics}, 2495 author = {Marc Spiegelman}, 2496 note = {presentation at the 2010 SIAM Conference on Parallel Processing for Scientific 2497 Computing}, 2498 year = {2010}, 2499 petsc_uses = {KSP} 2500} 2501 2502@Article{ schauer2011a, 2503 author = {Marco Schauer and Sabine Langer and Jose E. Roman and Enrique S. 2504 Quintana-Ort\'{\i}}, 2505 title = {Large scale simulation of wave propagation in soils interacting with structures 2506 using {FEM} and {SBFEM}}, 2507 journal = {Journal of Computational Acoustics}, 2508 volume = {19}, 2509 number = {1}, 2510 pages = {75--93}, 2511 year = {2011}, 2512 doi = {10.1142/S0218396X11004316}, 2513 petsc_uses = {KSP} 2514} 2515 2516@Misc{ bsa2010, 2517 author = {J. Brown and B. Smith and A. Ahmadia}, 2518 title = {Achieving textbook multigrid efficiency for hydrostatic ice sheet flow}, 2519 note = {submitted to SIAM Journal on Scientific Computing}, 2520 year = {2012}, 2521 petsc_uses = {KSP} 2522} 2523 2524@Article{ kellerkatz2016, 2525 title = {The Role of Volatiles in Reactive Melt Transport in the Asthenosphere}, 2526 author = {Tobias Keller and Richard F. Katz}, 2527 journal = {Journal of Petrology}, 2528 doi = {10.1093/petrology/egw030}, 2529 url = {http://petrology.oxfordjournals.org/content/early/2016/07/15/petrology.egw030.abstract}, 2530 eprint = {http://petrology.oxfordjournals.org/content/early/2016/07/15/petrology.egw030.full.pdf+html}, 2531 year = {2016}, 2532 petsc_uses = {KSP} 2533} 2534 2535@Article{ weatherley12, 2536 author = {S. Weatherley and R.F. Katz}, 2537 title = {Melting and channelized magmatic flow in chemically heterogeneous, upwelling 2538 mantle}, 2539 journal = {Geochem.\ Geophys.\ Geosys.}, 2540 year = {2012}, 2541 volume = {13}, 2542 number = {1}, 2543 pages = {Q0AC18}, 2544 doi = {10.1029/2011GC003989}, 2545 petsc_uses = {KSP} 2546} 2547 2548@Article{ katz12, 2549 author = {R.F. Katz and S. Weatherley}, 2550 title = {Consequences of mantle heterogeneity for melt extraction at mid-ocean ridges}, 2551 journal = {Earth\ Planet.\ Sci.\ Lett.}, 2552 year = {2012}, 2553 doi = {10.1016/j.epsl.2012.04.042}, 2554 volume = {335-336}, 2555 pages = {226-237}, 2556 petsc_uses = {KSP} 2557} 2558 2559@Article{ katz10b, 2560 author = {R.F. Katz}, 2561 title = {Porosity-driven convection and asymmetry beneath mid-ocean ridges}, 2562 journal = {Geochem.\ Geophys.\ Geosys.}, 2563 volume = {10}, 2564 number = {Q0AC07}, 2565 year = {2010}, 2566 doi = {10.1029/2010GC003282}, 2567 petsc_uses = {KSP} 2568} 2569 2570@Article{ england10, 2571 author = {P.C. England and R.F. Katz}, 2572 title = {Melting above the anhydrous solidus controls the location of volcanic arcs}, 2573 journal = {Nature}, 2574 year = {2010}, 2575 volume = {467}, 2576 pages = {700--703}, 2577 doi = {10.1038/nature09417}, 2578 petsc_uses = {KSP} 2579} 2580 2581@Article{ weatherley10, 2582 author = {S. Weatherley and R.F. Katz}, 2583 title = {Plate-Driven Mantle Dynamics and Global Patterns of Mid-Ocean Ridge Bathymetry}, 2584 journal = {Geochem.\ Geophys.\ Geosys.}, 2585 year = {2010}, 2586 volume = {11}, 2587 number = {10}, 2588 doi = {10.1029/2010GC003192}, 2589 petsc_uses = {KSP} 2590} 2591 2592@Article{ katz10, 2593 author = {R.F. Katz and M.G. Worster}, 2594 title = {The stability of ice-sheet grounding lines}, 2595 journal = {Proc.~Roy.~Soc.~A}, 2596 year = {2010}, 2597 volume = {466}, 2598 pages = {1597--1620}, 2599 doi = {10.1098/rspa.2009.0434}, 2600 url = {http://www.earth.ox.ac.uk/~richardk/publications/Katz_Worster_PRSA10.pdf}, 2601 petsc_uses = {KSP} 2602} 2603 2604@Article{ kyrkesmith2013stress, 2605 title = {Stress balances of ice streams in a vertically integrated, higher-order 2606 formulation}, 2607 author = {Kyrke-Smith, T.M. and Katz, R.F. and Fowler, A.C.}, 2608 journal = {Journal of Glaciology}, 2609 volume = {59}, 2610 number = {215}, 2611 pages = {449--466}, 2612 year = {2013}, 2613 doi = {10.3189/2013JoG12J140}, 2614 petsc_uses = {KSP} 2615} 2616 2617@Article{ takei2013anisotropy1, 2618 author = {Takei Y. and R.F. Katz}, 2619 title = {{Consequences of viscous anisotropy in a deforming, two-phase aggregate: 1. 2620 Governing equations and linearised analysis}}, 2621 journal = {J.\ Fluid\ Mech.}, 2622 year = {2013}, 2623 volume = {734}, 2624 pages = {424-455}, 2625 doi = {10.1017/jfm.2013.482}, 2626 petsc_uses = {KSP} 2627} 2628 2629@Article{ katz2013anisotropy2, 2630 author = {Katz R.F. and Y. Takei}, 2631 title = {{Consequences of viscous anisotropy in a deforming, two-phase aggregate: 2. 2632 Numerical solutions of the full equations}}, 2633 journal = {J.\ Fluid\ Mech.}, 2634 year = {2013}, 2635 volume = {734}, 2636 pages = {456-485}, 2637 doi = {10.1017/jfm.2013.483}, 2638 petsc_uses = {KSP} 2639} 2640 2641@Article{ kyrke-smith2014subglacial, 2642 author = {Kyrke-Smith, T.M. and R.F. Katz and A.C. Fowler}, 2643 title = {Subglacial hydrology and the formation of ice streams}, 2644 journal = {Proc.\ Roy.\ Soc.\ A}, 2645 year = {2014}, 2646 volume = {470}, 2647 number = {2161}, 2648 doi = {10.1098/rspa.2013.0494}, 2649 petsc_uses = {KSP} 2650} 2651 2652@Article{ spiegelmanwilsonvankeken2013, 2653 author = {{Spiegelman}, M.~W. and {Wilson}, C.~R. and {Van Keken}, P.~E. }, 2654 title = {{TerraFERMA: The Transparent Finite Element Rapid Model Assembler for 2655 multi-physics problems in the solid Earth sciences}}, 2656 journal = {AGU Fall Meeting Abstracts}, 2657 keywords = {0560 COMPUTATIONAL GEOPHYSICS Numerical solutions, 1902 INFORMATICS Community 2658 modeling frameworks, 1906 INFORMATICS Computational models, algorithms}, 2659 year = {2013}, 2660 month = dec, 2661 pages = {A2208}, 2662 adsurl = {http://adsabs.harvard.edu/abs/2013AGUFMDI31A2208S}, 2663 adsnote = {Provided by the SAO/NASA Astrophysics Data System}, 2664 petsc_uses = {KSP} 2665} 2666 2667@Article{ bueler2009shallow, 2668 title = {{Shallow shelf approximation as a ``sliding law'' in a thermomechanically coupled 2669 ice sheet model}}, 2670 author = {Ed Bueler and Jed Brown}, 2671 journal = {Journal of Geophysical Research-Earth Surface}, 2672 volume = {114}, 2673 number = {F3}, 2674 pages = {F03008}, 2675 year = {2009}, 2676 publisher = {American Geophysical Union}, 2677 petsc_uses = {KSP} 2678} 2679 2680@Article{ bueler2007est, 2681 title = {{Exact solutions to the thermomechanically coupled shallow ice approximation: 2682 effective tools for verification}}, 2683 author = {Ed Bueler and Jed Brown and Craig Lingle}, 2684 journal = {J. Glaciol}, 2685 volume = {53}, 2686 pages = {499--516}, 2687 year = {2007}, 2688 petsc_uses = {KSP} 2689} 2690 2691@Article{ bueler2007fcv, 2692 title = {{Fast computation of a viscoelastic deformable Earth model for ice-sheet 2693 simulations}}, 2694 author = {Ed Bueler and Craig S. Lingle and Jed Brown}, 2695 journal = {Ann. Glaciol}, 2696 volume = {46}, 2697 pages = {97--105}, 2698 year = {2007}, 2699 petsc_uses = {KSP} 2700} 2701 2702@Article{ bueler2005iso, 2703 author = {Ed Bueler and Craig S. Lingle and Jed A. Kallen-Brown and David N. Covey and 2704 Latrice N. Bowman}, 2705 title = {Exact solutions and numerical verification for isothermal ice sheets}, 2706 journal = {J. Glaciol.}, 2707 volume = {51}, 2708 number = {173}, 2709 pages = {291--306}, 2710 year = {2005}, 2711 petsc_uses = {KSP} 2712} 2713 2714@Article{ chao2008programming, 2715 title = {{Programming on Numerical Simulation of Tsunami with PETSc and FEPG}}, 2716 author = {Chao-fan, Z. and Yao-lin, S.}, 2717 journal = {Earthquake}, 2718 year = {2008}, 2719 petsc_uses = {KSP} 2720} 2721 2722@Article{ marti2014, 2723 author = {Marti, P. and Schaeffer, N. and Hollerbach, R. and Cébron, D. and Nore, C. and 2724 Luddens, F. and Guermond, J.-L. and Aubert, J. and Takehiro, S. and Sasaki, Y. and 2725 Hayashi, Y.-Y. and Simitev, R. and Busse, F. and Vantieghem, S. and Jackson, A.}, 2726 title = {Full sphere hydrodynamic and dynamo benchmarks}, 2727 journal = {Geophysical Journal International}, 2728 year = {2014}, 2729 doi = {10.1093/gji/ggt518}, 2730 url = {http://gji.oxfordjournals.org/content/early/2014/01/26/gji.ggt518.abstract}, 2731 petsc_uses = {KSP} 2732} 2733 2734@InProceedings{ ganfulukyangxueyang2013, 2735 author = {Gan, Lin and Fu, Haohuan and Luk, Wayne and Yang, Chao and Xue, Wei and Yang, 2736 Guangwen}, 2737 title = {Global Atmospheric Simulation on a Reconfigurable Platform}, 2738 booktitle = {Proceedings of the 2013 IEEE 21st Annual International Symposium on 2739 Field-Programmable Custom Computing Machines}, 2740 series = {FCCM '13}, 2741 pages = {230--}, 2742 year = {2013}, 2743 isbn = {978-0-7695-4969-9}, 2744 doi = {10.1109/FCCM.2013.26}, 2745 acmid = {2495688}, 2746 publisher = {IEEE Computer Society}, 2747 petsc_uses = {KSP} 2748} 2749 2750@InProceedings{ ganfuchaolukxuemencerhuangyang2014, 2751 author = {Lin Gan and Haohuan Fu and Chao Yang and Luk, W. and Wei Xue and Mencer, O. and 2752 Xiaomeng Huang and Guangwen Yang}, 2753 booktitle = {Field Programmable Logic and Applications (FPL), 2014 24th International 2754 Conference on}, 2755 title = {A highly-efficient and green data flow engine for solving euler atmospheric 2756 equations}, 2757 year = {2014}, 2758 month = sep, 2759 pages = {1-6}, 2760 doi = {10.1109/FPL.2014.6927462}, 2761 petsc_uses = {KSP} 2762} 2763 2764%Aagaard, B., Williams, C., Knepley, M. (2011). PyLith: A finite-element code for modeling quasi-static and dynamic crustal deformation (abstract), EarthScope National Meeting, Austin, Texas, May 17–20. 2765%Aagaard, B., Williams, C., and Knepley, M. (2011). PyLith: A finite-element code for modeling quasi-static and dynamic crustal deformation (abstract), Southern California Earthquake Center Annual Meeting, Palm Springs, California, September 11–14. 2766%Aagaard, B., Williams, C., and Knepley, M. (2012). PyLith: A Finite-Element Code for Modeling Quasi-Static and Dynamic Crustal Deformation (abstract), Seismological Society of America Annual Meeting, San Diego, California, April 17-19. 2767@Article{ aagaardknepleywilliams13, 2768 title = {A Domain Decomposition Approach to Implementing Fault Slip in Finite-Element 2769 Models of Quasi-static and Dynamic Crustal Deformation}, 2770 author = {Brad T. Aagaard and Matthew G. Knepley and Charles A. Williams}, 2771 journal = {Journal of Geophysical Research: Solid Earth}, 2772 volume = {118}, 2773 number = {6}, 2774 pages = {3059--3079}, 2775 issn = {2169-9356}, 2776 doi = {10.1002/jgrb.50217}, 2777 keywords = {fault slip, finite-element modeling, crustal deformation, earthquake physics}, 2778 year = {2013}, 2779 petsc_uses = {KSP} 2780} 2781 2782@InProceedings{ aagaardknepleywilliams11, 2783 author = {Charles A. Williams and Brad Aagaard and Matthew G. Knepley}, 2784 title = {{PyLith}: A Finite-Element Code for Modeling Quasi-Static and Dynamic Crustal 2785 Deformation}, 2786 booktitle = {Eos Transactions of the AGU}, 2787 organization = {American Geophysical Union}, 2788 note = {Fall Meeting Supplemental, Abstract DI14A-08}, 2789 year = {2011}, 2790 petsc_uses = {KSP} 2791} 2792 2793@InProceedings{ knepley10b, 2794 author = {Matthew G. {Knepley}}, 2795 title = {Acceleration of low order finite element computation with {GPUs} (Invited)}, 2796 booktitle = {Eos Transactions of the AGU}, 2797 organization = {American Geophysical Union}, 2798 note = {Fall Meeting Supplemental, Abstract IN44A-01}, 2799 year = {2010}, 2800 petsc_uses = {KSP} 2801} 2802 2803@InProceedings{ mayknepleygurnis09, 2804 author = {Dave A. May and Matthew G. Knepley and Michael Gurnis}, 2805 title = {{CitcomSX}: Robust preconditioning in {CitcomS} via {PETSc}}, 2806 booktitle = {Eos Transactions of the AGU}, 2807 organization = {American Geophysical Union}, 2808 note = {Fall Meeting Supplemental, Abstract P31A-A1241}, 2809 year = {2009}, 2810 petsc_uses = {KSP} 2811} 2812 2813@InProceedings{ yuenknepleyerlebacherwright09, 2814 author = {David A. Yuen and Matthew G. Knepley and Gordon Erlebacher and Grady B. Wright}, 2815 title = {The Coming Role of {GPU} in Computational Geodynamics}, 2816 booktitle = {Eos Transactions of the AGU}, 2817 organization = {American Geophysical Union}, 2818 note = {Fall Meeting Supplemental, Abstract DI22A-05}, 2819 year = {2009}, 2820 petsc_uses = {KSP} 2821} 2822 2823@InProceedings{ aagaardknepleywilliams08, 2824 author = {Brad Aagaard and Charles A. Williams and Matthew G. Knepley}, 2825 title = {{PyLith}: A Finite-Element Code for Modeling Quasi-Static and Dynamic Crustal 2826 Deformation}, 2827 booktitle = {Eos Transactions of the AGU}, 2828 organization = {American Geophysical Union}, 2829 volume = {89}, 2830 number = {53}, 2831 note = {Fall Meeting Supplemental, Abstract T41A-1925}, 2832 year = {2007}, 2833 petsc_uses = {KSP} 2834} 2835 2836@InProceedings{ aagaardknepleywilliams07, 2837 author = {Charles A. Williams and Brad Aagaard and Matthew G. Knepley}, 2838 title = {{PyLith}: A Finite-Element Code for Modeling Quasi-Static and Dynamic Crustal 2839 Deformation}, 2840 booktitle = {Eos Transactions of the AGU}, 2841 organization = {American Geophysical Union}, 2842 volume = {88}, 2843 number = {52}, 2844 note = {Fall Meeting Supplemental, Abstract T21B-1798}, 2845 year = {2007}, 2846 petsc_uses = {KSP} 2847} 2848 2849@InProceedings{ aagaardknepleywilliams05, 2850 author = {Charles A. Williams and Brad Aagaard and Matthew G. Knepley}, 2851 title = {Development of software for studying earthquakes across multiple spatial and 2852 temporal scales by coupling quasi-static and dynamic simulations}, 2853 booktitle = {Eos Transactions of the AGU}, 2854 organization = {American Geophysical Union}, 2855 volume = {86}, 2856 number = {52}, 2857 note = {Fall Meeting Supplemental, Abstract S53A-1072}, 2858 year = {2005}, 2859 petsc_uses = {KSP} 2860} 2861 2862@InProceedings{ williamsgablehagermeadeaagaardknepley08, 2863 author = {Charles A. Williams and Carl Gable and Bradford H. Hager and Brendan Meade and 2864 Brad Aagaard and Matthew G. Knepley}, 2865 title = {Modeling of Multiple Earthquake Cycles in Southern California Using the {SCEC} 2866 Community Fault Model}, 2867 booktitle = {Proceedings of Geosciences '08}, 2868 address = {Wellington, NZ}, 2869 month = nov, 2870 year = {2008}, 2871 petsc_uses = {KSP} 2872} 2873 2874@TechReport{ zhang07, 2875 title = {Two New Approaches in Solving the Nonlinear Shallow Water Equations for 2876 Tsunamis}, 2877 author = {C. Zhang and M. G. Knepley and D. A. Yuen and Y. Shi}, 2878 type = {Preprint}, 2879 number = {ANL/MCS-P1459-0907}, 2880 institution = {ANL}, 2881 month = sep, 2882 year = {2007}, 2883 petsc_uses = {KSP} 2884} 2885 2886@Article{ katz08b, 2887 author = {Richard F. Katz}, 2888 title = {Magma dynamics with the enthalpy method: {B}enchmark solutions and magmatic 2889 focusing at mid-ocean ridges}, 2890 journal = {J. Petrology}, 2891 year = {2008}, 2892 volume = {49}, 2893 pages = {2099--2121}, 2894 doi = {10.1093/petrology/egn058}, 2895 petsc_uses = {KSP} 2896} 2897 2898@Article{ hgrhkjvv2008, 2899 title = {On preconditioning for a parallel solution of the Richards equation}, 2900 author = {Michael Herbst and Swen Gottschalk and Martin Reissel and Horst Hardelauf and Roy 2901 Kasteel and Matthieu Javaux and Jan Vanderborght and Harry Vereeckena}, 2902 journal = {Computers and Geosciences}, 2903 volume = {34}, 2904 pages = {1958--1963}, 2905 year = {2008}, 2906 petsc_uses = {KSP} 2907} 2908 2909@Article{ maymoresi2008, 2910 title = {Preconditioned iterative methods for {Stokes} flow problems arising in 2911 computational geodynamics}, 2912 journal = {Physics of the Earth and Planetary Interiors}, 2913 volume = {171}, 2914 number = {1-4}, 2915 pages = {33--47}, 2916 year = {2008}, 2917 note = {{R}ecent Advances in Computational Geodynamics: Theory, Numerics and 2918 Applications}, 2919 issn = {0031-9201}, 2920 doi = {10.1016/j.pepi.2008.07.036}, 2921 author = {Dave A. May and Louis Moresi}, 2922 keywords = {Stokes flow, Krylov, Preconditioner, Schur complement, BFBt}, 2923 petsc_uses = {KSP} 2924} 2925 2926@Article{ kausmuhlhausmay2010, 2927 title = {A stabilization algorithm for geodynamic numerical simulations with a free 2928 surface}, 2929 author = {Boris JP Kaus and Hans M{\"u}hlhaus and Dave A May}, 2930 journal = {Physics of the Earth and Planetary Interiors}, 2931 volume = {181}, 2932 number = {1}, 2933 pages = {12--20}, 2934 year = {2010}, 2935 petsc_uses = {KSP} 2936} 2937 2938@Article{ duretzmaygeryatackley2011, 2939 title = {Discretization errors and free surface stabilization in the finite difference and 2940 marker-in-cell method for applied geodynamics: A numerical study}, 2941 author = {Thibault Duretz and David Alexander May and Taras V Gerya and Paul J Tackley}, 2942 journal = {Geochemistry, Geophysics, Geosystems}, 2943 volume = {12}, 2944 number = {7}, 2945 year = {2011}, 2946 petsc_uses = {KSP} 2947} 2948 2949@Article{ furuichimaytackley2011, 2950 title = {Development of a {Stokes} flow solver robust to large viscosity jumps using a 2951 {Schur} complement approach with mixed precision arithmetic}, 2952 author = {Mikito Furuichi and Dave A May and Paul J Tackley}, 2953 journal = {Journal of Computational Physics}, 2954 volume = {230}, 2955 number = {24}, 2956 pages = {8835--8851}, 2957 year = {2011}, 2958 petsc_uses = {KSP} 2959} 2960 2961@Article{ kellermaykaus2013, 2962 title = {Numerical modelling of magma dynamics coupled to tectonic deformation of 2963 lithosphere and crust}, 2964 author = {Tobias Keller and Dave A May and Boris JP Kaus}, 2965 journal = {Geophysical Journal International}, 2966 volume = {195}, 2967 number = {3}, 2968 pages = {1406--1442}, 2969 year = {2013}, 2970 petsc_uses = {KSP} 2971} 2972 2973@Article{ schellartfreemanstegmanmoresimay2007, 2974 title = {Evolution and diversity of subduction zones controlled by slab width}, 2975 author = {WP Schellart and Justin Freeman and David R Stegman and Louis Moresi and David A 2976 May}, 2977 journal = {Nature}, 2978 volume = {446}, 2979 number = {7133}, 2980 pages = {308--311}, 2981 year = {2007}, 2982 petsc_uses = {KSP} 2983} 2984 2985@Article{ cramerischmelinggolabekduretzorendtbuitermaykausgeryatackley2012, 2986 title = {A comparison of numerical surface topography calculations in geodynamic 2987 modelling: an evaluation of the sticky air method}, 2988 author = {F Crameri and H Schmeling and GJ Golabek and T Duretz and R Orendt and SJH Buiter 2989 and David A May and Boris JP Kaus and Taras V Gerya and Paul J Tackley}, 2990 journal = {Geophysical Journal International}, 2991 volume = {189}, 2992 number = {1}, 2993 pages = {38--54}, 2994 year = {2012}, 2995 petsc_uses = {KSP} 2996} 2997 2998@Article{ stegmanfreemanschellartmoresimay2006, 2999 title = {Influence of trench width on subduction hinge retreat rates in 3-D models of slab 3000 rollback}, 3001 author = {David R Stegman and Justin Freeman and WP Schellart and Louis Moresi and David A 3002 May}, 3003 journal = {Geochemistry, Geophysics, Geosystems}, 3004 volume = {7}, 3005 number = {3}, 3006 year = {2006}, 3007 petsc_uses = {KSP} 3008} 3009 3010@InProceedings{ may2014ptatin, 3011 title = {{pTatin3D}: {H}igh-performance methods for long-term lithospheric dynamics}, 3012 author = {Dave A May and Jed Brown and Laetitia {Le Pourhiet}}, 3013 booktitle = {Proceedings of {SC14}: The {International Conference for High Performance 3014 Computing, Networking, Storage and Analysis}}, 3015 organization = {ACM}, 3016 pages = {274--284}, 3017 year = {2014}, 3018 doi = {10.1109/SC.2014.28}, 3019 petsc_uses = {KSP} 3020} 3021 3022@Article{ maybrownpourhiet2015, 3023 title = {A scalable, matrix-free multigrid preconditioner for finite element 3024 discretizations of heterogeneous {Stokes} flow}, 3025 author = {David A May and Jed Brown and Laetitia {Le Pourhiet}}, 3026 journal = {Computer Methods in Applied Mechanics and Engineering}, 3027 volume = {290}, 3028 pages = {496--523}, 3029 year = {2015}, 3030 doi = {10.1016/j.cma.2015.03.014}, 3031 petsc_uses = {KSP} 3032} 3033 3034@Article{ duretzmayyamato2016, 3035 title = {A free surface capturing discretization for the staggered grid finite difference 3036 scheme}, 3037 author = {Thibault Duretz and Dave A May and Philippe Yamato}, 3038 journal = {Geophysical Journal International}, 3039 volume = {204}, 3040 number = {3}, 3041 pages = {1518--1530}, 3042 year = {2016}, 3043 petsc_uses = {KSP} 3044} 3045 3046@Article{ rhebergenwellskatzwathen2014, 3047 author = {Sander Rhebergen and Garth N. Wells and Richard F. Katz and Andrew J. Wathen}, 3048 title = {Analysis of block-preconditioners for models of coupled magma/mantle dynamics}, 3049 journal = {SIAM J. Sci. Comput.}, 3050 volume = {36}, 3051 pages = {A1960--A1977}, 3052 year = {2014}, 3053 petsc_uses = {KSP} 3054} 3055 3056@Article{ katz08a, 3057 author = {R.F. Katz and M.G. Worster}, 3058 title = {Simulation of directional solidification, thermochemical convection, and chimney 3059 formation in a {H}ele-{S}haw cell}, 3060 journal = {J. Comp. Phys.}, 3061 volume = {227}, 3062 pages = {9823-9840}, 3063 year = {2008}, 3064 doi = {10.1016/j.jcp.2008.06.039}, 3065 petsc_uses = {KSP} 3066} 3067 3068@Article{ aabg2007, 3069 author = {A. Askan and V. Akcelik and J. Bielak and O. Ghattas}, 3070 title = {Full waveform inversion for seismic velocity and anelastic losses in 3071 heterogeneous structures}, 3072 journal = {Bulletin of Seismological Society of America}, 3073 year = {2007}, 3074 volume = {97}, 3075 pages = {1990--2008}, 3076 petsc_uses = {KSP} 3077} 3078 3079@Article{ katz2006, 3080 author = {Richard F. Katz and Marc Spiegelman and Benjamin Holtzman}, 3081 title = {The dynamics of melt and shear localization in partially molten aggregates}, 3082 journal = {Nature}, 3083 year = {2006}, 3084 volume = {442}, 3085 pages = {676--679}, 3086 month = aug, 3087 day = {10}, 3088 url = {http://www.nature.com/nature/journal/v442/n7103/abs/nature05039.html}, 3089 petsc_uses = {KSP} 3090} 3091 3092@InProceedings{ mqrs2003, 3093 author = {Roland Masson and Philippe Quandalle and Stephane Requena and Robert Scheichl}, 3094 year = {2003}, 3095 title = {Parallel Preconditioning for Sedimentary Basin Simulations}, 3096 booktitle = {Large-Scale Scientific Computing: 4th International Conference, LSSC 2003, 3097 Sozopol, Bulgaria, June 4-8, 2003}, 3098 petsc_uses = {KSP} 3099} 3100 3101@InProceedings{ lichtner1, 3102 author = {Chuan Lu and Peter C. Lichtner}, 3103 year = {2005}, 3104 title = {{PFLOTRAN}: Massively Parallel {3-D} Simulator for {CO2} Sequestration in 3105 Geologic Media}, 3106 booktitle = {Fourth Annual Conference on Carbon Capture and Sequestration DOE/NETL}, 3107 lab = {LANL}, 3108 petsc_uses = {KSP} 3109} 3110 3111@Article{ hammondlichtnermills2014, 3112 title = {Evaluating the Performance of Parallel Subsurface Simulators: An Illustrative 3113 Example with {PFLOTRAN}}, 3114 author = {Glenn E. Hammond and Peter C. Lichtner and Richard Tran Mills}, 3115 journal = {Water Resources Research}, 3116 volume = {50}, 3117 number = {1}, 3118 pages = {208--228}, 3119 doi = {10.1002/2012WR013483}, 3120 year = {2014}, 3121 petsc_uses = {KSP} 3122} 3123 3124@Article{ smw2003, 3125 author = {R. Scheichl and R. Masson and J. Wendebourg}, 3126 title = {Decoupling and Block Preconditioning for Sedimentary Basin Simulations}, 3127 journal = {Computational Geosciences}, 3128 year = {2003}, 3129 volume = {7}, 3130 pages = {295--318}, 3131 url = {http://www.maths.bath.ac.uk/MATHEMATICS/preprints.html}, 3132 petsc_uses = {KSP} 3133} 3134 3135@Article{ kees-miller-03, 3136 author = {C. E. Kees and C.T. Miller and E.W. Jenkins and C.T. Kelley}, 3137 title = {Versatile multilevel Schwarz preconditioners for multiphase flow}, 3138 journal = {Computational Geosciences}, 3139 year = {2003}, 3140 volume = {7}, 3141 pages = {91--114}, 3142 petsc_uses = {KSP} 3143} 3144 3145@Article{ bk2003, 3146 author = {JN Buur and T Kuehnel}, 3147 title = {Improving depth imaging by automated model updating}, 3148 journal = {The Leading Edge}, 3149 year = {2003}, 3150 volume = {22}, 3151 pages = {310-318}, 3152 petsc_uses = {KSP} 3153} 3154 3155@Article{ frederickbuffett2016, 3156 title = {Submarine groundwater discharge as a possible formation mechanism for 3157 permafrost-associated gas hydrate on the circum-Arctic continental shelf}, 3158 author = {Jennifer M. Frederick and Bruce A. Buffett}, 3159 journal = {Journal of Geophysical Research: Solid Earth}, 3160 volume = {121}, 3161 number = {3}, 3162 pages = {1383--1404}, 3163 issn = {2169-9356}, 3164 doi = {10.1002/2015JB012627}, 3165 year = {2016}, 3166 petsc_uses = {KSP} 3167} 3168 3169% LiteralHTML: <td width="100%" colspan="2"><hr size="4" color="#FF5B5B"> </td> 3170% LiteralHTML:<font color="#FF0000"> 3171% LiteralHTML:Simulation of the earth's mantle and crust is valuable to 3172% LiteralHTML:understanding earthquakes, volcanos, etc. PETSc has been used for a 3173% LiteralHTML:variety of these simulations.</p> 3174% LiteralHTML:</font> 3175% LiteralHTML: 3176@InProceedings{ appelbe1, 3177 author = {B. Appelbe and D. May and S. Quenette and S. Tang and F. Wang and L. Moresi}, 3178 year = {2003}, 3179 title = {Mantle convection modeling with viscoelastic/brittle lithosphere: Numerical and 3180 computational methodology}, 3181 page = {781}, 3182 booktitle = {Lecture Notes in Computer Science, volume 2659, part of the ICCS Conference 3183 Proceedings}, 3184 publisher = {Springer-Verlag}, 3185 url = {http://vpac.org/VDT/SNARK/Presentations/RD0201-paper-20030602-ICCS03_ACES03_LNCS-mantle_convection_modelling.pdf}, 3186 petsc_uses = {KSP} 3187} 3188 3189% LiteralHTML:<a name="katz"> 3190@InProceedings{ gd1, 3191 author = {Guillaume Dumont and Michel Kern}, 3192 title = {Parallelization of a 3D Seismic Migration Code with PETSc}, 3193 year = {1999}, 3194 booktitle = {Proceedings of the Ninth SIAM Conference on Parallel Processing for Scientific 3195 Computing}, 3196 petsc_uses = {KSP} 3197} 3198 3199% LiteralHTML: <center><img alt="" src="images/katz1.jpg"> <img alt="" src="images/katz3.jpg"> 3200% LiteralHTML: <img alt="" src="images/katz2.jpg"></center></p> 3201% LiteralHTML:<font color="#FF0000"> 3202% LiteralHTML: Figures from the work of Richard Katz 3203@PhDThesis{ katzthesis, 3204 author = {R.F. Katz}, 3205 title = {The deep roots of volcanoes: models of magma dynamics with applications to 3206 subduction zones}, 3207 school = {Columbia University}, 3208 year = {2005}, 3209 url = {http://www.ldeo.columbia.edu/\~{ }katz/thesis/Katz_Dissertation_Columbia05.pdf}, 3210 petsc_uses = {KSP} 3211} 3212 3213@InCollection{ knepleykatzsmith06, 3214 author = {Knepley, Matthew G. and Katz, Richard F. and Smith, Barry}, 3215 affiliation = {Argonne National Laboratory Mathematics and Computer Science Division Argonne IL 3216 USA}, 3217 title = {Developing a Geodynamics Simulator with {PETSc}}, 3218 booktitle = {Numerical Solution of Partial Differential Equations on Parallel Computers}, 3219 series = {Lecture Notes in Computational Science and Engineering}, 3220 editor = {Bruaset, Are Magnus and Tveito, Aslak}, 3221 publisher = {Springer Berlin Heidelberg}, 3222 isbn = {978-3-540-31619-0}, 3223 keyword = {Mathematics and Statistics}, 3224 pages = {413-438}, 3225 volume = {51}, 3226 doi = {10.1007/3-540-31619-1_12}, 3227 year = {2006}, 3228 petsc_uses = {KSP} 3229} 3230 3231@Article{ katz04, 3232 author = {Richard F. Katz and Marc Spiegelman and S.M. Carbotte}, 3233 title = {Ridge migration, asthenospheric flow and the origin of magmatic segmentation in 3234 the global mid-ocean ridge system}, 3235 journal = {Geophys.\ Res.\ Letts.}, 3236 year = {2004}, 3237 volume = {31}, 3238 pages = {L15605}, 3239 petsc_uses = {KSP} 3240} 3241 3242@Article{ katz07, 3243 author = {Richard F. Katz and Matthew G. Knepley and Barry Smith and Marc Spiegelman and 3244 Ethan Coon}, 3245 title = {Numerical simulation of geodynamic processes with the {Portable Extensible 3246 Toolkit for Scientific Computation}}, 3247 journal = {Phys. Earth Planet. In.}, 3248 volume = {163}, 3249 pages = {52--68}, 3250 year = {2007}, 3251 petsc_uses = {KSP} 3252} 3253 3254@Article{ williams2006development, 3255 title = {{Development of a package for modeling stress in the lithosphere}}, 3256 author = {Williams, CA}, 3257 journal = {Eos Trans. AGU}, 3258 volume = {87}, 3259 pages = {36}, 3260 year = {2006}, 3261 petsc_uses = {KSP} 3262} 3263 3264@Article{ goverswortel05, 3265 author = {R. Govers and M.J.R. Wortel}, 3266 title = {Lithosphere tearing at STEP faults: response to edges of subduction zones}, 3267 journal = {Earth and Planetary Science Letters}, 3268 volume = {236/1-2}, 3269 pages = {505-523}, 3270 year = {2005}, 3271 petsc_uses = {KSP} 3272} 3273 3274@InProceedings{ snark2, 3275 author = {B. Appelbe and D. May and S. Quenette and S. Tang and F. Wang and L. Moresi}, 3276 year = {2002}, 3277 title = {Towards Rapid Geoscience Model Development - The {Snark} Project}, 3278 booktitle = {Proceedings of 3rd ACES (APEC Cooperation for Earthquake Simulation) Workshop}, 3279 petsc_uses = {KSP} 3280} 3281 3282@Article{ snark1, 3283 author = {Bill Appelbe and David May and Louis Moresi and Steve Quenette and Siew-Chiang 3284 Tan and Feng Wang}, 3285 title = {Snark - A Reusable Framwork for Geoscience Computational Models}, 3286 journal = {Submitted to Pure and Applied Geosciences}, 3287 petsc_uses = {KSP} 3288} 3289 3290@InProceedings{ earthquake2003, 3291 author = {Volkan Akcelik and Jacobo Bielak and George Biros and Ioannis Epanomeritakis and 3292 Antonio Fernandez and Omar Ghattas and Eui Joong Kim and David O'Hallaron and 3293 Tiankai Tu}, 3294 year = {2003}, 3295 title = {High Resolution Forward and Inverse Earthquake Modeling on Terascale Computers}, 3296 booktitle = {Proceedings of SC2003}, 3297 note = {A winner of the Gordon Bell Prize for special achievement at SC2003}, 3298 petsc_uses = {KSP} 3299} 3300 3301@InProceedings{ stefano12, 3302 author = {Michele De Stefano}, 3303 title = {Simultaneous Joint Inversion of Refraction Tomography and Magnetic Data}, 3304 booktitle = {PIERS Proceedings}, 3305 month = aug, 3306 address = {Moscow, RUSSIA}, 3307 pages = {491--495}, 3308 year = {2012}, 3309 petsc_uses = {KSP} 3310} 3311 3312%http://www.piers.org/piersproceedings/download.php?file=cGllcnMyMDEyTW9zY293fDJBN18wNDkxLnBkZnwxMjAzMTUwNDE2MDY= 3313 3314% LiteralHTML: <td width="100%" colspan="2"><hr size="4" color="#FF5B5B"> </td> 3315% LiteralHTML: <center><img alt="" 3316% LiteralHTML: src="images/ocean.jpg"></center></p> 3317@Article{ khatiwala07, 3318 author = {Khatiwala, S.}, 3319 title = {A computational framework for simulation of biogeochemical tracers in the ocean}, 3320 journal = {Glob. Biogeochem. Cycles}, 3321 volume = {21}, 3322 doi = {10.1029/2007GB002923}, 3323 year = {2007}, 3324 url = { http://www.ldeo.columbia.edu/\~{ }spk/Papers/KhatiwalaMatrixBiogeochemGBC07.pdf} 3325} 3326 3327@Article{ dks2004, 3328 author = {Sergey Danilov, Gennady Kivman and Jens Schroeter}, 3329 journal = {Ocean Modelling}, 3330 year = {2004}, 3331 volume = {6(2)}, 3332 pages = {125-150}, 3333 title = {A finite-element Ocean Model: Principles and Evaluation}, 3334 url = {http://www.sciencedirect.com/science?_ob=IssueURL&_tockey=%23TOC%236214%232004%23999939997%231%23FLA%23Volume_6,_Issue_2,_Pages_101-190_(2004)&_auth=y&view=c&_acct=C000007278&_version=1&_urlVersion=0&_userid=97338&md5=c3a50a31c599d8d38c8ce1f29117f267}, 3335 petsc_uses = {KSP} 3336} 3337 3338@Article{ danilov1, 3339 author = {S. Danilov and G. Kivman and J. Schroter}, 3340 year = {2004}, 3341 title = {Evaluation of an eddy-permitting finite-element ocean model in the North 3342 Atlantic}, 3343 journal = {Ocean Modelling}, 3344 petsc_uses = {KSP} 3345} 3346 3347@Article{ nerger1, 3348 author = {L. Nerger and S. Danilov and G. Kivman and W. Hiller and J. Schroter}, 3349 year = {2004}, 3350 title = {Data Assimilation with the Ensemble Kalman Filter and the SEIK Filter applied to 3351 a Finite Element Model of the North Atlantic}, 3352 journal = {Journal of marine systems}, 3353 petsc_uses = {KSP} 3354} 3355 3356@Conference{ rakowsky2003self, 3357 title = {{A self-adaptive finite element model of the atmosphere}}, 3358 author = {Rakowsky, N. and Frickenhaus, S. and Hiller, W. and L{\\"a}uter, M. and Handorf, 3359 D. and Dethloff, K. and Zwieflhofer, W. and Kreitz, N.}, 3360 booktitle = {Realizing teracomputing: proceedings of the tenth ECMWF Workshop on the Use of 3361 High Performance Computing in Meteorology: Reading, UK, 4-8 November, 2002}, 3362 pages = {279}, 3363 isbn = {981238376X}, 3364 year = {2003}, 3365 organization = {World Scientific Pub Co}, 3366 petsc_uses = {KSP} 3367} 3368 3369@Article{ lauter3, 3370 author = {M. Lauter}, 3371 year = {2004}, 3372 title = {GrossrAumige Zirkulationsstrukturen in einem nichtlinearen adaptiven 3373 AtmosphArenmodell}, 3374 journal = {Berichte zur Polar- und Meeresforschung}, 3375 petsc_uses = {KSP} 3376} 3377 3378@Article{ lauter2, 3379 author = {M. Lauter and D. Handorf and K. Dethloff}, 3380 year = {2004}, 3381 title = {Unsteady analytical solutions of the spherical shallow water equations}, 3382 journal = {Journal of computational physics}, 3383 petsc_uses = {KSP} 3384} 3385 3386@PhDThesis{ lauter1, 3387 author = {M. Lauter}, 3388 year = {2004}, 3389 title = {GrossAumige Zirkulationsstrukturen in einem nichtlinearen adaptiven 3390 AtmosphArenmodell}, 3391 institution = {UniversitAt Potsdam, 134 P., UniversitAt Potsdam}, 3392 petsc_uses = {KSP} 3393} 3394 3395@Article{ frickenhaus1, 3396 author = {S. Frickenhaus and W. Hiller and M. Best}, 3397 year = {2005}, 3398 title = {FoSSI : The Family of Simplified Solver Interfaces for the rapid development of 3399 parallel numerical atmosphere and ocean models}, 3400 journal = {Ocean Modelling}, 3401 volume = {10}, 3402 pages = {185--191}, 3403 petsc_uses = {KSP} 3404} 3405 3406@Article{ 0266-5611-24-3-034015, 3407 author = {I Epanomeritakis and V Ak\c{c}elik and O Ghattas and J Bielak}, 3408 title = {A Newton-CG method for large-scale three-dimensional elastic full-waveform 3409 seismic inversion}, 3410 journal = {Inverse Problems}, 3411 volume = {24}, 3412 number = {3}, 3413 pages = {034015 (26pp)}, 3414 url = {http://stacks.iop.org/0266-5611/24/034015}, 3415 year = {2008}, 3416 abstract = {We present a nonlinear optimization method for large-scale 3D elastic 3417 full-waveform seismic inversion. The method combines outer Gauss-Newton nonlinear 3418 iterations with inner conjugate gradient linear iterations, globalized by an 3419 Armijo backtracking line search, solved on a sequence of finer grids and higher 3420 frequencies to remain in the vicinity of the global optimum, inexactly terminated 3421 to prevent oversolving, preconditioned by L-BFGS/Frankel, regularized by a total 3422 variation operator to capture sharp interfaces, finely discretized by finite 3423 elements in the Lam\'{e} parameter space to provide flexibility and avoid bias, 3424 implemented in matrix-free fashion with adjoint-based computation of reduced 3425 gradient and reduced Hessian-vector products, checkpointed to avoid full spacetime 3426 waveform storage, and partitioned spatially across processors to parallelize the 3427 solutions of the forward and adjoint wave equations and the evaluation of 3428 gradient-like information. Several numerical examples demonstrate the grid 3429 independence of linear and nonlinear iterations, the effectiveness of the 3430 preconditioner, the ability to solve inverse problems with up to 17 million 3431 inversion parameters on up to 2048 processors, the effectiveness of multiscale 3432 continuation in keeping iterates in the basin of attraction of the global minimum, 3433 and the ability to fit the observational data while reconstructing the model with 3434 reasonable resolution and capturing sharp interfaces.}, 3435 petsc_uses = {KSP} 3436} 3437 3438% LiteralHTML: 3439% LiteralHTML: <a name="environmental"><H3><center>Environmental -- Subsurface Flow</center></H3> 3440% LiteralHTML: 3441% LiteralHTML: <td width="100%" colspan="2"><hr size="4" color="#FF5B5B"> </td> 3442% LiteralHTML:<font color="#FF0000"> 3443% LiteralHTML:Modeling surface flow of water is valuable for both flood control and 3444% LiteralHTML:agricultural and environmental reasons. For example, regenerating the 3445% LiteralHTML:Florida Everglades requires extensive understanding of the surface water 3446% LiteralHTML:characteristics over thousands of square miles. PETSc has been used 3447% LiteralHTML:for a variety of these simulations.</p> 3448% LiteralHTML:</font> 3449% LiteralHTML: 3450@Article{ mills2009modeling, 3451 title = {Modeling subsurface reactive flows using leadership-class computing}, 3452 author = {Mills, R.T. and Hammond, G.E. and Lichtner, P.C. and Sripathi, V. and 3453 Mahinthakumar, G.K. and Smith, B.F.}, 3454 journal = {Journal of Physics: Conference Series}, 3455 volume = {180}, 3456 pages = {012062}, 3457 year = {2009}, 3458 publisher = {IOP Publishing}, 3459 petsc_uses = {KSP} 3460} 3461 3462@Conference{ mills2007simulating, 3463 title = {{Simulating subsurface flow and transport on ultrascale computers using 3464 PFLOTRAN}}, 3465 author = {Mills, R.T. and Lu, C. and Lichtner, P.C. and Hammond, G.E.}, 3466 booktitle = {Journal of Physics: Conference Series}, 3467 volume = {78}, 3468 pages = {012051}, 3469 year = {2007}, 3470 organization = {IOP Publishing}, 3471 petsc_uses = {KSP} 3472} 3473 3474@InProceedings{ mills2009, 3475 title = {Modeling subsurface reactive flows using leadership-class computing}, 3476 author = {Mills, R.T. and Hammond, G.E. and Lichtner, P.C. and Sripathi, V. and 3477 Mahinthakmuar, G. and Smith, B.}, 3478 booktitle = {Journal of Physics: Conference Series}, 3479 volume = {180}, 3480 pages = {102062}, 3481 year = {2009}, 3482 organization = {IOP Publishing}, 3483 petsc_uses = {KSP} 3484} 3485 3486@Article{ guo2013parallel, 3487 title = {A parallel, fully coupled, fully implicit solution to reactive transport in 3488 porous media using the preconditioned {J}acobian-{F}ree {N}ewton-{K}rylov Method 3489 }, 3490 journal = {Advances in Water Resources }, 3491 volume = {53}, 3492 number = {0}, 3493 pages = {101 - 108}, 3494 year = {2013}, 3495 note = {}, 3496 issn = {0309-1708}, 3497 doi = {10.1016/j.advwatres.2012.10.010}, 3498 author = {Luanjing Guo and Hai Huang and Derek R. Gaston and Cody J. Permann and David 3499 Andrs and George D. Redden and Chuan Lu and Don T. Fox and Yoshiko Fujita}, 3500 keywords = {Reactive transport, Jacobian-Free Newton-Krylov, Physics-based block 3501 preconditioner}, 3502 petsc_uses = {KSP} 3503} 3504 3505@Unpublished{ stomp, 3506 title = {STOMP (Subsurface Transport Over Multiple Phases) webpage}, 3507 url = {http://stomp.pnl.gov/}, 3508 petsc_uses = {KSP} 3509} 3510 3511@InProceedings{ htfc2003, 3512 author = {L. Hluchy and V.D. Tran and D.Froehlich and W.Castaings}, 3513 title = {Methods and Experiences For Parallelizing Flood Models}, 3514 year = {2003}, 3515 booktitle = {Recent Advances in Parallel Virtual Machine and Message Passing Interface: 10th 3516 European PVM/MPI User's Group Meeting}, 3517 note = {Springer Lecture Notes in Computer Science, Volume 2840}, 3518 url = {http://www.springerlink.com/app/home/contribution.asp?wasp=2e9afcba8f614cd9a6f94a5294d1cbb0&referrer=parent&backto=issue,93,95;journal,588,1972;linkingpublicationresults,1:105633,1}, 3519 petsc_uses = {KSP} 3520} 3521 3522@InProceedings{ hulchy-tran-astalos-fmsip, 3523 author = {L. Hluchy and V.D. Tran and J. Astalos and M. Dobrucky and G. T. Nguyen and 3524 D.Froehlich}, 3525 title = {Flood Modeling System and Its Parallelization}, 3526 year = {2002}, 3527 booktitle = {Proceedings of the International Conference on Parallel Computing in Electrical 3528 Engineering}, 3529 url = {http://portal.acm.org/citation.cfm?id=824476.825951}, 3530 petsc_uses = {KSP} 3531} 3532 3533@InProceedings{ gy1, 3534 author = {J. P. Gwo and G. T. Yeh}, 3535 title = {High-Performance Simulation of Surface-Subsurface Coupled Flow and Reactive 3536 Transport at Watershed Scale}, 3537 year = {2004}, 3538 booktitle = {The International Conference on Computational Methods}, 3539 url = {http://www.sfwmd.gov/org/era/uncertainty_wkshp/GwoYeh.pdf}, 3540 petsc_uses = {KSP} 3541} 3542 3543@Conference{ cheng2009efficient, 3544 title = {{An efficient parallel method for large-scale groundwater flow equation based on 3545 PETSc}}, 3546 author = {Cheng, T. and Ji, X. and Wang, Q.}, 3547 booktitle = {Information, Computing and Telecommunication, 2009. YC-ICT'09. IEEE Youth 3548 Conference on}, 3549 pages = {190--193}, 3550 organization = {IEEE}, 3551 petsc_uses = {KSP} 3552} 3553 3554@Unpublished{ sfrsm, 3555 title = {The South Florida Regional Simulation Model and Hydrologic Simulation Engine}, 3556 url = {http://www.sfwmd.gov/org/pld/hsm/cerp_pres/hse_num.pdf}, 3557 note = {Simulates overland, groundwater and canal flows for south Florida. Uses PETSc for 3558 its linear solves}, 3559 petsc_uses = {KSP} 3560} 3561 3562% LiteralHTML: <td width="100%" colspan="2"><hr size="4" color="#FF5B5B"> </td> 3563@InProceedings{ bart_omar:sc05, 3564 author = {Volkan Ak{\c c}elik and George Biros and Andrei Dr{\u{a}}g{\u{a}}nescu and Omar 3565 Ghattas and Judith~C. Hill and Gart~G. van Bloemen Waanders}, 3566 title = {Dynamic data driven inversion for terascale simulations: real-time 3567 indentification of airborne contaminants}, 3568 booktitle = {Proceedings of SC2005}, 3569 organization = {IEEE/ACM}, 3570 address = {Seattle, WA}, 3571 year = {2005}, 3572 month = nov, 3573 url = {http://www.cs.cmu.edu/\~{ }oghattas/papers/sc05-inverse.pdf}, 3574 lab = {SNL}, 3575 petsc_uses = {KSP} 3576} 3577 3578@InProceedings{ anton-krassimir-lscc, 3579 author = {Anton Antonov and Krassimir Georgiev and Emilia Komsalova and Zahari Zlatev}, 3580 title = {Comparison of Two Local Refinement Methods for Large Scale Air Pollution 3581 Simulations}, 3582 booktitle = {Large-Scale Scientific Computing: 4th International Conference, LSSC 2003}, 3583 volume = {2907}, 3584 year = {2003}, 3585 publisher = {Springer-Verlag}, 3586 url = {http://www.springerlink.com/app/home/contribution.asp?wasp=65dfaebc36f6453d9120b8f9f86fecc5&referrer=parent&backto=issue,32,55;journal,618,2072;linkingpublicationresults,1:105633,1}, 3587 petsc_uses = {KSP} 3588} 3589 3590@InProceedings{ aa2001, 3591 author = {Anton Antonov}, 3592 title = {Object-Oriented Framework for Large Scale Air Pollution Modeling}, 3593 year = {2001}, 3594 booktitle = {Large-Scale Scientific Computing : Third International Conference, LSSC 2001, 3595 Sozopol, Bulgaria}, 3596 note = {Springer Lecture Notes in Computer Science, Volume 2179}, 3597 url = {http://www.springerlink.com/app/home/contribution.asp?wasp=3699c48fdb764bc7a3aa0539c7bf9f1d&referrer=parent&backto=issue,25,52;journal,1243,1972;linkingpublicationresults,1:105633,1}, 3598 petsc_uses = {KSP} 3599} 3600 3601% LiteralHTML: <td width="100%" colspan="2"><hr size="4" color="#FF5B5B"> </td> 3602@Article{ grassley-simmons-kercher-00, 3603 author = {William E. Glassley and Ardyth M. Simmons and James R. Kercher}, 3604 year = {2000}, 3605 title = {Mineralogical heterogeneity in fractured, porous media and its representation in 3606 reactive transport models}, 3607 journal = {Applied Geochemistry}, 3608 volume = {17}, 3609 pages = {699--708}, 3610 lab = {LLNL} 3611} 3612 3613@Article{ glassey-nitao-03, 3614 author = {William E. Glassley and John J. Nitao and Charles W. Grant and James W. Johnson 3615 and Carl I. Steefel and James R. Kercher}, 3616 year = {2003}, 3617 title = {The impact of climate change on vadose zone pore waters and its implication for 3618 long-term monitoring}, 3619 journal = {Computers and Geosciences}, 3620 volume = {29}, 3621 pages = {399-411}, 3622 lab = {LLNL}, 3623 petsc_uses = {KSP} 3624} 3625 3626@Article{ steefel-depaolo-lichtner-05, 3627 author = {Carl I. Steefel and Donald J. DePaolo and Peter C. Lichtner}, 3628 year = {2005}, 3629 title = {Reactive transport modeling: An essential tool and a new research approach for 3630 the Earth sciences}, 3631 journal = {Earth and Planetary Science Letters}, 3632 lab = {LLNL,LANL}, 3633 petsc_uses = {KSP} 3634} 3635 3636% LiteralHTML:<a name="scalinglarge"> 3637% LiteralHTML: <td width="100%" colspan="2"><hr size="4" color="#FF5B5B"> </td> 3638% LiteralHTML: <center><img alt="" 3639% LiteralHTML: src="images/scalinglarge.jpg"></center></p> 3640% LiteralHTML:<font color="#FF0000"> 3641% LiteralHTML: Sample <strong>strong scaling</strong> for the LANL PFLOTRAN flow and geochemical transport suite. (Courtesy of Richard Mills, ORNL) 3642@InProceedings{ kongstognergastonpetersonpermannslaughtermartineau2018, 3643 title = {A General-Purpose Hierarchical Mesh Partitioning Method with Node Balancing 3644 Strategies for Large-Scale Numerical Simulations}, 3645 author = {Fande Kong and Roy H. Stogner and Derek R. Gaston and John W. Peterson and Cody 3646 J. Permann and Andrew E. Slaughter and Richard C. Martineau}, 3647 booktitle = {2018 IEEE/ACM 9th Workshop on Latest Advances in Scalable Algorithms for 3648 Large-Scale Systems (scalA)}, 3649 pages = {65-72}, 3650 doi = {10.1109/ScalA.2018.00012}, 3651 month = nov, 3652 year = {2018}, 3653 petsc_uses = {KSP} 3654} 3655 3656@Article{ km2004, 3657 author = {A. Keese and H. G. Matthies}, 3658 journal = {Computers and Structures}, 3659 year = {2005}, 3660 volume = {83}, 3661 pages = {1033--1047}, 3662 title = {Hierarchical parallelisation for the solution of stochastic finite element 3663 equations}, 3664 url = {http://www.sciencedirect.com/science?_ob=ArticleURL&_udi=B6V28-4FPDPWM-1&_user=1722207&_rdoc=1&_fmt=&_orig=search&_sort=d&_docanchor=&view=c&_acct=C000053990&_version=1&_urlVersion=0&_userid=1722207&md5=89d48cd6fd5e80989372246d8dda400f}, 3665 petsc_uses = {KSP} 3666} 3667 3668@Unpublished{ hvl2002, 3669 title = {Numerical Modeling of NAPL Source Zone Treatment}, 3670 author = {Hammond, G.E., A.J. Valocchi and P.C. Lichtner}, 3671 note = {Poster at American Geophysical Union Fall 2002 Meeting, San Francisco, CA.}, 3672 url = {http://cee.uiuc.edu/transport/hammond/agu_2002.pdf}, 3673 year = {2002}, 3674 lab = {LANL}, 3675 petsc_uses = {KSP} 3676} 3677 3678@PhDThesis{ hammond2003, 3679 author = {Glenn E. Hammond}, 3680 title = {Innovative Methods for Solving Multicomponent Biogeochemical Groundwater 3681 Transport on Supercomputers}, 3682 school = {University of Illinois at Urbana-Champaign}, 3683 year = {2003}, 3684 url = {http://cee.uiuc.edu/transport/hammond/dissertation.pdf}, 3685 petsc_uses = {KSP} 3686} 3687 3688@Unpublished{ uk, 3689 title = {Parallel Least-Squares Finite Element Method for Large Eddy Simulation of Large 3690 Scale Environmental Flows and Transport Processes}, 3691 url = {http://es.epa.gov/ncer/progress/grants/96/high/tsang99.html}, 3692 note = {EPA funded work to simulate turbulent dispersion of toxic chemicals around 3693 buildings and in Green Bay. Used PETSc for its linear solvers}, 3694 year = {1999}, 3695 petsc_uses = {KSP} 3696} 3697 3698@InProceedings{ hammond2002, 3699 author = {Glenn E. Hammond and Albert J. Valocchi and Peter C. Lichtner}, 3700 title = {Modeling Multicomponent Reactive Transport on Parallel Computers Using 3701 {J}acobian-Free {N}ewton {K}rylov with Operator-Split Preconditioners}, 3702 year = {2002}, 3703 url = {http://www.cee.uiuc.edu/transport/publications/hammond/CMWR_2002.pdf}, 3704 booktitle = {Proceedings of the XIV International Conference on Computational Methods in Water 3705 Resources, Delft, The Netherlands.}, 3706 lab = {LANL}, 3707 petsc_uses = {KSP} 3708} 3709 3710@TechReport{ steefel1, 3711 author = {C. I. Steefel}, 3712 title = {Software for modeling multicomponent, multidimensional reactive transport}, 3713 year = {2001}, 3714 institution = {Lawrence Livermore National Laboratory}, 3715 number = {UCRL-MA-143182}, 3716 lab = {LLNL}, 3717 petsc_uses = {KSP} 3718} 3719 3720@Article{ steefel2, 3721 author = {C. I. Steefel and A. C. Lasaga}, 3722 title = {A coupled model for transport of multiple chemical-species and kinetic 3723 precipitation dissolution reactions with application to reactive flow in 3724 single-phase hydrothermal systems}, 3725 journal = {Americal Journal of Science}, 3726 year = {1994}, 3727 pages = {529-592}, 3728 volume = {294}, 3729 number = {5}, 3730 petsc_uses = {KSP} 3731} 3732 3733@TechReport{ steefel3, 3734 author = {C. I. Steefel and S. B. Yabusaki}, 3735 title = {OS3D/GIMRT, Software for Multicomponent-Multidimensional reactive transport: 3736 User's manual and programmer's guide}, 3737 year = {1996}, 3738 institution = {Pacific Northwest National Laboratory}, 3739 number = {PNNL-11166}, 3740 lab = {PNNL}, 3741 petsc_uses = {KSP} 3742} 3743 3744@Article{ 2005hvl, 3745 author = {G. E. Hammond and A.J. Valocchi and P.C. Lichtner}, 3746 title = {Application of {J}acobian-free {N}ewton-{K}rylov with physics-based 3747 preconditioning to biogeochemical transport}, 3748 journal = {Advances in Water Resources}, 3749 year = {2005}, 3750 pages = {359--376}, 3751 volume = {28}, 3752 url = { 3753 http://www.sciencedirect.com/science?_ob=IssueURL&_tockey=%23TOC%235953%232005%23999719995%23576651%23FLA%23Volume_28,_Issue_4,_Pages_315-427_(April_2005)&_auth=y&view=c&_acct=C000059129&_version=1&_urlVersion=0&_userid=2914253&md5=0d485527443c6192356cc508e1621002}, 3754 lab = {LANL}, 3755 petsc_uses = {KSP} 3756} 3757 3758@Article{ wang-zabar-05, 3759 author = {J Wang and N Zabaras}, 3760 journal = {Int. J. Heat and Mass Transfer}, 3761 title = {A Markov random field model of contamination source identification in porous 3762 media flow}, 3763 year = {2005}, 3764 petsc_uses = {KSP} 3765} 3766 3767@InBook{ kp1, 3768 author = {Jong G. Kim and Hyoung W. Park}, 3769 chapter = {Advanced Simulation Technique for Modeling Multiphase Fluid Flow in Porous 3770 Media}, 3771 url = {http://www.springerlink.com/app/home/contribution.asp?wasp=m5uc84pqrh1qrg8clyuh&referrer=parent&backto=issue,1,117;journal,206,1787;linkingpublicationresults,1:105633,1}, 3772 title = {Lecture Notes in Computer Science}, 3773 publisher = {Springer-Verlag}, 3774 volume = {3044}, 3775 year = {2004}, 3776 petsc_uses = {KSP} 3777} 3778 3779@Article{ 2001agusm...h32a06k, 3780 author = {{Kim}, J.~G. and {Kim}, J.}, 3781 title = {Parallel Implementation of Finite Element Groundwater Flow Model}, 3782 journal = {AGU Spring Meeting Abstracts}, 3783 year = {2001}, 3784 pages = {32-+}, 3785 petsc_uses = {KSP} 3786} 3787 3788@Article{ lzb2005, 3789 author = {A. M. Wasantha Lal and Randy Van Zee and Mark Belnap}, 3790 title = {CASE STUDY: A MODEL TO SIMULATE REGIONAL FLOW IN SOUTH FLORIDA}, 3791 journal = {Journal of Hydraulic Engineering}, 3792 year = {2005}, 3793 volume = {131}, 3794 number = {4}, 3795 pages = {247--258}, 3796 petsc_uses = {KSP} 3797} 3798 3799@Article{ rao2005, 3800 author = {Prasada Rao}, 3801 title = {A parallel RMA2 model for simulating large-scale free surface flows}, 3802 journal = {Environmental Modelling and Software}, 3803 year = {2005}, 3804 pages = {47--53}, 3805 petsc_uses = {KSP} 3806} 3807 3808@InProceedings{ pr1, 3809 author = {Prasada Rao}, 3810 title = {An Efficient Scalable Finite Element Model for Simulating Large Scale 3811 Hydrodynamic Flows}, 3812 year = {2003}, 3813 booktitle = {Proceedings of the American Society of Civil Engineers 16th Engineering Mechanics 3814 Conference}, 3815 url = {http://www.ce.washington.edu/em03/proceedings/papers/477.pdf}, 3816 petsc_uses = {KSP} 3817} 3818 3819@InProceedings{ lichtner2004, 3820 author = {Peter C. Lichtner and Andrew Wolfsberg}, 3821 title = {Modeling Thermal-Hydrological-Chemical ({THC}) Coupled Processes with 3822 Applications to Underground Nuclear Tests at the Nevada Test Site; A Grand 3823 Challenge Supercomputing Problem}, 3824 year = {2004}, 3825 booktitle = {MPU Workshop: Conceptual Model Development for Subsurface Reactive Transport 3826 Modeling of Inorganic Contaminants, Radionuclides and Nutrients}, 3827 note = {Also Los Alamos National Laboratory report: LA-UR-04-1826}, 3828 lab = {LANL}, 3829 petsc_uses = {KSP} 3830} 3831 3832% LiteralHTML: <td width="100%" colspan="2"><hr size="4" color="#FF5B5B"> </td> 3833@Article{ aba01:petsc-app, 3834 author = {Jason Abate and Peng Wang and Kamy Sepehrnoori}, 3835 title = {Parallel Compositional Reservior Simulation on Clusters of {PC}s}, 3836 journal = {Int. J. High Performance Computing Applications}, 3837 year = {2001}, 3838 volume = {15}, 3839 number = {1}, 3840 pages = {13--21}, 3841 petsc_uses = {KSP} 3842} 3843 3844@PhDThesis{ tjb200, 3845 author = {Thomas James Byer}, 3846 title = {Preconditioned Newton Methods for Simulation of Reservoirs with Surface 3847 Facilities}, 3848 school = {Stanford}, 3849 year = {2000}, 3850 petsc_uses = {KSP} 3851} 3852 3853@InProceedings{ puchyr2006, 3854 author = {Peter J. Puchyr}, 3855 title = {Experience with Parallel Computing for Reservoir and Geomechanics Simulation on a 3856 Win32 Cluster}, 3857 booktitle = {Proceedings of the Canadian International Petroleum Conference}, 3858 note = {Paper number CIPC2006-207}, 3859 year = {2006}, 3860 petsc_uses = {KSP} 3861} 3862 3863@InProceedings{ texas98, 3864 author = {P. Wang and S. Balay and K. Seperhrnoori and J. Wheeler and J. Abate and B. Smith 3865 and G. A. Pope}, 3866 title = {A Fully Implicit Parallel {EOS} Compositional Simulator for Large Scale Reservoir 3867 Simulation}, 3868 booktitle = {Proceedings of the 1999 Society of Petroleum Engineers 15th Reservoir Simulation 3869 Symposium}, 3870 note = {also available as Argonne preprint ANL/MCS-P743-1298}, 3871 url = {ftp://info.mcs.anl.gov/pub/tech_reports/reports/P743.pdf}, 3872 year = {1998}, 3873 petsc_uses = {KSP} 3874} 3875 3876% LiteralHTML: 3877% LiteralHTML: <a name="cfd"><H3><center>CFD</center></H3> 3878% LiteralHTML: 3879@Article{ farrellmitchellscottwechsung2021, 3880 title = {A {Reynolds-robust} preconditioner for the {Scott-Vogelius} discretization of the 3881 stationary incompressible {Navier-Stokes} equations}, 3882 author = {Patrick E Farrell and Lawrence Mitchell and L Ridgway Scott and Florian 3883 Wechsung}, 3884 journal = {The SMAI journal of computational mathematics}, 3885 volume = {7}, 3886 pages = {75--96}, 3887 year = {2021}, 3888 petsc_uses = {KSP} 3889} 3890 3891@Article{ adlerbensoncyrfarrellmaclachlantuminaro2021, 3892 title = {Monolithic Multigrid Methods for Magnetohydrodynamics}, 3893 author = {James H Adler and Thomas R Benson and Eric C Cyr and Patrick E Farrell and Scott 3894 P MacLachlan and Ray S Tuminaro}, 3895 journal = {SIAM Journal on Scientific Computing}, 3896 number = {0}, 3897 pages = {S70--S91}, 3898 year = {2021}, 3899 petsc_uses = {KSP} 3900} 3901 3902@Article{ farrellgaticalamichhaneoyarzuaruizbaier2021, 3903 title = {Mixed Kirchhoff stress–displacement–pressure formulations for incompressible 3904 hyperelasticity}, 3905 author = {Patrick E. Farrell and Luis F. Gatica and Bishnu P. Lamichhane and Ricardo 3906 Oyar\'ua and Ricardo Ruiz-Baier}, 3907 journal = {Computer Methods in Applied Mechanics and Engineering}, 3908 volume = {374}, 3909 pages = {113562}, 3910 issn = {0045-7825}, 3911 doi = {https://doi.org/10.1016/j.cma.2020.113562}, 3912 url = {https://www.sciencedirect.com/science/article/pii/S0045782520307477}, 3913 year = {2021}, 3914 petsc_uses = {KSP} 3915} 3916 3917@Article{ farrellmitchellwechsung2018, 3918 title = {An augmented {Lagrangian} preconditioner for the {3D} stationary incompressible 3919 {Navier-Stokes} equations at high {Reynolds} number}, 3920 author = {Patrick E Farrell and Lawrence Mitchell and Florian Wechsung}, 3921 journal = {SIAM Journal on Scientific Computing}, 3922 volume = {41}, 3923 number = {5}, 3924 eprint = {1810.03315}, 3925 pages = {A3073-A3096}, 3926 year = {2019}, 3927 petsc_uses = {KSP} 3928} 3929 3930@Article{ hevuikklaij2017, 3931 title = {Block-preconditioners for the incompressible {Navier}--{Stokes} equations 3932 discretized by a finite volume method}, 3933 author = {Xin He and Cornelis Vuik and Christiaan Klaij}, 3934 journal = {Journal of Numerical Mathematics}, 3935 volume = {25}, 3936 number = {2}, 3937 pages = {89--105}, 3938 year = {2017}, 3939 petsc_uses = {KSP} 3940} 3941 3942@InProceedings{ zou2015newton, 3943 title = {Newton--Krylov methods in applications of two-phase flow problems with phase 3944 appearance/disappearance}, 3945 author = {Zou, L and Zhao, H and Zhang, H}, 3946 booktitle = {ANS 2015 Annual Meeting, June}, 3947 volume = {7}, 3948 number = {11}, 3949 year = {2015}, 3950 petsc_uses = {KSP} 3951} 3952 3953@Article{ guermond2009nonlinear, 3954 title = {Nonlinear magnetohydrodynamics in axisymmetric heterogeneous domains using a 3955 Fourier/finite element technique and an interior penalty method}, 3956 author = {Guermond, J-L and Laguerre, Raphael and L{\'e}orat, Jacques and Nore, Caroline}, 3957 journal = {Journal of computational physics}, 3958 volume = {228}, 3959 number = {8}, 3960 pages = {2739--2757}, 3961 year = {2009}, 3962 publisher = {Elsevier}, 3963 petsc_uses = {KSP} 3964} 3965 3966@Article{ erzincanlisahin2015, 3967 title = {The numerical simulation of the wing kinematics effects on near wake topology and 3968 aerodynamic performance in hovering Drosophila flight}, 3969 author = {Belkis Erzincanli and Mehmet Sahin}, 3970 journal = {Computers \& Fluids}, 3971 volume = {122}, 3972 pages = {90--110}, 3973 year = {2015}, 3974 publisher = {Elsevier}, 3975 petsc_uses = {KSP} 3976} 3977 3978@Article{ ekensahin2015, 3979 title = {A parallel monolithic algorithm for the numerical simulation of large-scale fluid 3980 structure interaction problems}, 3981 author = {Ali Eken and Mehmet Sahin}, 3982 journal = {International Journal for Numerical Methods in Fluids}, 3983 year = {2015}, 3984 publisher = {Wiley Online Library}, 3985 petsc_uses = {KSP} 3986} 3987 3988@Article{ hwangsucai2015, 3989 title = {A parallel adaptive nonlinear elimination preconditioned inexact {Newton} method 3990 for transonic full potential equation}, 3991 author = {Feng-Nan Hwang and Yi-Cheng Su and Xiao-Chuan Cai}, 3992 journal = {Computers \& Fluids}, 3993 volume = {110}, 3994 number = {30}, 3995 pages = {96--107}, 3996 year = {2015}, 3997 doi = {10.1016/j.compfluid.2014.04.005}, 3998 petsc_uses = {KSP} 3999} 4000 4001@Article{ yanghwangcai2016, 4002 title = {Nonlinear Preconditioning Techniques for Full-Space Lagrange--Newton Solution of 4003 PDE-Constrained Optimization Problems}, 4004 author = {Haijian Yang and Feng-Nan Hwang and Xiao-Chuan Cai}, 4005 journal = {SIAM Journal on Scientific Computing}, 4006 volume = {38}, 4007 number = {5}, 4008 pages = {A2756--A2778}, 4009 year = {2016}, 4010 petsc_uses = {KSP} 4011} 4012 4013@Article{ khanaidun2011, 4014 author = {Irfan Khan and Cyrus K. Aidun}, 4015 title = {Direct numerical simulation of saturated deformable porous media using parallel 4016 hybrid Lattice-Boltzmann and finite element method}, 4017 journal = {Int. J. Numer. Meth. Eng.}, 4018 volume = {86}, 4019 pages = {1379--1395}, 4020 year = {2011}, 4021 petsc_uses = {KSP} 4022} 4023 4024@Article{ khanaidun2014, 4025 author = {Irfan Khan and Cyrus K. Aidun}, 4026 title = {Modeling the deformation of saturate porous media using direct numerical 4027 simulation}, 4028 journal = {Int. J. Multiphase Flow}, 4029 doi = {10.1016/j.ijmultiphaseflow.2014.12.003}, 4030 year = {2014}, 4031 petsc_uses = {KSP} 4032} 4033 4034@Article{ mofidi2014simulations, 4035 author = {A. Mofidi and P. M. Carrica}, 4036 title = {Simulations of Zigzag Maneuvers for a Container Ship with Direct Moving Rudder 4037 and Propeller}, 4038 journal = {Computers and Fluids}, 4039 pages = {191--203}, 4040 year = {2014}, 4041 petsc_uses = {KSP} 4042} 4043 4044@Article{ paik2014fluidstructure, 4045 author = {K. Paik and P. M. Carrica}, 4046 title = {Fluid-Structure Interaction for an Elastic Structure Interacting with Free 4047 Surface in a Rolling Tank}, 4048 journal = {Ocean Engineering}, 4049 pages = {201--212}, 4050 year = {2014}, 4051 petsc_uses = {KSP} 4052} 4053 4054@Article{ castro2013bubble, 4055 author = {A. M. Castro and P. M. Carrica}, 4056 title = {Bubble size distribution prediction for large-scale ship flows: {Model} 4057 evaluation and numerical issues}, 4058 journal = {International Journal of Multiphase Flow 57}, 4059 pages = {131--150}, 4060 year = {2013}, 4061 petsc_uses = {KSP} 4062} 4063 4064@Article{ carrica2013turn, 4065 author = {P. M. Carrica and F. Ismail and M. Hyman and S. Bhushan and F. Stern}, 4066 title = {Turn and Zigzag Maneuvers of a Surface Combatant Using a {URANS} Approach with 4067 Dynamic Overset Grids}, 4068 journal = {Journal of Marine Science and Technology}, 4069 pages = {166--181}, 4070 year = {2013}, 4071 petsc_uses = {KSP} 4072} 4073 4074@Article{ castro2013eulerian, 4075 author = {A. M. Castro and P. M. Carrica}, 4076 title = {Eulerian polydispersed modeling of bubbly flows around ships with application to 4077 {Athena} {R}/V,}, 4078 journal = {International Shipbuilding Progress}, 4079 pages = {403--433}, 4080 year = {2013}, 4081 petsc_uses = {KSP} 4082} 4083 4084@Article{ chase2013overset, 4085 author = {N. Chase and T. Michael and P. M. Carrica}, 4086 title = {Overset simulations of a {Submarine} in {Towed}, {Self}-{Propelled} and 4087 {Maneuvering} {Conditions}}, 4088 journal = {International Shipbuilding Progress}, 4089 pages = {171--205}, 4090 year = {2013}, 4091 petsc_uses = {KSP} 4092} 4093 4094@Article{ sadathosseini2013wu, 4095 author = {H. Sadat-Hosseini and P. -C. Wu and P. M. Carrica and H. Kim and Y. Toda and F. 4096 Stern}, 4097 title = {{CFD} Simulation and Validation of Added Resistance of {KVLCC}2 with Fixed and 4098 Free Surge Conditions in Short and Long Head Waves}, 4099 journal = {Ocean Engineering}, 4100 volume = {59}, 4101 pages = {240--273}, 4102 year = {2013}, 4103 petsc_uses = {KSP} 4104} 4105 4106@Article{ chase2013cfd, 4107 author = {N. Chase and P. M. Carrica}, 4108 title = {CFD Simulations of a Submarine Propeller and Application to Self-Propulsion of a 4109 Submarine}, 4110 journal = {Ocean Engineering}, 4111 pages = {68--80}, 4112 year = {2013}, 4113 petsc_uses = {KSP} 4114} 4115 4116@Article{ carrica2012cfd, 4117 author = {P. M. Carrica and H. Sadat-Hosseini and F. Stern}, 4118 title = {CFD Analysis of Broaching for a Model Surface Combatant with Explicit Simulation 4119 of Moving Rudders and Rotating Propellers}, 4120 journal = {Computers and Fluids 53}, 4121 pages = {117--132}, 4122 year = {2012}, 4123 petsc_uses = {KSP} 4124} 4125 4126@Article{ sakamoto2012urans, 4127 author = {N. Sakamoto and P. M. Carrica and F. Stern}, 4128 title = {URANS Simulations of Static and Dynamic Maneuvering for Surface Combatant-Part 1: 4129 Verification and Validation for Forces, Moment, and Hydrodynamic Derivatives}, 4130 publisher = {Journal of Marine Science and Technology}, 4131 pages = {422--445}, 4132 year = {2012}, 4133 petsc_uses = {KSP} 4134} 4135 4136@Article{ sakamoto2012uransb, 4137 author = {N. Sakamoto and P. M. Carrica and F. Stern}, 4138 title = {URANS Simulations of Static and Dynamic Maneuvering for Surface Combatant-Part 2: 4139 Analysis and Validation of Local Flow Characteristics}, 4140 journal = {Journal of Marine Science and Technology}, 4141 pages = {446--468}, 4142 year = {2012}, 4143 petsc_uses = {KSP} 4144} 4145 4146@Article{ li2012dynamic, 4147 author = {Y. Li and T. Xing and K. Paik and P. M. Carrica}, 4148 title = {Dynamic Overset {CFD} Simulations of Wind Turbine Aerodynamics}, 4149 journal = {Renewable Energy}, 4150 pages = {285--298}, 4151 year = {2012}, 4152 petsc_uses = {KSP} 4153} 4154 4155@Article{ huang2012a, 4156 author = {J. Huang and P. M. Carrica and F. Stern}, 4157 title = {A Method to Compute Ship Exhaust Plumes with Waves and Wind}, 4158 journal = {International Journal for Numerical Methods in Fluids}, 4159 pages = {160--180}, 4160 year = {2012}, 4161 petsc_uses = {KSP} 4162} 4163 4164@Article{ huang2012b, 4165 author = {J. Huang and P. M. Carrica and F. Stern}, 4166 title = {A geometry-based level set method for curvilinear overset grids with application 4167 to ship hydrodynamics}, 4168 journal = {International Journal for Numerical Methods in Fluids}, 4169 pages = {494--521}, 4170 year = {2012}, 4171 petsc_uses = {KSP} 4172} 4173 4174@Article{ carrica2011computations, 4175 author = {P. M. Carrica and H. Fu and F. Stern}, 4176 title = {Computations of self-propulsion free to sink and trim and of motions in head 4177 waves of the {KRISO} {Container} {Ship} ({KCS}) model}, 4178 journal = {Applied Ocean Research}, 4179 pages = {309--320}, 4180 year = {2011}, 4181 petsc_uses = {KSP} 4182} 4183 4184@Article{ bhushan2011scalability, 4185 author = {S. Bhushan and P. M. Carrica and J. Yang and F. Stern}, 4186 title = {Scalability and Validation Study for Large Scale Surface Combatant Computations 4187 Using {CFDShip}-Iowa}, 4188 journal = {International Journal of High Performance Computing Applications}, 4189 pages = {466--487}, 4190 year = {2011}, 4191 petsc_uses = {KSP} 4192} 4193 4194@Article{ castro2011full, 4195 author = {A. M. Castro and P. M. Carrica and F. Stern}, 4196 title = {Full scale self-propulsion computations using discretized propeller for the 4197 {KRISO} container ship {KCS}}, 4198 journal = {Computers and Fluids}, 4199 pages = {35--47}, 4200 year = {2011}, 4201 petsc_uses = {KSP} 4202} 4203 4204@Article{ kandasamy2011multifidelity, 4205 author = {M. Kandasamy and S. K. Ooi and P. M. Carrica and F. Stern and E. F. Campana and 4206 D. Peri and P. Osborne and J. Cote and N. Macdonald and N. de Waal}, 4207 title = {Multi-fidelity Optimization of a High-speed Foil-assisted Semi-planing Catamaran 4208 for Low Wake}, 4209 journal = {Journal of Marine Science and Technology}, 4210 pages = {143--156}, 4211 year = {2011}, 4212 petsc_uses = {KSP} 4213} 4214 4215@Article{ kandasamy2011cfd, 4216 author = {M. Kandasamy and S. K. Ooi and P. M. Carrica and F. Stern and E. F. Campana and 4217 D. Peri and P. Osborne and J. Cote and N. Macdonald and N. de Waal}, 4218 title = {CFD Validation Studies for a High-speed Foil-assisted Semi-planing Catamaran}, 4219 journal = {Journal of Marine Science and Technology}, 4220 pages = {157--167}, 4221 year = {2011}, 4222 petsc_uses = {KSP} 4223} 4224 4225@Article{ sadathosseini2011cfd, 4226 author = {H. Sadat-Hosseini and P. M. Carrica and F. Stern and N. Umeda and H. Hashimoto 4227 and S. Yamamura and A. Mastuda}, 4228 title = {CFD System-Based and {EFD} Study of Ship Dynamic Instability Events: Surf Riding, 4229 Periodic Motion and Broaching}, 4230 journal = {Ocean Engineering}, 4231 pages = {88--110}, 4232 year = {2011}, 4233 petsc_uses = {KSP} 4234} 4235 4236@Article{ mosaviraad2010development, 4237 author = {M. Mosaviraad and P. M. Carrica and F. Stern}, 4238 title = {Development and Validation of Harmonic Wave Group Single-Run Procedure for {RAO} 4239 with Comparison to Regular Wave and Transient Wave Group Procedures Using 4240 {URANS}}, 4241 journal = {Ocean Engineering}, 4242 pages = {653--666}, 4243 year = {2010}, 4244 petsc_uses = {KSP} 4245} 4246 4247@Article{ carrica2010largescale, 4248 author = {P. M. Carrica and J. Huang and R. Noack and D. Kaushik and B. Smith and F. 4249 Stern}, 4250 title = {Large-Scale {DES} Computations of the Forward Speed Diffraction and Pitch and 4251 Heave Problems for a Surface Combatant}, 4252 journal = {Computers and Fluids}, 4253 pages = {1095--1111}, 4254 year = {2010}, 4255 petsc_uses = {KSP} 4256} 4257 4258@Article{ carrica2010selfpropulsion, 4259 author = {P. M. Carrica and A. M. Castro and F. Stern}, 4260 title = {Self-Propulsion Computations Using Speed Controller and Discretized Propeller 4261 with Dynamic Overset Grids}, 4262 journal = {Journal of Marine Science and Technology}, 4263 pages = {316--330}, 4264 year = {2010}, 4265 petsc_uses = {KSP} 4266} 4267 4268@Article{ ismail2010evaluation, 4269 author = {F. Ismail and P. M. Carrica and T. Xing and F. Stern}, 4270 title = {Evaluation of Linear and Non-Linear Convection Schemes on Multidimensional 4271 Non-Orthogonal Grids with Applications to {KVLCC}2 Tanker}, 4272 journal = {International Journal of Numerical Methods in Fluids}, 4273 pages = {850--886}, 4274 year = {2010}, 4275 petsc_uses = {KSP} 4276} 4277 4278@Article{ kandasamy2010integral, 4279 author = {M. Kandasamy and S. K. Ooi and P. M. Carrica and F. Stern}, 4280 title = {Integral Force/Moment Waterjet Model for {CFD} Simulations}, 4281 journal = {Journal of Fluids Engineering}, 4282 pages = {101103}, 4283 year = {2010}, 4284 petsc_uses = {KSP} 4285} 4286 4287@Article{ kirk:2014de, 4288 author = {Kirk, Benjamin S and Stogner, Roy H and Bauman, Paul T and Oliver, Todd A}, 4289 title = {{Modeling hypersonic entry with the fully-implicit Navier--Stokes (FIN-S) 4290 stabilized finite element flow solver}}, 4291 journal = {Computers {\&} Fluids}, 4292 year = {2014}, 4293 volume = {92}, 4294 number = {0}, 4295 pages = {281--292}, 4296 month = mar, 4297 petsc_uses = {KSP} 4298} 4299 4300@Article{ carracciuolo20111382, 4301 title = {Computational simulations of {3D} large-scale time-dependent viscoelastic flows 4302 in high performance computing environment}, 4303 journal = {Journal of Non-Newtonian Fluid Mechanics }, 4304 volume = {166}, 4305 number = {23--24}, 4306 pages = {1382--1395}, 4307 year = {2011}, 4308 issn = {0377-0257}, 4309 doi = {10.1016/j.jnnfm.2011.08.014}, 4310 author = {L. Carracciuolo and D. Casaburi and L. D’Amore and G. D’Avino and P.L. 4311 Maffettone and A. Murli}, 4312 keywords = {Parallel computations, Viscoelastic flows, DEVSS-G, \{PETSc\}, Finite element 4313 method, High performance computing}, 4314 petsc_uses = {KSP} 4315} 4316 4317@Article{ bungartzgatzhammerliebmehlneckel11, 4318 author = {Bungartz, Hans-Joachim and Gatzhammer, Bernhard and Lieb, Michael and Mehl, 4319 Miriam and Neckel, Tobias}, 4320 title = {Towards multi-phase flow simulations in the PDE framework Peano}, 4321 journal = {Computational Mechanics}, 4322 volume = {48}, 4323 number = {3}, 4324 pages = {365-376}, 4325 year = {2011}, 4326 issn = {0178-7675}, 4327 doi = {10.1007/s00466-011-0626-1}, 4328 publisher = {Springer-Verlag}, 4329 keywords = {PDE framework; Octree-like Cartesian grids; Computational fluid dynamics; 4330 Thermohydraulics; Two-phase flow}, 4331 language = {English}, 4332 petsc_uses = {KSP} 4333} 4334 4335@Article{ bpr:cfl, 4336 author = {H.~M. B{\"u}cker and B. Pollul and A. Rasch}, 4337 title = {{On {CFL} Evolution Strategies for Implicit Upwind Methods in Linearized {E}uler 4338 Equations}}, 4339 journal = {International Journal for Numerical Methods in Fluids}, 4340 year = {2009}, 4341 volume = {59}, 4342 number = {1}, 4343 pages = {1--18}, 4344 doi = {10.1002/fld.1798}, 4345 petsc_uses = {KSP} 4346} 4347 4348@InBook{ bonfiglioli_campobasso_carpentieri_2010, 4349 author = {Bonfiglioli, A and Campobasso, M S and Carpentieri, B}, 4350 title = {Parallel unstructured three-dimensional turbulent flow analyses using efficiently 4351 preconditioned newton-krylov solver}, 4352 publisher = {Curran Associates}, 4353 year = {2010}, 4354 url = {http://www.proceedings.com/05932.html}, 4355 petsc_uses = {KSP} 4356} 4357 4358@Article{ bonfiglioli_rans_2005, 4359 author = {Paciorri, Renato and Bonfiglioli, Aldo and Di Mascio, Andrea and Favini, 4360 Bernardo}, 4361 title = {RANS simulations of a junction flow}, 4362 journal = {International Journal of Computational Fluid Dynamics}, 4363 volume = {19}, 4364 number = {2}, 4365 pages = {179-189}, 4366 year = {2005}, 4367 doi = {10.1080/10618560410001729126}, 4368 petsc_uses = {KSP} 4369} 4370 4371@InCollection{ bonfiglioli__carpentieri_rans_2008, 4372 author = {Bonfiglioli, A. and Carpentieri, B. and Sosonkina, M.}, 4373 affiliation = {University of Basilicata Dip.to di Ingegneria e Fisica dell’Ambiente Potenza 4374 Italy}, 4375 title = {Performance Analysis of Parallel Algebraic Preconditioners for Solving the RANS 4376 Equations Using Fluctuation Splitting Schemes}, 4377 booktitle = {Numerical Mathematics and Advanced Applications}, 4378 editor = {Kunisch, Karl and Of, Günther and Steinbach, Olaf}, 4379 publisher = {Springer Berlin Heidelberg}, 4380 isbn = {978-3-540-69777-0}, 4381 pages = {151-158}, 4382 doi = {10.1007/978-3-540-69777-0_17}, 4383 year = {2008}, 4384 petsc_uses = {KSP} 4385} 4386 4387@InCollection{ bonfiglioli__carpentieri_ens_2007, 4388 author = {Bonfiglioli, Aldo and Carpentieri, Bruno and Sosonkina, Masha}, 4389 affiliation = {Dip.to di Ingegneria e Fisica dell’Ambiente, University of Basilicata, Potenza, 4390 Italy}, 4391 title = {EulFS: A Parallel {CFD} Code for the Simulation of {Euler and Navier-Stokes} 4392 Problems on Unstructured Grids}, 4393 booktitle = {Applied Parallel Computing. State of the Art in Scientific Computing}, 4394 series = {Lecture Notes in Computer Science}, 4395 editor = {Kågström, Bo and Elmroth, Erik and Dongarra, Jack and Wasniewski, Jerzy}, 4396 publisher = {Springer Berlin / Heidelberg}, 4397 isbn = {978-3-540-75754-2}, 4398 pages = {676-685}, 4399 volume = {4699}, 4400 doi = {10.1007/978-3-540-75755-9_83}, 4401 year = {2007}, 4402 petsc_uses = {KSP} 4403} 4404 4405@Article{ terrelscottknepleykirby08, 4406 author = {Andy R. Terrel and L. Ridgway Scott and Matthew G. Knepley and Robert C. Kirby}, 4407 title = {Automated {FEM} Discretizations for the {Stokes} Equation}, 4408 journal = {BIT}, 4409 volume = {48}, 4410 number = {2}, 4411 year = {2008}, 4412 petsc_uses = {KSP} 4413} 4414 4415@Article{ martamadermartinsweidealonso07, 4416 author = {A. C. Marta and C. A. Mader and J. R. R. A. Martins and E. {Van der Weide} and J. 4417 J. Alonso}, 4418 title = {A methodology for the development of discrete adjoint solvers using automatic 4419 differentiation tools}, 4420 journal = {Computational Fluid Dyanmics}, 4421 volume = {21}, 4422 pages = {307--327}, 4423 year = {2007}, 4424 petsc_uses = {KSP} 4425} 4426 4427@TechReport{ avb2008, 4428 author = {V.R. Ambati and J.J.W. van der Vegt and O. Bokhove}, 4429 title = {Variational Space-time (Dis)continuous Galerkin Method for Linear Free Surface 4430 Waves}, 4431 year = {2008}, 4432 institution = {University of Twente, the Netherlands}, 4433 url = {http://eprints.eemcs.utwente.nl/11714/01/memo1863.pdf}, 4434 petsc_uses = {KSP} 4435} 4436 4437@InProceedings{ bdsm2005, 4438 author = {M. Bozkurttas and H. Dong and V. Seshadri and R. Mittal}, 4439 title = {Towards Numerical Simulation of Flapping Foils on Fixed Cartesian Grids}, 4440 booktitle = {43rd AIAA Aerospace Sciences Meeting and Exhibit}, 4441 year = {2005}, 4442 url = {http://project.seas.gwu.edu/~fsagmae/papers/AIAA_2005_0079.pdf}, 4443 petsc_uses = {KSP} 4444} 4445 4446@InProceedings{ ms2006, 4447 author = {S. Muller and Y. Stiriba}, 4448 title = {A MULTILEVEL FINITE VOLUME METHOD WITH MULTISCALE-BASED GRID ADAPTATION FOR 4449 STEADY COMPRESSIBLE FLOWS}, 4450 booktitle = {European Conference on Computational Fluid Dynamics: ECCOMAS CFD 2006}, 4451 year = {2006}, 4452 url = {http://www.numerical.rl.ac.uk/people/marioli/Archives/ECCOMAS-CFD-2006/documents/197.pdf}, 4453 petsc_uses = {KSP} 4454} 4455 4456@Article{ araujoteixeiracunhagroth08, 4457 author = {B. J. Ara\'ujo and J. C. F. Teixeira and A. M. Cunha and C. P. T. Groth}, 4458 title = {Parallel three-dimensional simulation of the injection molding process}, 4459 journal = {International Journal for Numerical Methods in Fluids}, 4460 year = {2008}, 4461 url = {http://www3.interscience.wiley.com/journal/119876958/abstract?CRETRY=1&SRETRY=0}, 4462 petsc_uses = {KSP} 4463} 4464 4465@PhDThesis{ a2008, 4466 author = {A. Cubero}, 4467 title = {a parallel coupled algorithm for collocated grids and its application to Large 4468 Eddy Simulation of a turbulent wake}, 4469 school = {University of Zaragoza (Spain)}, 4470 year = {2008}, 4471 petsc_uses = {KSP} 4472} 4473 4474@Article{ afa2007, 4475 author = {A. Cubero and N. Fueyo}, 4476 title = {A Compact Momentum Interpolation Method for unsteady flows and relaxation}, 4477 journal = {Numerical Heat Transfer, part B-Fundamentals}, 4478 volume = {56}, 4479 number = {6}, 4480 pages = {507--529}, 4481 year = {2007}, 4482 url = {http://www.informaworld.com/smpp/content~content=a782025305~db=all~order=page}, 4483 petsc_uses = {KSP} 4484} 4485 4486@TechReport{ af2007, 4487 title = {Preconditioning based on a partially implicit implementation of Momentum 4488 Interpolation for coupled solvers}, 4489 institution = {Fluid Mechanics Group of the University of Zaragoza (Spain)}, 4490 year = {2007}, 4491 author = {A. Cubero and N. Fueyo}, 4492 petsc_uses = {KSP} 4493} 4494 4495@InCollection{ dwight2004, 4496 author = {Richard Dwight}, 4497 title = {Robust Mesh Deformation using the Linear Elasticity Equations}, 4498 booktitle = {Computational Fluid Dynamics 2006}, 4499 editor = {H. Deconinck and E. Dick}, 4500 publisher = {Springer}, 4501 year = {2006}, 4502 url = {http://www.maths.man.ac.uk/\~{ 4503 }rdwight/pub/rdwight-ICCFD4-LinElastDeformation-2006.pdf}, 4504 petsc_uses = {KSP} 4505} 4506 4507@InProceedings{ dwight2006, 4508 author = {Richard Dwight and Joel Brezillon}, 4509 title = {Effect of Various Approximations of the Discrete Adjoint on Gradient-Based 4510 Optimization}, 4511 booktitle = {Proceedings of the 44th AIAA Aerospace Sciences Meeting and Exhibit, Reno NV. 4512 AIAA-2006-0690}, 4513 year = {2006}, 4514 url = {http://www.maths.man.ac.uk/\~{ }rdwight/pub/rdwight-AIAAReno-ApproxAdjoint.pdf}, 4515 petsc_uses = {KSP} 4516} 4517 4518@PhDThesis{ dwight2006a, 4519 author = {Richard Dwight}, 4520 title = {Efficiency Improvements of {RANS}-Based Analysis and Optimization using Implicit 4521 and Adjoint Methods on Unstructured Grids}, 4522 school = {School of Mathematics, University of Manchester}, 4523 year = {2006}, 4524 url = {http://www.maths.man.ac.uk/\~{ 4525 }rdwight/pub/rdwight-PhDThesis-ImplicitAndAdjoint.pdf}, 4526 petsc_uses = {KSP} 4527} 4528 4529@InProceedings{ lhdfrh, 4530 author = {M. Lauter and D. Handorf and K. Dethloff and S. Frickenhaus and N. Rakowsky and 4531 W. Hiller}, 4532 title = {An adaptive Lagrange-Galerkin shallow-water model on the sphere}, 4533 booktitle = {Workshop Proceedings Current Development in Shallow Water Models on the Sphere 4534 March, 10-14, 2003, Munich University of Technology, German}, 4535 year = {2003}, 4536 petsc_uses = {KSP} 4537} 4538 4539@InProceedings{ brios-ying-2002, 4540 author = {George Biros and Lexing Ying and Denis Zorin}, 4541 title = {The Embedded Boundary Integral Method (EBI) for the Incompressible 4542 {Navier-Stokes} equations}, 4543 booktitle = {IABEM 2002, International Association for Boundary Element Methods, UT Austin}, 4544 year = {2002}, 4545 petsc_uses = {KSP} 4546} 4547 4548@InProceedings{ mohsen-straatman-ins, 4549 author = {S.A. Mohsen Karimian and Anthony G. Straatman}, 4550 title = {Benchmarking of a {3D}, unstructured, finite volume code for incompressible 4551 {Navier-Stokes} equation on a cluster of distributed-memory computers}, 4552 booktitle = {Proceedings of the 19th International Symposium on High Performance Computing 4553 Systems and Applications}, 4554 pages = {11--16}, 4555 year = {2005}, 4556 url = { http://ieeexplore.ieee.org/search/wrapper.jsp?arnumber=1430046}, 4557 petsc_uses = {KSP} 4558} 4559 4560@TechReport{ bonglioli-icnmfd98, 4561 title = {Multidimensional Residual Distribution Schemes for the Pseudo-Compressible 4562 {Euler} and {Navier-Stokes} equations on Unstructured Meshes}, 4563 institution = {Universita della Basilicata via della Tecnica 3}, 4564 year = {1996}, 4565 author = {A. Bonglioli}, 4566 url = {http://www.unibas.it/utenti/bonfiglioli/icnmfd98.ps.gz}, 4567 petsc_uses = {KSP} 4568} 4569 4570@Article{ deng-piquet-ctf, 4571 author = {G. B. Deng and J. Piquet and X. Vasseur and M. Visonneau"}, 4572 title = {A new fully coupled method for computing turbulent flows}, 4573 journal = {Computers and Fluids}, 4574 volume = {30}, 4575 pages = {445--472}, 4576 year = {2001}, 4577 petsc_uses = {KSP} 4578} 4579 4580@InProceedings{ knepleysarinsameh99b, 4581 title = {Multilevel Preconditioning for Parallel {CFD}}, 4582 author = {Matthew G. Knepley and Vivek Sarin and Ahmed H. Sameh}, 4583 booktitle = {International Conference On Preconditioning Techniques For Large Sparse Matrix 4584 Problems In Industrial Applications}, 4585 address = {Minneapolis, MN}, 4586 year = {1999}, 4587 petsc_uses = {KSP} 4588} 4589 4590@InProceedings{ garbey1, 4591 author = {M. Garbey and B. Hadri and W. Shyy.}, 4592 title = {Fast Elliptic Solver for Incompressible {Navier Stokes} Flow and Heat Transfer 4593 Problems on the Grid}, 4594 booktitle = {Aerospace Sciences Meeting and Exhibit}, 4595 note = {Paper No. 2005-1386}, 4596 year = {2005}, 4597 petsc_uses = {KSP} 4598} 4599 4600@Article{ carrica2007unsteady, 4601 title = {An unsteady single-phase level set method for viscous free surface flows}, 4602 author = {Carrica, PM and Wilson, RV and Stern, F.}, 4603 journal = {International Journal for Numerical Methods in Fluids}, 4604 volume = {53}, 4605 number = {2}, 4606 pages = {229--256}, 4607 year = {2007}, 4608 publisher = {Chichester; New York: Wiley, c1981-}, 4609 petsc_uses = {KSP} 4610} 4611 4612@Article{ pctw2004, 4613 author = {M. S. Politano and P. M. Carrica and C. Turan and L. Weber}, 4614 title = {A Multidimensional Two-Phase Flow Model for the Total Dissolved Gas Downstream of 4615 Spillways}, 4616 journal = {Journal of Hydraulic Research}, 4617 note = {accepted for publication}, 4618 year = {2004}, 4619 petsc_uses = {KSP} 4620} 4621 4622@Article{ wcs2004, 4623 author = {R. V. Wilson and P. M. Carrica and F. Stern}, 4624 title = {Unsteady RANS Method for Ship Motions with Application to Roll for a Surface 4625 Combatant}, 4626 journal = {Computers and Fluids}, 4627 note = {in press}, 4628 year = {2004}, 4629 petsc_uses = {KSP} 4630} 4631 4632@Article{ cws2005, 4633 author = {P. M. Carrica and R. V. Wilson and F. Stern}, 4634 title = {Unsteady RANS Simulation of the Ship Forward Speed Diffraction Problem}, 4635 journal = {Computers and Fluids}, 4636 note = {accepted for publication}, 4637 year = {2005}, 4638 petsc_uses = {KSP} 4639} 4640 4641@Article{ chndss2010, 4642 author = {P. M. Carrica and J. Huang and R. Noack and D. Kaushik and B. Smith and F. 4643 Stern}, 4644 title = { Large-Scale {DES} Computations of the Forward Speed Diffraction and Pitch and 4645 Heave Problems for a Surface Combatant}, 4646 journal = {Computers and Fluids}, 4647 year = {2010}, 4648 volume = {39}, 4649 number = {7}, 4650 pages = {1095--1111}, 4651 petsc_uses = {KSP} 4652} 4653 4654@InProceedings{ chnkss2008, 4655 author = {P. M. Carrica and J. Huang and R. Noack and D. Kaushik and B. Smith and F. 4656 Stern}, 4657 title = {Toward Large-Scale Computations of Ship Motions with Dynamic Overset Curvilinear 4658 Grids}, 4659 booktitle = {Proceedings of the 27th Symposium on Naval Hydrodynamics, Seoul, Korea}, 4660 year = {2008}, 4661 petsc_uses = {KSP} 4662} 4663 4664@MastersThesis{ mtj, 4665 author = {M. T. Jozkowski}, 4666 title = {Application of Algebraic Multigrid Methods to the Solution of Stratified Flows 4667 About Submerged Bodies}, 4668 school = {The Pennsylvania State University}, 4669 year = {2005}, 4670 petsc_uses = {KSP} 4671} 4672 4673@Article{ pp, 4674 author = {E. G. Paterson and L. J. Peltier}, 4675 title = {Detached-Eddy Simulation of High Reynolds Number Beveled-Trailing-Edge Flows and 4676 Wakes}, 4677 journal = {ASME Journal of Fluids Engineering}, 4678 note = {In press}, 4679 year = {2005}, 4680 petsc_uses = {KSP} 4681} 4682 4683@Article{ eps, 4684 author = {B. A. Edge and E. G. Paterson and G. Settles}, 4685 title = {Computational Study of the Wake and Contaminant Transport of a Walking Human}, 4686 journal = {ASME Journal of Fluids Engineering}, 4687 note = {In press}, 4688 year = {2005}, 4689 petsc_uses = {KSP} 4690} 4691 4692@InProceedings{ rp, 4693 author = {B. Racine and E. G. Paterson}, 4694 title = {Computation of Maneuvering Coefficients for Non-Body-of-Revolution Submarines 4695 Using Unsteady {RANS} {CFD}}, 4696 booktitle = {35th AIAA Fluid Dynamics Conference and Exhibit}, 4697 year = {2005}, 4698 petsc_uses = {KSP} 4699} 4700 4701@InProceedings{ etpp, 4702 author = {B. A. Edge and M. F. Trujillo and E. G. Paterson and L. J. Peltier}, 4703 title = {Prediction of Forces and Moments on a Sonobuoy Configuration Using Overset Grids 4704 and DES}, 4705 booktitle = {7th Overset Composite Grid and Solution Technology Symposium}, 4706 year = {2004}, 4707 petsc_uses = {KSP} 4708} 4709 4710@InProceedings{ pp8, 4711 author = {E. G. Paterson and L. J. Peltier}, 4712 title = {Localized turbulence simulation for naval hydrodynamics: issues in using overset 4713 refinement grids and detached-eddy simulation}, 4714 booktitle = {7th Overset Composite Grid and Solution Technology Symposium}, 4715 year = {2004}, 4716 petsc_uses = {KSP} 4717} 4718 4719@InProceedings{ mzwp, 4720 author = {R. Meyer and F. J. Zajackowski and W. A. Straka,and E. G. Paterson}, 4721 title = {Experimental and Computational Study of Cavitation Inception on Co-Flow Nozzles}, 4722 booktitle = {25th Symposium on Naval Hydrodynamics}, 4723 year = {2004}, 4724 petsc_uses = {KSP} 4725} 4726 4727@InProceedings{ ppph, 4728 author = {E. G. Paterson and J. E. Poremba and L. J. Peltier and S. A. Hambric}, 4729 title = {A Physics-Based Simulation Methodology for Predicting Trailing-Edge Singing}, 4730 booktitle = {25th Symposium on Naval Hydrodynamics}, 4731 year = {2004}, 4732 petsc_uses = {KSP} 4733} 4734 4735@InProceedings{ ppd, 4736 author = {E. G. Paterson and L. J. Peltier}, 4737 title = {Detached-Eddy Simulation of High Reynolds Number Trailing-Edge Flows and Wakes}, 4738 booktitle = {Symposium on LES Advancements and Applications, ASME FED Summer Meeting}, 4739 year = {2004}, 4740 petsc_uses = {KSP} 4741} 4742 4743@InProceedings{ bp, 4744 author = {W. J. Baker and E. G. and Paterson}, 4745 title = {Simulation of Steady Circulation Control for the General Aviation Circulation 4746 Control Wing}, 4747 booktitle = {NASA/ONR Workshop on Circulation Control}, 4748 year = {2004}, 4749 petsc_uses = {KSP} 4750} 4751 4752@InProceedings{ pb, 4753 author = {E. G. Paterson and W. J. Baker}, 4754 title = {RANS and Detached-Eddy Simulation of the NCCR airfoil}, 4755 booktitle = {NASA/ONR Workshop on Circulation Control}, 4756 year = {2004}, 4757 petsc_uses = {KSP} 4758} 4759 4760@InProceedings{ pb3, 4761 author = {E. G. Paterson and W. J. Baker}, 4762 title = {Simulation of Steady and Pulsed Circulation Controlfor Marine-Vehicle Control 4763 Surfaces}, 4764 booktitle = {42nd AIAA Aerospace Sciences Meeting}, 4765 year = {2004}, 4766 petsc_uses = {KSP} 4767} 4768 4769@InProceedings{ gid1, 4770 author = {G. Frank and J. D'Elia}, 4771 title = {{CFD} Modelling of the Flow Around the {Ahmed} Vehicle Model}, 4772 year = {2004}, 4773 booktitle = {Proceedings of the 2nd Conference on Advances and Applications of GiD}, 4774 url = {http://www.gid.cimne.upc.es/2004/papers/p216.pdf}, 4775 petsc_uses = {KSP} 4776} 4777 4778@InBook{ b1, 4779 author = {A.Bonfiglioli}, 4780 chapter = {On the use of the PETSc library for unstructured {CFD} applications}, 4781 year = {2001}, 4782 title = {Science and Supercomputing at CINECA}, 4783 pages = {397--400}, 4784 petsc_uses = {KSP} 4785} 4786 4787@InProceedings{ b2004, 4788 author = {L. A. Barba}, 4789 title = {Computing high-Reynolds number vortical flows: a highly accurate method with a 4790 fully meshless formulation}, 4791 year = {2004}, 4792 booktitle = {International Conference on Parallel CFD, Grand Canary, May 2004}, 4793 note = {Submitted}, 4794 petsc_uses = {KSP} 4795} 4796 4797@InProceedings{ bl2004, 4798 author = {L. A. Barba and A. Leonard}, 4799 title = {Computation of Viscous Vortices with Fully Meshless Method}, 4800 year = {2004}, 4801 booktitle = {Proceedings of ICTAM meeting in Warsaw, August 2004}, 4802 note = {Submitted}, 4803 petsc_uses = {KSP} 4804} 4805 4806@Article{ vws1, 4807 author = {B. G. M. Van Wachem and J. C. Schouten}, 4808 title = {Experimental Validation of 3-D Lagrangian VOF Model: Bubble Shape and Rise 4809 Velocity}, 4810 institution = {Laboratory of Chemical Reactor Engineering, Department of Chemical Engineering 4811 and Chemistry, Eindhoven University of Technology, 5600 MB Eindhoven, The 4812 Netherlands}, 4813 journal = {AIChE}, 4814 volumne = {48}, 4815 number = {12}, 4816 month = dec, 4817 year = {2002}, 4818 petsc_uses = {KSP} 4819} 4820 4821@TechReport{ lbam1, 4822 author = {P. Leggiero and A. Bonfiglioli and P. Amodio and F. Mazzi}, 4823 title = {Precondizionatori paralleli per la fluidodinamica computazionale}, 4824 institution = {Dipartimento Interuniversitario di Matematica Universiti degli Studi-Politecnico 4825 di Bari Italy}, 4826 year = {2002}, 4827 number = {25/02}, 4828 petsc_uses = {KSP} 4829} 4830 4831@Article{ kees_miller_02, 4832 author = {C. E. Kees and C. T. Miller}, 4833 title = {Higher Order Time Integration Methods for Two-Phase Flow}, 4834 journal = {Advances in Water Resources}, 4835 year = {2002}, 4836 volume = {25}, 4837 number = {2}, 4838 pages = {159-177.}, 4839 petsc_uses = {KSP} 4840} 4841 4842@InProceedings{ lepotmeersessers2001, 4843 author = {I. Lepot and F. Meers and J.A. Essers}, 4844 title = {Multilevel Parallel High Order Schemes for Invisid Flow Computations on 3D 4845 Unstructured Meshes}, 4846 year = {2001}, 4847 booktitle = {ECCOMAS Computational Fluid Dynamics Conference 2001}, 4848 url = {http://www.ulg.ac.be/aerodyn}, 4849 petsc_uses = {KSP} 4850} 4851 4852@InProceedings{ knepley98, 4853 author = {Matthew Knepley and Denis Vanderstraeten}, 4854 title = {Parallel Building Blocks for Finite Element Simulations: Application to 4855 Solid-Liquid Mixture Flows}, 4856 booktitle = {Proceedings of Parallel CFD'97}, 4857 publisher = {Elsevier}, 4858 pages = {281--287}, 4859 year = {1998}, 4860 petsc_uses = {KSP} 4861} 4862 4863@InProceedings{ pcfd97, 4864 author = {William D. Gropp and David E. Keyes and Lois Curfman McInnes and M. D. Tidriri}, 4865 title = {Parallel Implicit {PDE} Computations: Algorithms and Software}, 4866 publisher = {Elsevier}, 4867 year = {1998}, 4868 booktitle = {Proceedings of Parallel CFD'97}, 4869 pages = {333-344}, 4870 petsc_uses = {KSP} 4871} 4872 4873@InProceedings{ knepleysamehsari98, 4874 author = {Matthew Knepley and Ahmed H. Sameh and Vivek Sarin}, 4875 title = {Parallel Simulation of Particulate Flows}, 4876 booktitle = {Solving Irregularly Structured Problems in Parallel}, 4877 editors = {A. Ferreira et al}, 4878 year = {1998}, 4879 series = {Lecture Notes in Computer Science}, 4880 volume = {1457}, 4881 pages = {226--237}, 4882 petsc_uses = {KSP} 4883} 4884 4885@Article{ gkmt98, 4886 author = {William D. Gropp and David E. Keyes and Lois Curfman McInnes and M. D. Tidriri}, 4887 title = {Globalized {N}ewton-{K}rylov-{S}chwarz Algorithms and Software for Parallel 4888 Implicit {CFD}}, 4889 journal = {Int. J. High Performance Computing Applications}, 4890 year = {2000}, 4891 volume = {14}, 4892 url = {ftp://info.mcs.anl.gov/pub/tech_reports/reports/P788.ps.Z}, 4893 pages = {102-136}, 4894 petsc_uses = {KSP} 4895} 4896 4897@InProceedings{ agkks-sc99, 4898 author = {W. K. Anderson and W. D. Gropp and D. K. Kaushik and D. E. Keyes and B. F. 4899 Smith}, 4900 title = {Achieving High Sustained Performance in an Unstructured Mesh {CFD} Application}, 4901 booktitle = {ACM/IEEE Proc. of SC 99: High Performance Networking and Computing}, 4902 editor = {}, 4903 publisher = {}, 4904 url = {ftp://info.mcs.anl.gov/pub/tech_reports/reports/P776.ps.Z}, 4905 year = {1999}, 4906 note = {Winner of Gordon Bell Special Prize at SC 99}, 4907 petsc_uses = {KSP} 4908} 4909 4910@Article{ gkks01, 4911 author = {W. D. Gropp and D. K. Kaushik and D. E. Keyes and B. F. Smith}, 4912 title = {High Performance Parallel Implicit {CFD}}, 4913 journal = {Journal of Parallel Computing}, 4914 year = {2001}, 4915 volume = {27}, 4916 pages = {337-362}, 4917 url = {http://www.mcs.anl.gov/petsc-fun3d/Papers/manke.pdf}, 4918 petsc_uses = {KSP} 4919} 4920 4921@Article{ cristea-sofonea-02, 4922 author = {Artur Cristea and Victor Sofonea}, 4923 title = {Finite Difference lattice Boltzmann model for Liquid Vapour Systems}, 4924 journal = {Proceedings of the Romanian Academy, Series A: Mathematics, Physics, Technical 4925 Sciences, Information Sciences}, 4926 volume = {3}, 4927 number = {3}, 4928 year = {2002}, 4929 petsc_uses = {KSP} 4930} 4931 4932@Article{ cristea2, 4933 author = {Artur Cristea and Victor Sofonea}, 4934 title = {Two component lattice Boltzmann model with flux limiter techniques}, 4935 journal = {Proceedings of the Romanian Academy, Series A: Mathematics, Physics, Technical 4936 Sciences, Information Sciences}, 4937 volume = {4}, 4938 number = {1}, 4939 year = {2003}, 4940 pages = {59--64}, 4941 petsc_uses = {KSP} 4942} 4943 4944@Article{ cristea1, 4945 author = {Artur Cristea and Victor Sofonea}, 4946 title = {Two component lattice Boltzmann model with flux limiters}, 4947 journal = {Central European Journal of Physics}, 4948 volume = {2}, 4949 number = {2}, 4950 year = {2004}, 4951 pages = {382--396}, 4952 petsc_uses = {KSP} 4953} 4954 4955@Article{ sofnea-lamura1, 4956 author = {Victor Sofonea and Antonio Lamura and Giuseppe Gonnella and Artur Cristea}, 4957 title = {Finite-difference lattice Boltzmann model with flux limiters for liquid-vapor 4958 systems}, 4959 journal = {Physical Review E}, 4960 volume = {70}, 4961 number = {4}, 4962 year = {2004}, 4963 pages = {046702-1 / 046702-9}, 4964 petsc_uses = {KSP} 4965} 4966 4967@InProceedings{ gkks01b, 4968 author = {W. D. Gropp and D. K. Kaushik and D. E. Keyes and B. F. Smith}, 4969 title = {Latency, Bandwidth, and Concurrent Issue Limitations in High-Performance {CFD}}, 4970 booktitle = {Proceedings of the First MIT Conference on Computational Fluid and Solid 4971 Mechanics}, 4972 editor = {}, 4973 location = {Cambridge, MA}, 4974 year = {2001}, 4975 month = jun, 4976 url = {http://www.mcs.anl.gov/petsc-fun3d/Papers/mit01.pdf}, 4977 petsc_uses = {KSP} 4978} 4979 4980@InProceedings{ gkks00, 4981 author = {W. D. Gropp and D. K. Kaushik and D. E. Keyes and B. F. Smith}, 4982 title = {Understanding the Parallel Scalability of An Implicit Unstructured Mesh {CFD} 4983 Code}, 4984 booktitle = {Proceedings of the 7th International Conference on High Performance Computing 4985 (HiPC '2000)}, 4986 editor = {}, 4987 location = {Bangalore, India}, 4988 year = {2000}, 4989 pages = {395--404}, 4990 url = {http://www.mcs.anl.gov/petsc-fun3d/Papers/hipc00.pdf}, 4991 petsc_uses = {KSP} 4992} 4993 4994@InProceedings{ gkks-sc00, 4995 author = {W. D. Gropp and D. K. Kaushik and D. E. Keyes and B. F. Smith}, 4996 title = {Performance Modeling and Tuning of an Unstructured Mesh {CFD} Application}, 4997 booktitle = {Proceedings of SC2000}, 4998 editor = {}, 4999 publisher = {IEEE Computer Society}, 5000 year = {2000}, 5001 url = {http://www.mcs.anl.gov/petsc-fun3d/Papers/sc00.pdf}, 5002 petsc_uses = {KSP} 5003} 5004 5005@InProceedings{ knepleysamehsarin99, 5006 author = {Matthew Knepley and Ahmed H. Sameh and Vivek Sarin}, 5007 title = {Design of Large Scale Parallel Simulations}, 5008 booktitle = {Proceedings of Parallel CFD'99}, 5009 editors = {A. {Ecer et al.}}, 5010 publisher = {Elsevier}, 5011 year = {1999}, 5012 petsc_uses = {KSP} 5013} 5014 5015@InProceedings{ gkks-pcfd99, 5016 author = {William D. Gropp and Dinesh K. Kaushik and David E. Keyes and Barry F. Smith}, 5017 title = {Towards Realistic Performance Bounds for Implicit {CFD} codes}, 5018 booktitle = {Proceedings of Parallel CFD'99}, 5019 editors = {A. {Ecer et al.}}, 5020 publisher = {Elsevier}, 5021 url = {http://www.cs.odu.edu/~keyes/papers/pcfd99_gkks.pdf}, 5022 year = {1999}, 5023 petsc_uses = {KSP} 5024} 5025 5026@InProceedings{ kks97, 5027 author = {D. K. Kaushik and D. E. Keyes and B. F. Smith}, 5028 title = {On the Interaction of Architecture and Algorithm in the Domain-Based 5029 Parallelization of an Unstructured Grid Incompressible Flow Code}, 5030 booktitle = {Proceedings of the 10th International Conference on Domain Decomposition 5031 Methods}, 5032 editor = {J. Mandel et al.}, 5033 pages = {311--319}, 5034 publisher = {Wiley}, 5035 note = {}, 5036 year = {1997}, 5037 petsc_uses = {KSP} 5038} 5039 5040@InProceedings{ kks99, 5041 author = {D. K. Kaushik and D. E. Keyes and B. F. Smith}, 5042 title = {{N}ewton-{K}rylov-{S}chwarz Methods for Aerodynamic Problems: Compressible and 5043 Incompressible Flows on Unstructured Grids}, 5044 booktitle = {Proceedings of the 11th International Conference on Domain Decomposition 5045 Methods}, 5046 editors = {C.-H. {Lai et al.}}, 5047 publisher = {Domain Decomposition Press, Bergen}, 5048 url = {ftp://info.mcs.anl.gov/pub/tech_reports/reports/P745.ps.Z}, 5049 year = {1999}, 5050 petsc_uses = {KSP} 5051} 5052 5053@InCollection{ kks97_cfd, 5054 author = {D. E. Keyes and D. K. Kaushik and B. F. Smith}, 5055 title = {Perspectives for {CFD} on Petaflops Systems}, 5056 booktitle = {CFD Review 1998}, 5057 editor = {M. Hafez and K. Oshima}, 5058 publisher = {World Scientific, Singapore}, 5059 pages = {1079--1096}, 5060 note = {}, 5061 year = {1998}, 5062 petsc_uses = {KSP} 5063} 5064 5065@Article{ hm99, 5066 author = {P. D. Hovland and L. C. McInnes}, 5067 title = {Parallel Simulation of Compressible Flow Using Automatic Differentiation and 5068 {PETSc}}, 5069 year = {2000}, 5070 journal = {Parallel Computing}, 5071 url = {ftp://info.mcs.anl.gov/pub/tech_reports/reports/P796.ps.Z}, 5072 note = {special issue of Parallel Computing on ``Parallel Computing in Aerospace''}, 5073 petsc_uses = {KSP} 5074} 5075 5076@InProceedings{ cruzbarbaknepley08, 5077 author = {Felipe A. Cruz and Lorena A. Barba and Matthew G. Knepley}, 5078 title = {Fast Multipole Method for particle interactions: an open source parallel library 5079 component}, 5080 booktitle = {Proceedings of ParCFD2008}, 5081 year = {2008}, 5082 editor = {Tromeur-Dervout et. al.}, 5083 publisher = {Elsevier}, 5084 petsc_uses = {KSP} 5085} 5086 5087@Article{ hwangcai05, 5088 author = {F.-N. Hwang and X.-C. Cai}, 5089 title = {A parallel nonlinear additive {Schwarz} preconditioned inexact {Newton} algorithm 5090 for incompressible {Navier-Stokes} equations}, 5091 journal = {J. Comput. Phys.}, 5092 volume = {204}, 5093 year = {2005}, 5094 pages = {666--691}, 5095 petsc_uses = {KSP} 5096} 5097 5098@Article{ barbaleonard07, 5099 author = {Lorena A Barba and Anthony Leonard}, 5100 title = {Emergence and evolution of tripole vortices from net-circulation initial 5101 conditions}, 5102 journal = {Phys. Fluids}, 5103 volume = {19}, 5104 pages = {017101}, 5105 year = {2007}, 5106 doi = {10.1063/1.2409734}, 5107 petsc_uses = {KSP} 5108} 5109 5110@Article{ barba07, 5111 author = {Lorena A Barba}, 5112 title = {Non-shielded multipolar vortices at high Reynolds number}, 5113 journal = {Phys. Rev. E}, 5114 volume = {73}, 5115 pages = {065303}, 5116 year = {2006}, 5117 doi = {10.1103/PhysRevE.73.065303}, 5118 petsc_uses = {KSP} 5119} 5120 5121@Article{ schofield2010multi, 5122 title = {Multi-material incompressible flow simulation using the moment-of-fluid method}, 5123 author = {Schofield, S.P. and Christon, M.A. and Dyadechko, V. and Garimella, R.V. and 5124 Lowrie, R.B. and Swartz, B.K.}, 5125 journal = {International Journal for Numerical Methods in Fluids}, 5126 volume = {63}, 5127 number = {8}, 5128 pages = {931--952}, 5129 year = {2010}, 5130 publisher = {Wiley Online Library}, 5131 petsc_uses = {KSP} 5132} 5133 5134% LiteralHTML: 5135% LiteralHTML: <a name="wave"><H3><center>Wave propagation and the Helmholtz equation</center></H3> 5136% LiteralHTML: 5137% LiteralHTML: article{DeGersem99, 5138% LiteralHTML: author = {Ji Wng and Yu Wang and Wen-ke Hu and Jian-ke Du}, 5139% LiteralHTML: title = {The high performance of finite element analysis and applications of surface acoustic waves in finite elastic solids}, 5140% LiteralHTML: } 5141@Article{ nagler2014, 5142 title = {Sound transmission through a poroelastic layered panel}, 5143 author = {Loris Nagler and Ping Rong and Martin Schanz and Otto von Estorff}, 5144 journal = {Computational Mechanics}, 5145 volume = {53}, 5146 number = {4}, 5147 pages = {549--560}, 5148 issn = {1432-0924}, 5149 doi = {10.1007/s00466-013-0916-x}, 5150 year = {2014}, 5151 petsc_uses = {KSP} 5152} 5153 5154@Article{ sheikh2013, 5155 author = {Sheikh, A. H. and Lahaye, D. and Vuik, C.}, 5156 title = {On the convergence of shifted {L}aplace preconditioner combined with multilevel 5157 deflation}, 5158 journal = {Numerical Linear Algebra with Applications}, 5159 volume = {20}, 5160 number = {4}, 5161 issn = {1099-1506}, 5162 doi = {10.1002/nla.1882}, 5163 pages = {645--662}, 5164 keywords = {Helmholtz equation, shifted Laplace preconditioner, multigrid deflation, Fourier 5165 analysis}, 5166 year = {2013}, 5167 petsc_uses = {KSP} 5168} 5169 5170@InProceedings{ silence, 5171 author = {J.M. and Alonso and G. Garcia and V. Hernandez and F.D. Denia and F.J. 5172 Fuenmayor}, 5173 title = {A parallel computing approach for solving the Helmholtz equation in 3D domains: 5174 Application to the study of acoustic behaviour of silencers}, 5175 year = {2004}, 5176 booktitle = {Eurppean Congress on Computational Methods in Applied Sciences and Engineering 5177 (ECCOMAS)}, 5178 petsc_uses = {KSP} 5179} 5180 5181@Article{ degersem99, 5182 author = {H. De Gersem and Domenico Lahaye and S. Vandewalle and K. Hameyer}, 5183 title = {Comparison of Quasi Minimal Residual and Bi-Conjugate Gradient Iterative Methods 5184 to Solve Complex Symmetric Systems Arising from Time-Harmonic Simulations}, 5185 journal = {COMPEL}, 5186 year = {1999}, 5187 volume = {18}, 5188 number = {3}, 5189 pages = {298--310}, 5190 bibdate = {}, 5191 petsc_uses = {KSP} 5192} 5193 5194@InProceedings{ widlund-wave-98, 5195 author = {Olof B. Widlund}, 5196 title = {Schwarz Methods for {H}elmholtz's Equation}, 5197 booktitle = {Mathematical and Numerical Aspects of Wave Propagation}, 5198 editor = {John A. DeSanto}, 5199 year = {1998}, 5200 publisher = {SIAM}, 5201 pages = {620--622}, 5202 address = {Philadelphia}, 5203 note = {Proceedings of the Fourth International Conference on Mathematical and Numerical 5204 Aspects of Wave Propagation, Golden, Colorado, June 1--5}, 5205 petsc_uses = {KSP} 5206} 5207 5208@InProceedings{ toselli-wave-98, 5209 author = {Andrea Toselli}, 5210 title = {Overlapping {S}chwarz Methods for {M}axwell's Equations in Conductive Media}, 5211 booktitle = {Mathematical and Numerical Aspects of Wave Propagation}, 5212 editor = {John A. DeSanto}, 5213 year = {1998}, 5214 publisher = {SIAM}, 5215 address = {Philadelphia}, 5216 pages = {540--542}, 5217 note = {Proceedings of the Fourth International Conference on Mathematical and Numerical 5218 Aspects of Wave Propagation, Golden, Colorado, June 1--5}, 5219 petsc_uses = {KSP} 5220} 5221 5222@InProceedings{ mcinnes-wave-98, 5223 author = {L. C. McInnes and R. Susan-Resiga and H. M. Atassi and D. E. Keyes}, 5224 title = {Parallel Solution of {H}elmholtz Problems using Additive {S}chwarz Methods}, 5225 booktitle = {Mathematical and Numerical Aspects of Wave Propagation}, 5226 editor = {John A. DeSanto}, 5227 year = {1998}, 5228 publisher = {SIAM}, 5229 address = {Philadelphia}, 5230 pages = {623--625}, 5231 note = {Proceedings of the Fourth International Conference on Mathematical and Numerical 5232 Aspects of Wave Propagation, Golden, Colorado, June 1--5}, 5233 petsc_uses = {KSP} 5234} 5235 5236@InProceedings{ mska98, 5237 author = {L. C. McInnes and R. Susan-Resiga and D. E. Keyes and H. M. Atassi}, 5238 title = {Additive {S}chwarz Methods with Nonreflecting Boundary Conditions for the 5239 Parallel Computation of {H}elmholtz Problems}, 5240 booktitle = {Proceedings of the 10th Intl. Conf. on Domain Decomposition Methods}, 5241 editor = {J. Mandel et al.}, 5242 publisher = {AMS}, 5243 pages = {349--357}, 5244 year = {1998}, 5245 petsc_uses = {KSP} 5246} 5247 5248@InProceedings{ ccew98, 5249 author = {X.-C. Cai and M. A. Casarin, Jr. and F. W. Elliott, Jr. and O. B. Widlund}, 5250 title = {Overlapping {S}chwarz Algorithms for Solving {H}elmholtz's Equation}, 5251 booktitle = {Proceedings of the 10th Intl. Conf. on Domain Decomposition Methods}, 5252 editor = {J. Mandel et al.}, 5253 publisher = {AMS}, 5254 pages = {437-445}, 5255 year = {1998}, 5256 petsc_uses = {KSP} 5257} 5258 5259@InProceedings{ ra98a, 5260 author = {R. Susan-Resiga and H. M. Atassi}, 5261 title = {Parallel Computing Using {S}chwarz Domain Decomposition Method for Aeroacoustic 5262 Problems}, 5263 booktitle = {Proceedings of the 4th AIAA/CEAS Aeroacoustics Conference}, 5264 publisher = {AIAA}, 5265 pages = {86-96}, 5266 note = {AIAA paper 98-2218}, 5267 year = {1998}, 5268 petsc_uses = {KSP} 5269} 5270 5271@InProceedings{ ar98c, 5272 author = {H. M. Atassi and R. Susan-Resiga}, 5273 title = {Parallel Computation of Harmonic Waves using Domain Decomposition, Part {I}: 5274 General Formulation}, 5275 booktitle = {Proceedings of the ASME Noise Control and Acoustics Division}, 5276 publisher = {ASME}, 5277 note = {NCA-25}, 5278 pages = {375-379}, 5279 year = {1998}, 5280 petsc_uses = {KSP} 5281} 5282 5283@InProceedings{ ra98b, 5284 author = {R. Susan-Resiga and H. M. Atassi}, 5285 title = {Parallel Computation of Harmonic Waves using Domain Decomposition, Part {II}: 5286 Numerical Implementation and Applications}, 5287 booktitle = {Proceedings of the ASME Noise Control and Acoustics Division}, 5288 publisher = {ASME}, 5289 note = {NCA-25}, 5290 pages = {381 -388}, 5291 year = {1998}, 5292 petsc_uses = {KSP} 5293} 5294 5295@InProceedings{ cai-dd10-98, 5296 author = {Xiao-Chuan Cai and Mario A. Casarin and Frank W. Elliott, Jr. and Olof B. 5297 Widlund}, 5298 title = {Overlapping {S}chwarz methods for solving {H}elmholtz's Equation}, 5299 booktitle = {Domain Decomposition Methods 10}, 5300 editors = {Jan Mandel and Charbel Farhat and Xiao-Chuan Cai}, 5301 series = {Contemporary Mathematics}, 5302 volume = {218}, 5303 publisher = {American Mathematical Society}, 5304 address = {Providence, Rhode Island}, 5305 year = {1998}, 5306 pages = {437--445}, 5307 petsc_uses = {KSP} 5308} 5309 5310@InProceedings{ alghamdi2011petclaw, 5311 title = {Pet{C}law: A Scalable Parallel Nonlinear Wave Propagation Solver for {P}ython}, 5312 booktitle = {Proceedings of SpringSim 2011}, 5313 publisher = {ACM}, 5314 author = {Amal Alghamdi and Aron Ahmadia and David I. Ketcheson and Matthew G. Knepley and 5315 Kyle T. Mandli and Lisandro Dalcin}, 5316 year = {2011}, 5317 petsc_uses = {KSP} 5318} 5319 5320@Article{ pyclaw2012, 5321 author = {David I. Ketcheson and Kyle T. Mandli and Aron J. Ahmadia and Amal Alghamdi and 5322 Manuel Quezada de Luna and Matteo Parsani and Matthew G. Knepley and Matthew 5323 Emmett}, 5324 title = {{PyClaw}: Accessible, Extensible, Scalable Tools for Wave Propagation Problems}, 5325 journal = {SIAM Journal on Scientific Computing}, 5326 volume = {34}, 5327 number = {4}, 5328 pages = {C210--C231}, 5329 note = {\url{http://arxiv.org/abs/1111.6583}}, 5330 year = {2012}, 5331 petsc_uses = {KSP} 5332} 5333 5334% LiteralHTML: 5335% LiteralHTML: <a name="optimization"><H3><center>Optimization</center></H3> 5336% LiteralHTML: 5337@Article{ sojkahorakhaplacermak2018, 5338 title = {The impact of enabling multiple subdomains per MPI process in the TFETI domain 5339 decomposition method}, 5340 author = {Radim Sojka and David Hor{\'a}k and V{\'a}clav Hapla and Martin {\v{C}}erm{\'a}k}, 5341 journal = {Applied Mathematics and Computation}, 5342 volume = {319}, 5343 pages = {586--597}, 5344 year = {2018}, 5345 petsc_uses = {KSP} 5346} 5347 5348@Article{ chencai2014, 5349 title = {A parallel two-level domain decomposition based one-shot method for shape 5350 optimization problems}, 5351 author = {Rongliang Chen and Xiao‐Chuan Cai}, 5352 journal = {International Journal for Numerical Methods in Engineering}, 5353 volume = {99}, 5354 number = {13}, 5355 year = {2014}, 5356 doi = {10.1002/nme.4711}, 5357 petsc_uses = {KSP} 5358} 5359 5360@PhDThesis{ prudencio2005, 5361 author = {Ernesto Prudencio}, 5362 title = {Parallel Fully Coupled {Lagrange-Newton-Krylov-Schwarz} Algorithms and Software 5363 for Optimization Problems Constrained by Partial Differential Equations}, 5364 school = {University of Colorado, Boulder}, 5365 year = {2005}, 5366 petsc_uses = {KSP} 5367} 5368 5369@Article{ prudenciocai2007, 5370 title = {Parallel multilevel restricted {Schwarz} preconditioners with pollution removing 5371 for {PDE}-constrained optimization}, 5372 author = {Ernesto Prudencio and X. C. Cai}, 5373 journal = {SIAM J. Sci. Comp.}, 5374 volume = {29}, 5375 number = {3}, 5376 pages = {964--985}, 5377 year = {2007}, 5378 petsc_uses = {KSP} 5379} 5380 5381@Article{ prudenciobyrdcai2006, 5382 author = {Ernesto Prudencio and R. Byrd and X. C. Cai}, 5383 title = {Parallel full space {SQP Lagrange-Newton-Krylov-Schwarz} algorithms for 5384 {PDE}-constrained Optimization Problems}, 5385 journal = {SIAM J. Sci. Comp.}, 5386 volume = {27}, 5387 pages = {1305--1328}, 5388 year = {2006}, 5389 petsc_uses = {KSP} 5390} 5391 5392@InProceedings{ prudenciobyrdcai2004, 5393 title = {Domain decomposition methods for {PDE}-constrained optimization problems}, 5394 author = {Ernesto Prudencio and R. Byrd and X. C. Cai}, 5395 booktitle = {VECPAR 2004}, 5396 editor = {M. Dayde and J. Dongarra and V. Hernandex and J. Palma}, 5397 publisher = {Springer}, 5398 pages = {569--582}, 5399 year = {2004}, 5400 petsc_uses = {KSP} 5401} 5402 5403@Article{ belhamadia-fortin-pcp, 5404 author = {Youssef Belhamadia and Andre Fortin and Eric Chamberland}, 5405 title = {Three-dimensional anisotropic mesh adaptation for phase change problems}, 5406 journal = {Journal of Computational Physics}, 5407 volume = {201}, 5408 pages = {753-770}, 5409 year = {2004}, 5410 url = {http://portal.acm.org/citation.cfm?id=1055817.1055834#references}, 5411 petsc_uses = {KSP} 5412} 5413 5414@Article{ biros00, 5415 author = {George Biros and Omar Ghattas}, 5416 title = {A {Lagrange-Newton-Krylov-Schur} Method for {PDE} Constrained Optimization}, 5417 journal = {SIAG-Opt Views and News}, 5418 volume = {11}, 5419 number = {2}, 5420 year = {2000}, 5421 month = aug, 5422 url = {http://www.cs.cmu.edu/\~{ }oghattas/papers/siag-opt/siag-opt.pdf}, 5423 petsc_uses = {KSP} 5424} 5425 5426@Article{ bmm01, 5427 author = {Steve Benson and Lois Curfman McInnes and Jorge Mor\'{e}}, 5428 journal = {ACM Transactions on Mathematical Software}, 5429 title = {A case study in the performance and scalability of optimization algorithms}, 5430 year = {2001}, 5431 volume = {27}, 5432 number = {3}, 5433 pages = {361--376}, 5434 petsc_uses = {KSP} 5435} 5436 5437@InProceedings{ oghattas1999, 5438 author = {George Biros and Omar Ghattas}, 5439 title = {Parallel preconditioners for {KKT} systems arising in optimal control of viscous 5440 incompressible flows}, 5441 booktitle = {Proceedings of Parallel CFD '99, Williamsburg, Virginia, USA, May 23-26, 1999}, 5442 url = {http://www.cs.cmu.edu/\~{ }oghattas/papers/pcfd99/pcfd99.pdf}, 5443 year = {1999}, 5444 petsc_uses = {KSP} 5445} 5446 5447@InProceedings{ hkms00, 5448 title = {Using Automatic Differentiation for Second-order Matrix-free Methods in 5449 PDE-constrained Optimization}, 5450 author = {P. D. Hovland and D. E. Keyes and L. C. McInnes and W. Samyono}, 5451 url = {http://www.icase.edu/\~{ }keyes/papers/ad2000.ps}, 5452 booktitle = {Automatic Differentiation of Algorithms: From Simulation to Optimization}, 5453 editor = {George Corliss and Christ\`{e}le Faure and Andreas Griewank and Laurent 5454 Hasco\"{e}t and Uwe Naumann}, 5455 publisher = {Springer}, 5456 year = {2002}, 5457 petsc_uses = {KSP} 5458} 5459 5460% old version: replace with biros2005pln1 5461@TechReport{ bg011, 5462 author = {George Biros and Omar Ghattas}, 5463 title = {Parallel Lagrange-Newton-Krylov-Schur Methods for PDE-Constrained Optimization. 5464 Part I: The Krylov-Schur Solver}, 5465 institution = {Laboratory for Mechanics, Algorithms, and Computing, Carnegie Mellon University}, 5466 year = {2001}, 5467 url = {http://www.cs.cmu.edu/\~{ }oghattas/papers/lnks/lnks1.pdf}, 5468 petsc_uses = {KSP} 5469} 5470 5471% old version: replace with biros2005pln2 5472@TechReport{ bg012, 5473 author = {George Biros and Omar Ghattas}, 5474 title = {Parallel {Lagrange-Newton-Krylov-Schur} Methods for {PDE}-Constrained 5475 Optimization. Part II: The {Lagrange-Newton} Solver, and its Application to 5476 Optimal Control of Steady Viscous Flows}, 5477 institution = {Laboratory for Mechanics, Algorithms, and Computing, Carnegie Mellon University}, 5478 year = {2001}, 5479 url = {http://www.cs.cmu.edu/\~{ }oghattas/papers/lnks/lnks2.pdf}, 5480 petsc_uses = {KSP} 5481} 5482 5483% LiteralHTML: 5484% LiteralHTML: <a name="fastmethods"><H3><center>Fast Algorithms</center></H3> 5485% LiteralHTML: 5486@InProceedings{ ly2003, 5487 author = {Lexing Ying and G. Biros and D. Zorin and H. Langston}, 5488 title = {A New Parallel Kernel-independent Fast Multipole Method}, 5489 booktitle = {Proceedings of the ACM/IEEE conference on Supercomputing 2003}, 5490 year = {2003}, 5491 note = {Winner of the Best Student Paper at SC2003}, 5492 petsc_uses = {KSP} 5493} 5494 5495@Article{ yokotabarbaknepley10, 5496 author = {Rio Yokota and L A Barba and Matthew G Knepley}, 5497 title = {{PetRBF} -- A parallel {O(N)} algorithm for radial basis function interpolation}, 5498 journal = {Computer Methods in Applied Mechanics and Engineering}, 5499 volume = {199}, 5500 number = {25-28}, 5501 pages = {1793--1804}, 5502 url = {http://arxiv.org/abs/0909.5413v1}, 5503 note = {\url{http://arxiv.org/abs/0909.5413v1}}, 5504 year = {2010}, 5505 petsc_uses = {KSP} 5506} 5507 5508@Article{ cruzknepleybarba10, 5509 author = {Felipe A. Cruz and Matthew G Knepley and L A Barba}, 5510 title = {{PetFMM} -- A dynamically load-balancing parallel fast multipole library}, 5511 journal = {International Journal of Numerical Methods in Engineering}, 5512 volume = {85}, 5513 number = {4}, 5514 pages = {403--428}, 5515 url = {http://arxiv.org/abs/0905.2637}, 5516 note = {\url{http://arxiv.org/abs/0905.2637}}, 5517 year = {2010}, 5518 petsc_uses = {KSP} 5519} 5520 5521% LiteralHTML: 5522% LiteralHTML: <a name="otherapps"><H3><center>Other Application Areas</center></H3> 5523% LiteralHTML: 5524@Article{ buchanpainumplebysmedleystevenson2012, 5525 title = {A sub-grid scale finite element agglomeration multigrid method with application 5526 to the Boltzmann transport equation}, 5527 author = {AG Buchan and CC Pain and AP Umpleby and RP Smedley-Stevenson}, 5528 journal = {International Journal for Numerical Methods in Engineering}, 5529 volume = {92}, 5530 number = {3}, 5531 pages = {318--342}, 5532 year = {2012}, 5533 publisher = {Wiley Online Library}, 5534 petsc_uses = {KSP} 5535} 5536 5537@Article{ magoulesahamedsuzuki2015, 5538 title = {Green computing on graphics processing units}, 5539 author = {Fr{\'e}d{\'e}ric Magoul{\`e}s and Abal-Kassim Cheik Ahamed and Atsushi Suzuki}, 5540 journal = {Concurrency and Computation: Practice and Experience}, 5541 year = {2015}, 5542 publisher = {Wiley Online Library}, 5543 petsc_uses = {KSP} 5544} 5545 5546@InProceedings{ yanrhodes11, 5547 author = {Yan, Baoqiang and Rhodes, Philip J.}, 5548 title = {IDEA -- An API for Parallel Computing with Large Spatial Datasets}, 5549 booktitle = {Proceedings of the 2011 International Conference on Parallel Processing}, 5550 series = {ICPP '11}, 5551 pages = {355--364}, 5552 year = {2011}, 5553 isbn = {978-0-7695-4510-3}, 5554 numpages = {10}, 5555 doi = {10.1109/ICPP.2011.70}, 5556 acmid = {2066965}, 5557 publisher = {IEEE Computer Society}, 5558 address = {Washington, DC, USA}, 5559 keywords = {cluster, parallelization, spatial dataset, dependency, data partitioning}, 5560 petsc_uses = {KSP} 5561} 5562 5563@Article{ hakansson2013mdstochasticliouville, 5564 author = {Hakansson, Par and Nguyen, ThaoNguyen and Nair, Prasanth B. and Edge, Ruth and 5565 Stulz, Eugen}, 5566 title = {Cu(ii)-porphyrin molecular dynamics as seen in a novel EPR/Stochastic Liouville 5567 equation study}, 5568 journal = {Phys. Chem. Chem. Phys.}, 5569 year = {2013}, 5570 volume = {15}, 5571 issue = {26}, 5572 pages = {10930-10941}, 5573 publisher = {The Royal Society of Chemistry}, 5574 doi = {10.1039/C3CP50788B}, 5575 petsc_uses = {KSP} 5576} 5577 5578@Article{ hakansson2011stochasticliouville, 5579 author = {Hakansson, Par and Nair, Prasanth B.}, 5580 title = {Implicit numerical schemes for the stochastic Liouville equation in Langevin 5581 form}, 5582 journal = {Phys. Chem. Chem. Phys.}, 5583 year = {2011}, 5584 volume = {13}, 5585 issue = {20}, 5586 pages = {9578-9589}, 5587 publisher = {The Royal Society of Chemistry}, 5588 doi = {10.1039/C1CP20400A}, 5589 petsc_uses = {KSP} 5590} 5591 5592@InProceedings{ wang:lee:scidac2011, 5593 author = {Lei Wang and Jungho Lee and Mihai Anitescu and Anter El Azab and Lois Curfman 5594 McInnes and Todd Munson and Barry Smith}, 5595 title = {A Differential Variational Inequality Approach for the Simulation of 5596 Heterogeneous Materials}, 5597 booktitle = {Proceedings of SciDAC 2011 Conference}, 5598 year = {2011}, 5599 petsc_uses = {KSP} 5600} 5601 5602@Article{ bourdinlarsenrichardson2011, 5603 author = {Blaise Bourdin and Christopher Larsen and Casey Richardson}, 5604 title = {A time-discrete model for dynamic fracture based on crack regularization}, 5605 journal = {International Journal of Fracture}, 5606 volume = {168}, 5607 issue = {2}, 5608 pages = {133--143}, 5609 doi = {10.1007/s10704-010-9562-x}, 5610 year = {2011}, 5611 petsc_uses = {KSP} 5612} 5613 5614@Book{ bourdinfrancfortmarigo, 5615 author = {Blaise Bourdin and Gilles Francfort and Jean-Jacques Marigo}, 5616 title = {The Variational Approach to Fracture}, 5617 publisher = {Springer}, 5618 year = {2008}, 5619 petsc_uses = {KSP} 5620} 5621 5622@Article{ bourdinfrancfortmarigo2008, 5623 author = {Blaise Bourdin and Gilles Francfort and Jean-Jacques Marigo}, 5624 title = {The Variational Approach to Fracture}, 5625 journal = {J. Elasticity}, 5626 volume = {91}, 5627 issue = {1}, 5628 pages = {1--148}, 5629 doi = {10.1007/s10659-007-9107-3}, 5630 year = {2008}, 5631 petsc_uses = {KSP} 5632} 5633 5634@Article{ lahtinen2008spectrum, 5635 title = {Spectrum of the non-abelian phase in Kitaev's honeycomb lattice model}, 5636 author = {Lahtinen, V. and Kells, G. and Carollo, A. and Stitt, T. and Vala, J. and Pachos, 5637 J.K.}, 5638 journal = {Annals of Physics}, 5639 volume = {323}, 5640 number = {9}, 5641 pages = {2286--2310}, 5642 year = {2008}, 5643 publisher = {Elsevier}, 5644 petsc_uses = {KSP} 5645} 5646 5647@InProceedings{ roark2004discriminative, 5648 title = {Discriminative language modeling with conditional random fields and the 5649 perceptron algorithm}, 5650 author = {Roark, B. and Saraclar, M. and Collins, M. and Johnson, M.}, 5651 booktitle = {Proceedings of the 42nd Annual Meeting on Association for Computational 5652 Linguistics}, 5653 pages = {47}, 5654 year = {2004}, 5655 organization = {Association for Computational Linguistics}, 5656 petsc_uses = {KSP} 5657} 5658 5659@Article{ roark2007discriminative, 5660 title = {Discriminative n-gram language modeling}, 5661 author = {Roark, B. and Saraclar, M. and Collins, M.}, 5662 journal = {Computer Speech \& Language}, 5663 volume = {21}, 5664 number = {2}, 5665 pages = {373--392}, 5666 year = {2007}, 5667 publisher = {Elsevier}, 5668 petsc_uses = {KSP} 5669} 5670 5671@Conference{ garcia2011parallel, 5672 title = {{Parallel performance of the PETSc Krylov methods applied to linear systems of 3D 5673 nanodevice simulators}}, 5674 author = {Garcia-Rivera, A. and Valin, R. and Seoane, N. and Garcia-Loureiro, A. and 5675 Aldegunde, M.}, 5676 booktitle = {Electron Devices (CDE), 2011 Spanish Conference on}, 5677 pages = {1--4}, 5678 organization = {IEEE}, 5679 petsc_uses = {KSP} 5680} 5681 5682@Conference{ wesley2006parallel, 5683 title = {{A parallel artificial neural network implementation}}, 5684 author = {Wesley-Smith, I.}, 5685 booktitle = {Proceedings of The National Conference On Undergraduate Research (NCUR)}, 5686 year = {2006}, 5687 petsc_uses = {KSP} 5688} 5689 5690@Article{ hcsw1, 5691 author = {F.-N. Hwang and S.-R. Cai and Y.-L. Shao and J.-S. Wu}, 5692 title = {Parallel Newton-Krylov-Schwarz algorithms for the three-dimensional 5693 Poisson-Boltzmann equation in numerical simulation of colloidal particle 5694 interactions}, 5695 journal = {Computer Physics Communications}, 5696 volumne = {181}, 5697 year = {2010}, 5698 pages = {1529--1537}, 5699 petsc_uses = {KSP} 5700} 5701 5702@Article{ hh1, 5703 author = {C.-Y. Huang and F.-N. Hwang}, 5704 title = {Parallel pseudo-transient Newton-Krylov-Schwarz continuation algorithms for 5705 bifurcation analysis of incompressible sudden expansion flows}, 5706 journal = {Applied Numerical Mathematics}, 5707 volume = {60}, 5708 year = {2010}, 5709 pages = {738--751}, 5710 petsc_uses = {KSP} 5711} 5712 5713@Article{ hwhw1, 5714 author = {F.-N. Hwang and Z.-H. Wei and T.-M. Huang and W. Wang}, 5715 title = {A parallel additive Schwarz preconditioned Jacobi-Davidson algorithm for 5716 polynomial eigenvalue problems in quantum dot simulation}, 5717 journal = {Journal of Computational Physics}, 5718 volume = {229}, 5719 year = {2010}, 5720 pages = {2932--2947}, 5721 petsc_uses = {KSP} 5722} 5723 5724@Article{ wei2011parallel, 5725 title = {{A Parallel Scalable PETSc-Based Jacobi-Davidson Polynomial Eigensolver with 5726 Application in Quantum Dot Simulation}}, 5727 author = {Wei, Z.H. and Hwang, F.N. and Huang, T.M. and Wang, W.}, 5728 journal = {Domain Decomposition Methods in Science and Engineering XIX}, 5729 pages = {157--164}, 5730 year = {2011}, 5731 publisher = {Springer}, 5732 petsc_uses = {KSP} 5733} 5734 5735@Article{ flores2007sequential, 5736 title = {{Sequential and parallel resolution of the two-group transient neutron diffusion 5737 equation using second-degree iterative methods}}, 5738 author = {Flores-S{\'a}nchez, O. and Vidal, V. and Garc{\'\i}a, V. and Flores-S{\'a}nchez, P.}, 5739 journal = {High Performance Computing for Computational Science-VECPAR 2006}, 5740 pages = {426--438}, 5741 year = {2007}, 5742 publisher = {Springer}, 5743 petsc_uses = {KSP} 5744} 5745 5746@InProceedings{ gordonbell09, 5747 author = {Dinesh Kaushik and Michael Smith and Allan Wollaber and Barry Smith and Andrew 5748 Siegel and Won Sik Yang}, 5749 title = {Enabling High Fidelity Neutron Transport Simulations on Petascale Architectures}, 5750 booktitle = {ACM/IEEE Proceedings of SC2009: High Performance Networking and Computing}, 5751 note = {{SC'09 Gordon Bell} Prize Finalist}, 5752 year = {2009}, 5753 petsc_uses = {KSP} 5754} 5755 5756@Article{ knepleykarpeevdavidovitseisenberggillespie10, 5757 author = {Matthew G. Knepley and Dmitry A. Karpeev and Seth Davidovits and Robert~S. 5758 Eisenberg and Dirk Gillespie}, 5759 title = {An Efficient Algorithm for Classical Density Functional Theory in Three 5760 Dimensions: Ionic Solutions}, 5761 journal = {Journal of Physical Chemistry}, 5762 volume = {132}, 5763 number = {12}, 5764 pages = {124101--124111}, 5765 url = {http://arxiv.org/abs/0910.1531}, 5766 year = {2010}, 5767 petsc_uses = {KSP} 5768} 5769 5770@Article{ knepleykarpeeveisenberggillespie09, 5771 author = {{Knepley}, M.~G. and {Karpeev}, D.~A. and {Eisenberg}, R.~S. and {Gillespie}, 5772 D.}, 5773 title = {{Energetics of Calcium Selectivity: A Three-Dimensional Classical Density 5774 Functional Theory Approach}}, 5775 journal = {Biophysical Journal}, 5776 month = feb, 5777 volume = {96}, 5778 pages = {661}, 5779 doi = {10.1016/j.bpj.2008.12.3494}, 5780 year = {2009}, 5781 petsc_uses = {KSP} 5782} 5783 5784@Article{ scx2008, 5785 author = {SUWITO AND XIAO-CHUAN CAI AND YUNPING XI}, 5786 title = {PARALLEL FINITE ELEMENT METHOD FOR COUPLED CHLORIDE MOISTURE DIFFUSION IN 5787 CONCRETE}, 5788 journal = {INTERNATIONAL JOURNAL OF NUMERICAL ANALYSIS AND MODELING}, 5789 volume = {3}, 5790 number = {4}, 5791 year = {2006}, 5792 url = {http://www.math.ualberta.ca/ijnam/Volume-3-2006/No-4-06/2006-04-06.pdf}, 5793 petsc_uses = {KSP} 5794} 5795 5796@TechReport{ kdgs2008, 5797 year = {2008}, 5798 school = {Centro Internacional de Methodos Numericos en Ingenieria, Argentina}, 5799 title = {High Performance Simulations of Electrokinetic Flow and Transport in Microfluidic 5800 Chips}, 5801 author = {Pablo A. Klera and Lisandro D. Dalcin and Fabio A. Guarnieria and Mario A. 5802 Stortia}, 5803 url = {http://www.cimec.org.ar/ojs/index.php/cmm/article/view/1383}, 5804 petsc_uses = {KSP} 5805} 5806 5807@Article{ springerlink:10.1007/s10915-011-9551-x, 5808 author = {Schauer, Marco and Roman, Jose and Quintana-Ortí, Enrique and Langer, Sabine}, 5809 affiliation = {Institut für Angewandte Mechanik, Technische Universität Carolo-Wilhelmina zu 5810 Braunschweig, Spielmannstraße 11, 38106 Braunschweig, Germany}, 5811 title = {Parallel Computation of 3-D Soil-Structure Interaction in Time Domain with a 5812 Coupled FEM/SBFEM Approach}, 5813 journal = {Journal of Scientific Computing}, 5814 publisher = {Springer Netherlands}, 5815 issn = {0885-7474}, 5816 keyword = {Mathematics and Statistics}, 5817 pages = {1-22}, 5818 doi = {10.1007/s10915-011-9551-x}, 5819 petsc_uses = {KSP} 5820} 5821 5822@TechReport{ jj2007, 5823 author = {Boris Jeremic and Guanzhou Jie}, 5824 title = {Parallel Finite Element Computations for Soil-Foundation-Structure Interaction 5825 Problems Report}, 5826 institution = {UCD CompGeoMech 02--2007}, 5827 year = {2007}, 5828 url = {http://sokocalo.engr.ucdavis.edu/~jeremic/wwwpublications/CV-R23.pdf}, 5829 petsc_uses = {KSP} 5830} 5831 5832@Unpublished{ kuiper08, 5833 title = {Fast 3D frequency-dependent Radiative Transfer for Magneto-Hydrodynamics}, 5834 author = {Rolf Kuiper}, 5835 institution = {Max-Planck-Institute for Astronomy}, 5836 url = {http://www.mpia.de/~kuiper/MAKEMAKE.html}, 5837 year = {2008}, 5838 petsc_uses = {KSP} 5839} 5840 5841@Article{ williamson2012multidimensional, 5842 title = {Multidimensional multiphysics simulation of nuclear fuel behavior}, 5843 author = {Williamson, R.L. and Hales, J.D. and Novascone, S.R. and Tonks, M.R. and Gaston, 5844 D.R. and Permann, C.J. and Andrs, D. and Martineau, R.C.}, 5845 journal = {Journal of Nuclear Materials}, 5846 volume = {423}, 5847 number = {1}, 5848 pages = {149--163}, 5849 year = {2012}, 5850 publisher = {Elsevier}, 5851 petsc_uses = {KSP} 5852} 5853 5854@InProceedings{ kucukboyaci2015cobra, 5855 title = {COBRA-TF parallelization and application to PWR reactor core subchannel DNB 5856 analysis}, 5857 author = {Kucukboyaci, Vefa and Sung, Yixing and Salko, Robert}, 5858 booktitle = {Joint International Conference on Mathematics and Computation, Supercomputing in 5859 Nuclear Applications and the Monte Carlo Method}, 5860 pages = {1--18}, 5861 year = {2015}, 5862 petsc_uses = {KSP} 5863} 5864 5865@Article{ hales2012solving, 5866 title = {Solving Nonlinear Solid Mechanics Problems with the {J}acobian-{F}ree {N}ewton 5867 {K}rylov Method}, 5868 author = {Hales, J.D. and Novascone, S.R. and Williamson, R.L. and Gaston, D.R. and Tonks, 5869 M.R.}, 5870 journal = {Computer Modeling in Engineering \& Sciences(CMES)}, 5871 volume = {84}, 5872 number = {2}, 5873 pages = {123--153}, 5874 year = {2012}, 5875 publisher = {Tech Science Press}, 5876 petsc_uses = {KSP} 5877} 5878 5879@InProceedings{ srksyp2008, 5880 author = {M. A. Smith and C. Rabiti and D. Kaushik and B. Smith and W. S. Yang and G. 5881 Palmiotti}, 5882 title = {Fast reactor core simulations using the {UNIC} code}, 5883 booktitle = {Proceedings of the International Conference on the Physics of Reactors, Nuclear 5884 Power: A Sustainable Resource}, 5885 year = {2008}, 5886 petsc_uses = {KSP} 5887} 5888 5889@InProceedings{ psrlkssl2007, 5890 author = {G. Palmiotti and M. A. Smith and C. Rabiti and M. Leclere and D. Kaushik and A. 5891 Siegel and B. Smith and E. E. Lewis}, 5892 title = {{UNIC}: Ultimate Neutronic Investigation Code}, 5893 booktitle = {Joint International Topical Meeting on Mathematics and Computation and 5894 Supercomputing in Nuclear Applications}, 5895 year = {2007}, 5896 petsc_uses = {KSP} 5897} 5898 5899@InProceedings{ sprkssl2007, 5900 author = {M. A. Smith and G. Palmiotti and C. Rabiti and D. Kaushik and A. Siegel and B. 5901 Smith and E. E. Lewis}, 5902 title = {{PNFE} Component of the {UNIC} Code}, 5903 booktitle = {Joint International Topical Meeting on Mathematics and Computation and 5904 Supercomputing in Nuclear Applications}, 5905 year = {2007}, 5906 petsc_uses = {KSP} 5907} 5908 5909@InProceedings{ dc-oop-03, 5910 author = {H. Digonnet and T. Coupez}, 5911 title = {Object-oriented programming for fast-and-easy development of parallel 5912 applications in forming processes simulation}, 5913 booktitle = {Proceedings of the Second MIT Conference on Computational Fluid and Solid 5914 Mechanics}, 5915 year = {2003}, 5916 petsc_uses = {KSP} 5917} 5918 5919@InProceedings{ dc-cfm-03, 5920 author = {H. Digonnet and T. Coupez}, 5921 title = {Calcul parallele en mise en forme des materiaux}, 5922 booktitle = {XVIeme Congres Francais de Mecanique}, 5923 year = {2003}, 5924 petsc_uses = {KSP} 5925} 5926 5927@InProceedings{ dsc-pcsev-04, 5928 author = {H. Digonnet and L. Silva and T. Coupez}, 5929 title = {Parallel computation for solving efficiently viscoelastic fluid flow problems}, 5930 booktitle = {Proceedings of ECCOMAS 2004}, 5931 year = {2004}, 5932 petsc_uses = {KSP} 5933} 5934 5935@InProceedings{ dsc-pca3fs-04, 5936 author = {H. Digonnet and L. Silva and T. Coupez}, 5937 title = {Parallel computation applied to 3D FE simulation of polymer injection molding}, 5938 booktitle = {Proceedings of WCCM VI}, 5939 year = {2004}, 5940 petsc_uses = {KSP} 5941} 5942 5943@InProceedings{ dbcs-cpaac-05, 5944 author = {H. Digonnet and O. Basset and T. Coupez and L. Silva}, 5945 title = {Calcul parallele appliqu aux coulements de fluides complexe}, 5946 booktitle = {Proceedings of Eme Congres Francais de Mecanique}, 5947 year = {2005}, 5948 petsc_uses = {KSP} 5949} 5950 5951@Article{ sz2010, 5952 author = {B. Smith and H. Zhang}, 5953 title = {Sparse Triangular Solves for {ILU} Revisited: Data Layout Crucial to Better 5954 Performance}, 5955 journal = {International Journal of High Performance Computing Applications}, 5956 volume = {25}, 5957 number = {4}, 5958 pages = {386--391}, 5959 year = {2011}, 5960 petsc_uses = {KSP} 5961} 5962 5963@Article{ zssz2006, 5964 author = {H. Zhang and B. Smith and M. Sternberg and P. Zapol}, 5965 title = {{SIPs}: Shift-and-Invert Parallel Spectral Transformations}, 5966 journal = {TOMS}, 5967 url = {http://math.nist.gov/toms/Current.html#v33n2}, 5968 volumne = {33}, 5969 number = {2}, 5970 year = {2007}, 5971 petsc_uses = {KSP} 5972} 5973 5974@Article{ gs2006, 5975 author = {Fang Jin and Nivedita R. Gupta and Kathleen J. Stebe}, 5976 title = {The detachment of a viscous drop in a viscous solution in the presence of a 5977 soluble surfactant}, 5978 journal = {Phys. Fluids}, 5979 volume = {18}, 5980 year = {2006}, 5981 url = {http://scitation.aip.org/dbt/dbt.jsp?KEY=PHFLE6&Volume=LASTVOL&Issue=LASTISS}, 5982 petsc_uses = {KSP} 5983} 5984 5985@Article{ jmemsci, 5986 author = {Bo Zhou and Adam Powell}, 5987 title = {Phase Field Simulations of Liquid-Liquid Demixing During Immersion Precipitation 5988 of Polymeric Membranes in 2D and 3D}, 5989 journal = {J. Membrane Sci.}, 5990 volume = {268}, 5991 number = {2}, 5992 pages = {150--164}, 5993 year = {2006}, 5994 month = jan, 5995 day = {15}, 5996 doi = {10.1016/j.memsci.2005.05.030}, 5997 petsc_uses = {KSP} 5998} 5999 6000@InProceedings{ vbde2002, 6001 author = {Anke Veser and Wolfgang Breitung and Sergey Dorofeev and Alexander Efimenko}, 6002 title = {Flame Acceleration Distance in Obstacle-Laden Tubes}, 6003 booktitle = {Proceedings of the NINTH INTERNATIONAL CONFERENCE ON NUMERICAL COMBUSTION}, 6004 url = {http://web.ing.unisannio.it/icnc2002/CP21Turbulent_Combustion-Deflagrations_Jets_&_Fires.pdf}, 6005 year = {2002}, 6006 petsc_uses = {KSP} 6007} 6008 6009@InProceedings{ wid2005, 6010 author = {Alexander I. Bobenko and Peter Schrader}, 6011 title = {Discrete Willmore Flow}, 6012 booktitle = {Eurographics Symposium on Geometry Processing}, 6013 url = {http://www.math.tu-berlin.de/\~{ }bobenko/Papers/Willmore.pdf}, 6014 year = {2005}, 6015 editor = {M. Desbrun and H. Pottmann}, 6016 petsc_uses = {KSP} 6017} 6018 6019@Article{ stj2003, 6020 author = {A. Scascighini and A. Troxler and R. Jeltsch}, 6021 journal = {International Journal for Numerical Methods in Fluids}, 6022 volume = {41}, 6023 issue = {4}, 6024 title = {A numerical method for inverse design based on the inverse Euler equations}, 6025 year = {2003}, 6026 pages = {339--355}, 6027 url = {http://www3.interscience.wiley.com/cgi-bin/abstract/102521480/ABSTRACT}, 6028 petsc_uses = {KSP} 6029} 6030 6031@PhDThesis{ as2001, 6032 author = {ANDREA SCASCIGHINI}, 6033 title = {A Numerical Method for the Design of Internal Flow Configurations Based on the 6034 Inverse Euler Equations}, 6035 school = {SWISS FEDERAL INSTITUTE OF TECHNOLOGY, ZURICH}, 6036 year = {2001}, 6037 url = {http://www.sam.math.ethz.ch/\~{ }andrea/}, 6038 petsc_uses = {KSP} 6039} 6040 6041@Article{ hb2005, 6042 author = {E. McKay Hyde and Oscar P. Bruno}, 6043 journal = {Journal of Computational Physics}, 6044 volume = {202}, 6045 title = {A fast, higher-order solver for scattering by penetrable bodies in three 6046 dimensions}, 6047 year = {2005}, 6048 pages = {236--261}, 6049 url = {http://www.acm.caltech.edu/\~{ }bruno/hyde_bruno_3d_jcp.pdf}, 6050 petsc_uses = {KSP} 6051} 6052 6053@MastersThesis{ d2002, 6054 author = {Matthew F Dixon}, 6055 title = {PARALLEL SOLUTION OF HIGH ORDER FINITE DIFFERENCE SCHEMES FOR PRICING 6056 MULTI-DIMENSIONAL AMERICAN OPTIONS}, 6057 school = {READING UNIVERSITY}, 6058 year = {2002}, 6059 url = {http://www.ma.ic.ac.uk/\~{ }mdixion/papers/MScThesis.pdf.gz}, 6060 petsc_uses = {KSP} 6061} 6062 6063@TechReport{ gzb, 6064 author = {David Gleich and Leonid Zhukov and Pavel Berkhin}, 6065 title = {Fast Parallel PageRank: A Linear System Approach}, 6066 institution = {Stanford University}, 6067 year = {2004}, 6068 url = {http://www.gg.caltech.edu/\~{ }zhukov/papers/ParallelPageRank-paper.pdf}, 6069 petsc_uses = {KSP} 6070} 6071 6072@PhDThesis{ yergeau-99, 6073 author = {Daniel W. Yergeau}, 6074 title = {A DIAL-AN-OPERATOR APPROACH TO SIMULATION OF IMPURITY DIFFUSION IN 6075 SEMICONDUCTORS}, 6076 school = {Stanford}, 6077 year = {1999}, 6078 url = {http://www-tcad.stanford.edu/tcad/pubs/theses/yergeau.pdf}, 6079 petsc_uses = {KSP} 6080} 6081 6082@InProceedings{ rathkopf-miller-00, 6083 author = {J.A. Rathkopf and D.S. Miller and J.M. Owen and L.M. Stuart and M.R. Zika and 6084 P.G. Eltgroth and N.K. Madsen and K.P. McCandless and P.F. Nowak and M.K. Nemanic 6085 and N.A. Gentile and N.D. Keen and T.S. Palmer}, 6086 title = {{KULL}: {LLNL}'s {ASCI} Inertial Confinement Fusion Simulation Code}, 6087 year = {2000}, 6088 booktitle = {Physor 2000 American Nuclear Society Topical Meeting on Advances in Reactor 6089 Physics and Mathematics and Computation into the Next Millennium}, 6090 url = {http://www.llnl.gov/tid/lof/documents/pdf/237860.pdf}, 6091 lab = {LLNL}, 6092 petsc_uses = {KSP} 6093} 6094 6095@Article{ bonfi-palma-pas-05, 6096 author = {A. Bonfiglioli and P. De Palma and G. Pascazio and M. Napolitano}, 6097 journal = {Journal of Turbomachinery}, 6098 volume = {127}, 6099 title = {An Implicit Fluctuation Splitting Scheme for Turbomachinery Flows}, 6100 year = {2005}, 6101 pages = {395-401}, 6102 petsc_uses = {KSP} 6103} 6104 6105@InProceedings{ fettig-sobh-05, 6106 author = {John Fettig and Nahil Sobh and Dmitriy V. Melnikov and Jean-Pierre Leburton}, 6107 title = {High Performance Algorithms for Scalable Spin-Qubit Circuits with Quantum Dots}, 6108 year = {2005}, 6109 booktitle = {Proceedings of the 5th International Conference on Linux Clusters}, 6110 url = {http://www.linuxclustersinstitute.org/Linux-HPC-Revolution/Archive/PDF05/28-Fettig_J.pdf}, 6111 petsc_uses = {KSP} 6112} 6113 6114@TechReport{ melnikov-matagne-05, 6115 author = {Dmitriy V. Melnikov and Philippe Matagne and Jean-Pierre Leburton and D.G. 6116 Austing and G. Yu and S. Tarucha and John Fettig and Nahil Sobh}, 6117 title = {Spin configurations in circular and rectangular vertical quantum dots in a 6118 magnetic field: Three-dimensional self-consistent simulation}, 6119 year = {2005}, 6120 number = {Arxiv preprint cond-mat/0506585}, 6121 url = {http://arxiv.org/pdf/cond-mat/0506585}, 6122 petsc_uses = {KSP} 6123} 6124 6125@InProceedings{ richard-smedley-03, 6126 author = {Richard P. Smedley-Stevenson}, 6127 title = {PARALLEL THERMAL RADIATION TRANSPORT IN TWO DIMENSIONS}, 6128 year = {2003}, 6129 booktitle = {18th International Conference on Transport Theory (18 ICTT)}, 6130 url = {http://www.iprj.uerj.br/\~{ }ricardob/Evento_Cientifico_html/poster03j.pdf}, 6131 petsc_uses = {KSP} 6132} 6133 6134@Article{ guan-godoy-ravaioli-03, 6135 author = {D. Guan and A. Godoy and U. Ravaioli and F. Gamiz}, 6136 journal = {Journal of Computational Electronics}, 6137 volume = {2}, 6138 title = {Comparison Between Non-Equilibrium Green's Function and Monte Carlo Simulations 6139 for Transport in a Silicon Quantum Wire Structure}, 6140 year = {2003}, 6141 pages = {335--339}, 6142 petsc_uses = {KSP} 6143} 6144 6145@Article{ ovtchinnikovcai04, 6146 author = {S. Ovtchinnikov and X.-C. Cai}, 6147 journal = {Numer. Lin. Alg. Applics}, 6148 volume = {11}, 6149 title = {One-level Newton-Krylov-Schwarz algorithm for unsteady nonlinear radiation 6150 diffusion problem}, 6151 year = {2004}, 6152 pages = {867--881}, 6153 petsc_uses = {KSP} 6154} 6155 6156@Article{ mixedstress, 6157 title = {Floating Solids: Combining Phase Field and Fluid-Structure Interactions}, 6158 author = {Adam Powell and David Dussault}, 6159 journal = {Appl. Numer. Anal. Comp. Math.}, 6160 volume = {2}, 6161 number = {1}, 6162 year = {2005}, 6163 pages = {157--166}, 6164 petsc_uses = {KSP} 6165} 6166 6167@Article{ dhh2005, 6168 author = {G. Deli\'ege and F. Henrotte and K. Hameyer}, 6169 title = {Accuracy analysis of the thrust force in 2D-3D finite element models}, 6170 journal = {International Journal for Computation and Mathematics in Electrical and 6171 Electronic Engineering (COMPEL)}, 6172 year = {2005}, 6173 petsc_uses = {KSP} 6174} 6175 6176@Article{ dhh2004, 6177 author = {G. Deli\'ege and F. Henrotte and W. Deprez and K. Hameyer}, 6178 title = {Finite element modelling of ion convection by electrostatic forces}, 6179 journal = {IEE Proceedings Science, Measurement and Technology}, 6180 year = {2004}, 6181 volume = {151}, 6182 number = {6}, 6183 petsc_uses = {KSP} 6184} 6185 6186@Article{ adams-07b, 6187 author = {Adams M.F.}, 6188 title = {Algebraic Multigrid Techniques for Strongly Indefinite Linear Systems from Direct 6189 Frequency Response Analysis in Solid Mechanics}, 6190 journal = {Computional Mechanics}, 6191 year = {2007}, 6192 volume = {39}, 6193 number = {4}, 6194 pages = {497-507}, 6195 petsc_uses = {KSP} 6196} 6197 6198@InProceedings{ wc2004, 6199 author = {A. Wheelock and D. Cooke}, 6200 title = {Computational Modeling of Ion Beam-Neutralizer Interactions in Two and Three 6201 Dimensions}, 6202 year = {2004}, 6203 booktitle = {40th AIAA/ASME/SAE/ASEE Joint Propulsion Conference and Exhibit}, 6204 url = {http://www.aiaa.org/content.cfm?pageid=406&gTable=Paper&gID=19282}, 6205 petsc_uses = {KSP} 6206} 6207 6208@InProceedings{ allard-gouranton-ipts2002, 6209 author = {Jeremie Allard and Valerie Gouranton and Emmanuel Melin and Bruno Raffin}, 6210 title = {Parallelizing Pre-rendering Computations on a Net Juggler PC Cluster}, 6211 year = {2002}, 6212 booktitle = {Immersive Projection Technology Symposium}, 6213 url = {http://www-id.imag.fr/\~{ }allardj/files/ipts2002.pdf}, 6214 petsc_uses = {KSP} 6215} 6216 6217@Article{ icc, 6218 author = {D Ioan and G Ciuprina and C Ciobotaru}, 6219 title = {Hybrid and concurrent algorithms for nonlinear magnetic field problems}, 6220 journal = {IEEE Transactions on Magnetics}, 6221 year = {2000}, 6222 url = {http://ieeexplore.ieee.org/Xplore/login.jsp?url=/iel5/20/19005/00877735.pdf}, 6223 petsc_uses = {KSP} 6224} 6225 6226@InProceedings{ hs1, 6227 author = {Brian J. Henz and Dale R. Shires}, 6228 title = {Development and Performance Analysis of a Parallel Finite Element Application 6229 Implemented in an Object-Oriented Programming Framework}, 6230 year = {2003}, 6231 booktitle = {PDPTA 2003}, 6232 pages = {1286-1292}, 6233 note = {Resin Transfer Modeling}, 6234 petsc_uses = {KSP} 6235} 6236 6237@TechReport{ b2000, 6238 author = {Rickard Bergstrom}, 6239 title = {Least-Squares Finite Element Methods for Electromagnetic Applications}, 6240 year = {2000}, 6241 institution = {Chalmers}, 6242 number = {2000-05}, 6243 url = {http://www.phi.chalmers.se/pub/preprints/ps/phiprint-2000-05.ps}, 6244 petsc_uses = {KSP} 6245} 6246 6247@Article{ fs2004, 6248 author = {Petri Fast and Michael J. Shelley}, 6249 title = {A Moving Overset Grid Method for Interface Dynamics Applied to Non-Newtonian Hele 6250 Shaw Flow}, 6251 journal = {Journal of Computational Physics}, 6252 year = {2004}, 6253 volume = {195}, 6254 url = {http://www.math.nyu.edu/faculty/shelley/papers/FS2004.pdf}, 6255 pages = {117-142}, 6256 petsc_uses = {KSP} 6257} 6258 6259@MastersThesis{ wallach, 6260 author = {Hanna Wallach}, 6261 title = {Efficient Training of Conditional Random Fields}, 6262 school = {University of Edinburgh}, 6263 year = {2002}, 6264 url = {http://scholar.google.com/url?sa=U&q=http://www.hcrc.ed.ac.uk/\~{ 6265 }osborne/msc-projects/wallach.ps.gz}, 6266 petsc_uses = {KSP} 6267} 6268 6269@Article{ something, 6270 author = {T Rylander and A Bondeson}, 6271 title = {Stability of explicit-implicit hybrid time-stepping schemes for Maxwells 6272 equations}, 6273 journal = {Journal of Computational Physics}, 6274 year = {2002}, 6275 volume = {179}, 6276 pages = {426-438}, 6277 petsc_uses = {KSP} 6278} 6279 6280@TechReport{ uf1, 6281 author = {Uwe Fabricius}, 6282 title = {Comparison of two implementations of AMG-preconditioned CG considering an 6283 electrostatic problem}, 6284 year = {2004}, 6285 institution = {Friedrich Alexander Universitat Erlangen Nurnberg Germany}, 6286 url = {http://www10.informatik.uni-erlangen.de/de/Publications/TechnicalReports/TechRep04-1.pdf}, 6287 number = {04-1}, 6288 petsc_uses = {KSP} 6289} 6290 6291@InBook{ sg1, 6292 author = {Natalia Seoane and A.J.Garca-Loureiro}, 6293 chapter = {Analysis of Parallel Numerical Libraries to Solve the 3D Electron Continuity 6294 Equation}, 6295 url = {http://www.springerlink.com/app/home/contribution.asp?wasp=h0xlulyhugck3y2gnt2l&referrer=parent&backto=issue,79,112;journal,212,1787;linkingpublicationresults,1:105633,1}, 6296 title = {Lecture Notes in Computer Science}, 6297 publisher = {Springer-Verlag}, 6298 volume = {3037}, 6299 year = {2004}, 6300 petsc_uses = {KSP} 6301} 6302 6303@Article{ nikyilmazgivisheikhipope10, 6304 author = {M. B. Nik and S. L. Yilmaz and P. Givi and M. R. H. Sheikhi and S. B. Pope}, 6305 title = {Simulation of Sandia Flame D Using Velocity-Scalar Filtered Density Function}, 6306 journal = {AIAA Journal}, 6307 volume = {48}, 6308 number = {7}, 6309 pages = {1513--1522}, 6310 year = {2010}, 6311 petsc_uses = {KSP} 6312} 6313 6314@Article{ nikyilmazsheikhigivi10, 6315 author = {Mehdi B. Nik and Server L. Yilmaz and Mohammad Reza H. Sheikhi and Peyman Givi}, 6316 title = {Grid Resolution Effects on VSFMDF/LES}, 6317 journal = {Flow, Turbulence and Combustion}, 6318 doi = {10.1007/s10494-010-9272-5}, 6319 year = {2010}, 6320 petsc_uses = {KSP} 6321} 6322 6323@Article{ idema2013towards, 6324 title = {Towards faster solution of large power flow problems}, 6325 author = {Idema, Reijer and Papaefthymiou, Georgios and Lahaye, Domenico and Vuik, Cornelis 6326 and van der Sluis, Lou}, 6327 journal = {Power Systems, IEEE Transactions on}, 6328 volume = {28}, 6329 number = {4}, 6330 pages = {4918--4925}, 6331 year = {2013}, 6332 publisher = {IEEE}, 6333 petsc_uses = {KSP} 6334} 6335 6336@Article{ 6026245, 6337 author = {Idema, R. and Lahaye, D.J.P. and Vuik, C. and Van der Sluis, L.}, 6338 journal = {Power Systems, IEEE Transactions on}, 6339 title = {Scalable Newton-Krylov Solver for Very Large Power Flow Problems}, 6340 year = {2012}, 6341 month = feb, 6342 volume = {27}, 6343 number = {1}, 6344 pages = {390-396}, 6345 doi = {10.1109/TPWRS.2011.2165860}, 6346 issn = {0885-8950}, 6347 petsc_uses = {KSP} 6348} 6349 6350@Book{ idema2014computational, 6351 title = {Computational Methods in Power System Analysis}, 6352 author = {Idema, Reijer and Lahaye, Domenico JP}, 6353 year = {2014}, 6354 publisher = {Springer}, 6355 petsc_uses = {KSP} 6356} 6357 6358@PhDThesis{ abhyankar2011thesis, 6359 author = {Shrirang Abhyankar}, 6360 title = {Development of an implicitly coupled electromechanical and electromagnetic 6361 transients simulator for power systems}, 6362 school = {Illinois Institute of Technology}, 6363 year = {2011}, 6364 petsc_uses = {KSP} 6365} 6366 6367@InProceedings{ abhyankarhipcna11-1, 6368 author = {Shrirang Abhyankar and Barry Smith and Hong Zhang and A. Flueck}, 6369 title = {Using {PETSc} to develop scalable applications for next-generation power grid}, 6370 year = {2011}, 6371 booktitle = {Proceedings of the 1st International Workshop on High Performance Computing, 6372 Networking and Analytics for the Power Grid}, 6373 url = {http://www.mcs.anl.gov/uploads/cels/papers/P1957-0911.pdf}, 6374 publisher = {ACM}, 6375 petsc_uses = {KSP} 6376} 6377 6378@InProceedings{ abhyankarhipcna11-2, 6379 author = {Shrirang Abhyankar and Alexander Flueck and Xu Zhang and Hong Zhang}, 6380 title = {Development of a parallel three-phase transient stability simulator for power 6381 systems}, 6382 year = {2011}, 6383 booktitle = {Proceedings of the 1st International Workshop on High Performance Computing, 6384 Networking and Analytics for the Power Grid}, 6385 publisher = {ACM}, 6386 petsc_uses = {KSP} 6387} 6388 6389@InProceedings{ abhyankarpesgeneral2012, 6390 author = {Shrirang Abhyankar and A. Flueck}, 6391 title = {An implicitly-coupled solution approach for combined electromechanical and 6392 electromagnetic transients simulation}, 6393 year = {2012}, 6394 booktitle = {Proceedings of the IEEE PES General Meeting}, 6395 publisher = {IEEE}, 6396 petsc_uses = {KSP} 6397} 6398 6399@Article{ idemalahayevuiksluis2012, 6400 author = {Reijer Idema and Domenico Lahaye and Cornelis Vuik and Lou van der Sluis}, 6401 title = {Scalable Newton-Krylov solver for very large Power Flow problems}, 6402 journal = {IEEE Transactions on Power Systems}, 6403 year = {2012}, 6404 volume = {27}, 6405 pages = {390-396}, 6406 petsc_uses = {KSP} 6407} 6408 6409@Article{ korrestzavellasgalinas2013, 6410 author = {George N. Korres and Anastasios Tzavellas and Evangelos Galinas}, 6411 title = {A distributed implementation of multi-area power system state estimation on a 6412 cluster of computers }, 6413 journal = {Electric Power Systems Research }, 6414 volume = {102}, 6415 number = {0}, 6416 pages = {20 - 32}, 6417 year = {2013}, 6418 issn = {0378-7796}, 6419 doi = {10.1016/j.epsr.2013.04.002}, 6420 petsc_uses = {KSP} 6421} 6422 6423% LiteralHTML: <td width="100%" colspan="2"><hr size="4" color="#FF5B5B"> </td> 6424% LiteralHTML:<font color="#FF0000"> 6425% LiteralHTML: Material failure, for example, cracking of steel beams resulting 6426% LiteralHTML: in bridge collapse and corrosion, is a little understood phenomena. Thus simulations 6427% LiteralHTML: are important for prediction and prevention. PETSc has been used 6428% LiteralHTML: in a variety of studies of material failure.</p> 6429% LiteralHTML:</font> 6430% LiteralHTML: 6431@InProceedings{ gray2, 6432 author = {Yuan He and Joshua Gray and Richard Braatz and Richard Alkire}, 6433 title = {Modulized Coupled Simulation of Localized Pit Initiation in Stainless Steel}, 6434 year = {2004}, 6435 booktitle = {American Institute of Chemical Engineers 2004 Annual Meeting}, 6436 petsc_uses = {KSP} 6437} 6438 6439@InProceedings{ gray1, 6440 author = {J. Gray and and C. Homescu and L. Petzold and Richard Alkire}, 6441 title = {Algorithms and Computing Architectures for Solving Differential-Algebraic 6442 Equation Systems Typically Encountered in Models of Corrosion Pit Initiation}, 6443 year = {2003}, 6444 booktitle = {Abstracts of the Electrochemical Society 204th meeting}, 6445 petsc_uses = {KSP} 6446} 6447 6448@InProceedings{ crack2, 6449 author = {Erin Lesulauro and Anthony R. Ingraffea and Gerd Heber and Paul A. Wawrzynek}, 6450 title = {A multiscale modeling approach to crack initiation in metallic polycrystals}, 6451 booktitle = {44th AIAA/ASME/ASCE/AHS/ASC Structures, Structural Dynamics, and Materials 6452 Conference}, 6453 url = {http://md1.csa.com/partners/viewrecord.php?requester=gs&collection=TRD&recid=A0325099AH}, 6454 year = {2003}, 6455 petsc_uses = {KSP} 6456} 6457 6458@TechReport{ hdams1, 6459 author = {Gerd Heber and Andrew J. Dolgert and Maxirn Alt and Karen A. Mazurkiewicz and 6460 Lynd Stringer}, 6461 title = {Fracture Mechanics on the Intel Itanium Architecture}, 6462 year = {2001}, 6463 institution = {Intel Corporation}, 6464 url = {http://cedar.intel.com/media/pdf/scs/cptconitanium.pdf}, 6465 petsc_uses = {KSP} 6466} 6467 6468@InProceedings{ ihwi, 6469 author = {E. Iesulauro and G. Heber and P. A. Wawrzynek and A. R. Ingraffea}, 6470 title = {Modeling of 3D Metallic Polycrystals and Simulation of Crack Initiation}, 6471 booktitle = {International Conference ON Computational Engineering and Sciences}, 6472 year = {2002}, 6473 url = {http://www.cfg.cornell.edu/\~{ }erin/erin/ices02_iesulauro.pdf}, 6474 petsc_uses = {KSP} 6475} 6476 6477@InProceedings{ crack, 6478 author = {Bruce Carter and Chuin-Shan Chen and L. Paul Chew and Nikos Chrisochoides and 6479 Guang R. Gao and Gerd Heber and Antony R. Ingraffea and Roland Krause and Chris 6480 Myers and Demian Nave and Keshav Pingali and Paul Stodghill and Stephen Vavasis 6481 and Paul A. Wawrzynek}, 6482 title = {Parallel FEM Simulation of Crack Propagation}, 6483 booktitle = {Proceedings of Irregular 2000}, 6484 url = {http://www.cs.cornell.edu/stodghil/papers/irregular00.ps}, 6485 year = {2000}, 6486 petsc_uses = {KSP} 6487} 6488 6489@InProceedings{ beaudoin98, 6490 author = {A. J. Beaudoin}, 6491 title = {Use of Polycrystal Plasticity Theory in Assessing Material Performance}, 6492 booktitle = {Simulation of materials processing: Theory, methods, and applications - 6493 Proceedings of the Sixth International Conference, NUMIFORM'98}, 6494 editor = {J. Hu\'etink and F. P. T. Baaijens}, 6495 optvolume = {}, 6496 optnumber = {}, 6497 optseries = {}, 6498 year = {1998}, 6499 optorganization={}, 6500 publisher = {A. A. Balkema Publishers}, 6501 address = {Rotterdam, Netherlands}, 6502 month = jun, 6503 optpages = {}, 6504 petsc_uses = {KSP} 6505} 6506 6507% LiteralHTML: <td width="100%" colspan="2"><hr size="4" color="#FF5B5B"> </td> 6508@TechReport{ defordheld1, 6509 author = {JF DeFord and BL Held}, 6510 title = {RF3P-A New Parallel Driven Frequency Electromagnetic Solver}, 6511 year = {2002}, 6512 institution = {Simulation Technology and Applied Research}, 6513 url = {http://www.staarinc.com/support/papers/aces2002.pdf}, 6514 note = {Discusses their parallel commercial solver that uses PETSc}, 6515 petsc_uses = {KSP} 6516} 6517 6518@PhDThesis{ sande2003, 6519 author = {Hans Vande Sande}, 6520 title = {Modelling and Finite Element Simulation of Non-Linear and Anisotropic 6521 Quasi-Static Electromagnetic Systems}, 6522 school = {Katholieke Universiteit Leuven, Belgium}, 6523 year = {2003}, 6524 petsc_uses = {KSP} 6525} 6526 6527@Article{ sdchh2004, 6528 author = {H. Vande Sande and W. Deprez and J. De Coster and F. Henrotte and K. Hameyer}, 6529 title = {Reducing the Computation Time of Non-Linear Problems by an Adaptive Linear System 6530 Tolerance}, 6531 journal = {IEEE Transactions on Magnetics}, 6532 year = {2004}, 6533 volume = {40}, 6534 pages = {1306--1309}, 6535 petsc_uses = {KSP} 6536} 6537 6538@Article{ holst-lindblom-etal:2004, 6539 author = {Michael Holst and Lee Lindblom and Robert Owen and Harald P. Pfeiffer and Mark A. 6540 Scheel and Lawrence E. Kidder}, 6541 title = {Optimal constraint projection for hyperbolic evolution systems, }, 6542 journal = {Phys. Rev. D}, 6543 year = {2004}, 6544 volume = {70}, 6545 pages = {084017}, 6546 petsc_uses = {KSP} 6547} 6548 6549@Article{ marm2005, 6550 author = {Matthew Anderson and Richard A. Matzner}, 6551 title = {Extended Lifetime in Computational Evolution of Isolated Black Holes}, 6552 journal = {Foundations of Physics}, 6553 volume = {35}, 6554 pages = {1572--9516}, 6555 year = {2005}, 6556 petsc_uses = {KSP} 6557} 6558 6559@Article{ cook-pfeiffer:2004, 6560 author = {Cook, Gregory B. and Pfeiffer, Harald P.}, 6561 title = {Excision boundary conditions for black hole initial data}, 6562 journal = {Phys. Rev. D}, 6563 volume = {70}, 6564 pages = {104016--24}, 6565 year = {2004}, 6566 petsc_uses = {KSP} 6567} 6568 6569@Article{ pfeiffer-kidder-etal:2005, 6570 author = {Harald P. Pfeiffer and Lawrence E. Kidder and Mark A. Scheel and Deirdre 6571 Shoemaker}, 6572 title = {Initial data for {E}instein's equations with superposed gravitational waves}, 6573 journal = {Phys. Rev. D}, 6574 year = {2005}, 6575 volume = {71}, 6576 pages = {024020}, 6577 petsc_uses = {KSP} 6578} 6579 6580@Article{ pfeiffer-kidder-etal:2003, 6581 author = {Pfeiffer, Harald P. and Kidder, Lawrence E. and Scheel, Mark A. and Teukolsky, 6582 Saul A.}, 6583 title = {A multidomain spectral method for solving elliptic equations}, 6584 journal = {CPC}, 6585 year = {2003}, 6586 volume = {152}, 6587 pages = {253--273}, 6588 note = {Solves nonlinear coupled 3-D elliptic equations that arise in general relativity. 6589 For a related online version, see arXiv:gr-qc/0202096}, 6590 petsc_uses = {KSP} 6591} 6592 6593@Article{ pfeiffer-cook-teukolsky:2002, 6594 author = {Pfeiffer, Harald P. and Cook, Gregory B. and Teukolsky, Saul A.}, 6595 title = {Comparing initial-data sets for binary black hole}, 6596 journal = {PRD}, 6597 year = {2002}, 6598 volume = {66}, 6599 pages = {024047}, 6600 note = {for a related online version, seearXiv:gr-qc/0203085}, 6601 petsc_uses = {KSP} 6602} 6603 6604@PhDThesis{ pfeiffer:2003, 6605 author = {Pfeiffer, Harald P.}, 6606 title = {Initial Data for Black Hole Evolutions}, 6607 school = {Cornell University}, 6608 year = {2003}, 6609 petsc_uses = {KSP} 6610} 6611 6612@TechReport{ h1, 6613 author = {Erik Schnetter}, 6614 title = {A fast apparent horizon algorithm}, 6615 year = {2002}, 6616 number = {Arxiv preprint gr-qc/0206003}, 6617 url = {http://arxiv.org/pdf/gr-qc/0206003}, 6618 petsc_uses = {KSP} 6619} 6620 6621@Article{ h2, 6622 author = {Erik Schnetter}, 6623 title = {Finding apparent horizons and other 2-surfaces of constant expansion}, 6624 year = {2003}, 6625 journal = {Class. Quantum Grav.}, 6626 pages = {4719-4737}, 6627 volume = {20}, 6628 url = {http://www.iop.org/EJ/article/0264-9381/20/22/001/cqg3_22_001.pdf}, 6629 petsc_uses = {KSP} 6630} 6631 6632@Article{ adams-03a, 6633 author = {Adams, M.~F.}, 6634 journal = {Numerical Linear Algebra with Applications}, 6635 number = {2-3}, 6636 pages = {141-153}, 6637 title = {Algebraic multigrid methods for constrained linear systems with applications to 6638 contact problems in solid mechanics}, 6639 volume = {11}, 6640 year = {2004}, 6641 petsc_uses = {KSP} 6642} 6643 6644@Article{ vandesande1, 6645 author = {H. Vande Sande and H. De Gersem and F. Henrotte and K. Hameyer}, 6646 journal = {IEEE TRANSACTIONS ON MAGNETICS}, 6647 year = {2003}, 6648 volume = {39}, 6649 pages = {1709--1712}, 6650 title = {Solving Nonlinear Magnetic Problems Using Newton Trust Region Methods}, 6651 petsc_uses = {KSP} 6652} 6653 6654@InProceedings{ vbde1, 6655 author = {Rajesh Rawat and Jennifer P. Spinti and Wing Yee and Philip J. Smith}, 6656 year = {2002}, 6657 title = {Parallelization and Integration of a Large Scale Hydrocarbon Pool Fire in the 6658 Uintah PSE}, 6659 booktitle = {In Proceedings of Ninth Internation Conference on Numerical Combustion - ICNC 6660 2002}, 6661 pages = {49-55}, 6662 url = {http://web.ing.unisannio.it/icnc2002/CP21Turbulent_Combustion-Deflagrations_Jets_&_Fires.pdf}, 6663 note = {Extended abstract}, 6664 petsc_uses = {KSP} 6665} 6666 6667@Unpublished{ ep1, 6668 title = {An Inherently-Parallel Method for Solving Discretized Diffusion Equations}, 6669 author = {Bradley R. Eccleston and Todd S. Palmer}, 6670 institution = {Department of Nuclear Engineering, Oregon State University}, 6671 url = {http://www.physics.orst.edu/\~{ }bertrand/stuff/Year_Two_Report.pdf}, 6672 note = {Funded under the ASCI Level III: Computational Transport Issues for Large-Scale 6673 Parallel Simulations}, 6674 year = {1999}, 6675 petsc_uses = {KSP} 6676} 6677 6678@InProceedings{ teo2007scalable, 6679 title = {A scalable modular convex solver for regularized risk minimization}, 6680 author = {Teo, C.H. and Smola, A. and Vishwanathan, SVN and Le, Q.V.}, 6681 booktitle = {Proceedings of the 13th ACM SIGKDD international conference on Knowledge 6682 discovery and data mining}, 6683 pages = {727--736}, 6684 year = {2007}, 6685 organization = {ACM}, 6686 petsc_uses = {KSP} 6687} 6688 6689@InProceedings{ rm02, 6690 author = {Robert Malouf}, 6691 year = {2002}, 6692 title = {A comparison of algorithms for maximum entropy Parameter estimation}, 6693 booktitle = {In Proceedings of the Sixth Conference on Natural Language Learning 6694 (CoNLL-2002)}, 6695 pages = {49-55}, 6696 url = {http://bulba.sdsu.edu/malouf/papers/conll02.pdf}, 6697 petsc_uses = {KSP} 6698} 6699 6700@Unpublished{ hrv02, 6701 title = {Computing the Lambda Modes of a Nuclear Reactor with {SLEPc} and {PETSc}}, 6702 author = {V. Hernandex and J. E. Roman and V. Vidal}, 6703 note = {Submitted to CMMSE}, 6704 petsc_uses = {KSP} 6705} 6706 6707@Article{ tmh2001, 6708 author = {Manfred Gilli and Evis Kellezi and Giorgio Pauletto}, 6709 journal = {Journal of Economic Dynamics and Control}, 6710 year = {2002}, 6711 volume = {26}, 6712 pages = {1499-1515}, 6713 title = {Solving finite difference schemes arising in trivariate option pricing}, 6714 petsc_uses = {KSP} 6715} 6716 6717@InProceedings{ a2, 6718 author = {C.J.Palansuriya and C-H.Lai and C.S.Ierotheou and K.A.Pericleous and D.E.Keyes}, 6719 title = {Comparison of three algorithms for nonlinear metal cutting problems}, 6720 booktitle = {Proceedings of the 11th International Conference on Domain Decomposition 6721 Methods}, 6722 editor = {C.-H. Lai et al.}, 6723 publisher = {Domain Decomposition Press, Bergen}, 6724 url = {http://www.ddm.org/DD11/Palansuriya.ps.gz}, 6725 year = {1999}, 6726 petsc_uses = {KSP} 6727} 6728 6729@Unpublished{ mmmdcmaa-web-page, 6730 title = {{M}ulti-{M}odel {M}ulti-{D}omain {C}omputational {M}ethods in {A}erodynamics and 6731 {A}coustics {W}eb Page}, 6732 url = {http://www.cs.odu.edu/\~{ }keyes/nsf}, 6733 author = {David E. Keyes}, 6734 institution = {Old Dominion University}, 6735 petsc_uses = {KSP} 6736} 6737 6738@Conference{ liu2010parallelization, 6739 title = {{Parallelization of Thermal Recovery Simulation Based on PETSc}}, 6740 author = {Liu, L. and Xue, W. and Shu, J. and Ma, L.}, 6741 booktitle = {International Symposium on Parallel and Distributed Processing with 6742 Applications}, 6743 pages = {528--535}, 6744 year = {2010}, 6745 organization = {IEEE}, 6746 petsc_uses = {KSP} 6747} 6748 6749@Unpublished{ oil-reservoir-sim-web-page, 6750 title = {{N}ew {G}eneration {F}ramework for {P}etroleum, {R}eservoir {S}imulation}, 6751 url = {http://www.pe.utexas.edu/CPGE/new_generation}, 6752 institution = {University of Texas at Austin and Argonne National Laboratory}, 6753 key = {University of Texas at Austin and Argonne National Laboratory}, 6754 petsc_uses = {KSP} 6755} 6756 6757@Article{ tmh2001b, 6758 author = {V. Thiagarajan and K. Milfeld and KT. Milfeld}, 6759 journal = {IEEE TRANSACTIONS ON MAGNETICS }, 6760 year = {2001}, 6761 volume = {37}, 6762 pages = {143--146}, 6763 title = {Adapting EMAP3D to parallel processing}, 6764 petsc_uses = {KSP} 6765} 6766 6767@Article{ harbury98, 6768 author = {HK Harbury and W Porod}, 6769 journal = {VLSI Design}, 6770 year = {1998}, 6771 volume = {6}, 6772 pages = {47--51}, 6773 title = {Parallel computation for electronic waves in quantum corrals}, 6774 petsc_uses = {KSP} 6775} 6776 6777@Article{ bludszuwei98, 6778 author = {Mark Bludszuweit}, 6779 journal = {Journal of Lightwave Technology}, 6780 year = {1998}, 6781 volume = {16}, 6782 number = {7}, 6783 pages = {1336--42}, 6784 title = {Mixed Finite Element Beam Propagation Method}, 6785 petsc_uses = {KSP} 6786} 6787 6788@Article{ s1, 6789 author = {J. L. Friedman and N. Stergioulas}, 6790 journal = {Astrophysics Journal}, 6791 year = {1998}, 6792 volume = {492}, 6793 number = {301}, 6794 pages = {}, 6795 title = {}, 6796 petsc_uses = {KSP} 6797} 6798 6799@Article{ s1a, 6800 author = {S. M. Morsink and N. Stergioulas and S. Blattnig}, 6801 journal = {Astrophysics Journal}, 6802 year = {1999}, 6803 volume = {510}, 6804 number = {854}, 6805 pages = {}, 6806 title = {}, 6807 petsc_uses = {KSP} 6808} 6809 6810@PhDThesis{ s2, 6811 author = {N. Stergioulas}, 6812 title = {Ph. D. thesis}, 6813 year = {1996}, 6814 institution = {University of Wisconsin-Milwaukee}, 6815 petsc_uses = {KSP} 6816} 6817 6818@InProceedings{ coral1, 6819 author = {L. Kettunen and K. Forsman and D. Levine and W. Gropp}, 6820 title = {Solutions of TEAM Problem \#13 Using Integral Equations in a Sequential and 6821 Parallel Computing Environment}, 6822 booktitle = {Proceedings of the Miami TEAM Workshop}, 6823 location = {Florida International University, Department of Electrical Engineering and 6824 Computing Science}, 6825 month = nov, 6826 year = {1993}, 6827 petsc_uses = {KSP} 6828} 6829 6830@InProceedings{ coral2, 6831 author = {L. Kettunen and K. Forsman and D. Levine and W. Gropp}, 6832 title = {Solutions of TEAM Problems 13 and 20 Using a Volume Integral Formulation}, 6833 booktitle = {Proceedings of Aix-les-Bains TEAM Workshop}, 6834 month = dec, 6835 year = {1994}, 6836 petsc_uses = {KSP} 6837} 6838 6839@InProceedings{ coral3, 6840 author = {L. Kettunen and K. Forsman and D. Levine and W. Gropp}, 6841 title = {Computational Electromagnetics and Parallel Dense Matrix Computations}, 6842 booktitle = {Proceedings of the SIAM Parallel Processing for Scientific Computing Conference}, 6843 location = {Florida International University, Department of Electrical Engineering and 6844 Computing Science}, 6845 year = {1995}, 6846 petsc_uses = {KSP} 6847} 6848 6849@InProceedings{ mijalkovic, 6850 author = {Slobodan Mijalkovi\'{c}}, 6851 title = {Evaluation of Multigrid as a Solver for Stress Analysis Problems in Semiconductor 6852 Process Simulation}, 6853 booktitle = {Multigrid Methods VI: Proceedings of the Sixth European Multigrid Conference Held 6854 Gent, Belgium, September 27--30, 1999.}, 6855 editor = {Erik Dick, Kris Riemslagh, Jan Vierendeels}, 6856 optvolume = {14}, 6857 optseries = {Lecture Notes in Computational Science and Engineering}, 6858 year = {2000}, 6859 publisher = {Springer}, 6860 address = {Berlin}, 6861 optpages = {179--184}, 6862 petsc_uses = {KSP} 6863} 6864 6865@Article{ bludszuwei98a, 6866 author = {Mark Bludszuweit}, 6867 journal = {Journal of Lightwave Technology}, 6868 year = {1998}, 6869 volume = {16}, 6870 number = {7}, 6871 pages = {1336--42}, 6872 title = {Mixed Finite Element Beam Propagation Method}, 6873 petsc_uses = {KSP} 6874} 6875 6876@Article{ gilli-pauletto-1998, 6877 author = {Manfred Gilli and Giorgio Pauletto}, 6878 title = {Parallel {K}rylov Methods for Econometric Model Simulation}, 6879 journal = {Computational Economics}, 6880 year = {2000}, 6881 volume = {16}, 6882 pages = {173--186}, 6883 petsc_uses = {KSP} 6884} 6885 6886% LiteralHTML: 6887% LiteralHTML: <a name="packages"></a><H3><center>Software Packages that use or interface to PETSc</center></H3> 6888% LiteralHTML: 6889@Article{ collierdalcincalo2013, 6890 title = {{PetIGA}: High-Performance Isogeometric Analysis}, 6891 author = {Nathan Collier and Lisandro Dalcin and Victor M. Calo}, 6892 journal = {arxiv}, 6893 year = {2013}, 6894 number = {1305.4452}, 6895 note = {\url{http://arxiv.org/abs/1305.4452}}, 6896 petsc_uses = {KSP} 6897} 6898 6899@Article{ collierdalcinvignalcortescalo2016, 6900 title = {PetIGA: A framework for high-performance isogeometric analysis}, 6901 author = {Lisandro Dalcin and Nathan Collier and Philippe Vignal and AMA C{\^o}rtes and 6902 Victor M. Calo}, 6903 journal = {Computer Methods in Applied Mechanics and Engineering}, 6904 year = {2016}, 6905 petsc_uses = {KSP} 6906} 6907 6908@Misc{ petiga-web-page, 6909 author = {N. Collier and L. Dalcin and V.M. Calo}, 6910 title = {{PetIGA} {W}eb page}, 6911 url = {https://bitbucket.org/dalcinl/petiga/}, 6912 howpublished = {\url{https://bitbucket.org/dalcinl/petiga/}}, 6913 year = {2014}, 6914 petsc_uses = {KSP} 6915} 6916 6917@Article{ logg07, 6918 author = {Logg, Anders}, 6919 title = {Automating the Finite Element Method}, 6920 journal = {Archives of Computational Methods in Engineering}, 6921 volume = {14}, 6922 number = {2}, 6923 pages = {93-138}, 6924 year = {2007}, 6925 doi = {10.1007/s11831-007-9003-9}, 6926 publisher = {Kluwer Academic Publishers}, 6927 issn = {1134-3060}, 6928 language = {English}, 6929 petsc_uses = {KSP} 6930} 6931 6932@Article{ jezequelcouturierdenis12, 6933 author = {Jezequel, Fabienne and Couturier, Rapha\"el and Denis, Christophe}, 6934 title = {Solving large sparse linear systems in a grid environment: the GREMLINS code 6935 versus the PETSc library}, 6936 journal = {The Journal of Supercomputing}, 6937 volume = {59}, 6938 number = {3}, 6939 pages = {1517-1532}, 6940 year = {2012}, 6941 issn = {0920-8542}, 6942 doi = {10.1007/s11227-011-0563-y}, 6943 publisher = {Springer US}, 6944 keywords = {Asynchronous iterations; Grid computing; Iterative method; Multisplitting method; 6945 Sparse linear solver}, 6946 language = {English}, 6947 petsc_uses = {KSP} 6948} 6949 6950@Unpublished{ feap-web-page, 6951 title = {FEAP: A Finite Element Analysis Program}, 6952 url = {http://www.ce.berkeley.edu/projects/feap/}, 6953 author = {FEAP Team}, 6954 note = {Uses PETSc linear solvers - iterative and direct}, 6955 petsc_uses = {KSP} 6956} 6957 6958@Unpublished{ parpre-web-page, 6959 title = {{ParPre} {W}eb {P}age}, 6960 url = {http://www.cs.utk.edu/\~{ }eijkhout/parpre.html}, 6961 institution = {University of Tennessee}, 6962 author = {Victor Eijkhout}, 6963 note = {This is no longer supported. A set of preconditioners built on PETSc}, 6964 petsc_uses = {KSP} 6965} 6966 6967@Unpublished{ pism, 6968 title = {{PISM}: a Parallel Ice Sheet Model}, 6969 author = {{PISM Team}}, 6970 abstract = {We have developed a numerical model of ice sheets called PISM (a Parallel Ice 6971 Sheet Model). The thickness, temperature, velocity and age of the ice are all 6972 simulated, as is the deformation of the earth underneath the ice. New techniques 6973 for fast ice dynamics, earth deformation, and verification have are included.}, 6974 note = {\url{http://www.pism-docs.org/}}, 6975 petsc_uses = {KSP} 6976} 6977 6978@Unpublished{ oofem, 6979 title = {OOFEM - an object oriented finite element package}, 6980 author = {Borek Patzak}, 6981 url = {http://www.oofem.org}, 6982 petsc_uses = {KSP} 6983} 6984 6985@Unpublished{ dks2openfvm, 6986 title = {OpenFVM - a finite volume based general purpose CFD solver}, 6987 author = {Open source development}, 6988 url = {http://openfvm.sourceforge.net/}, 6989 petsc_uses = {KSP} 6990} 6991 6992@Unpublished{ sundar-2008w, 6993 title = {DENDRO: a parallel geometric multigrid library for trilinear finite elements on 6994 octree meshes}, 6995 author = {H. Sundar and R.S. Sampath and S.S. Adavani and C. Davatzikos and G. Biros}, 6996 institution = {University of Pennsylvania}, 6997 url = {http://www.seas.upenn.edu/~csela/dendro/html/index.html}, 6998 petsc_uses = {KSP} 6999} 7000 7001@Unpublished{ khatiwala07-software, 7002 title = {A computational framework for simulation of biogeochemical tracers in the ocean}, 7003 author = {Khatiwala, S.}, 7004 institution = {Columbia University}, 7005 url = {http://www.ldeo.columbia.edu/\~{ }spk}, 7006 petsc_uses = {KSP} 7007} 7008 7009@InBook{ jiaolima99, 7010 author = {Xiangmin Jiao and Xiang-Yang Li and Xiaosong Ma}, 7011 chapter = {SIFFEA:Scalable Integrated Framework for Finite Element Analysis}, 7012 url = {http://portal.acm.org/citation.cfm?id=646895.709725}, 7013 title = {Lecture Notes in Computer Science}, 7014 publisher = {Springer-Verlag}, 7015 volume = {1732}, 7016 year = {1999}, 7017 petsc_uses = {KSP} 7018} 7019 7020@Article{ crow1, 7021 author = {C. S. Crow IV}, 7022 title = {DistSolve: An Open Source Web Service for Solving Sparse Systems of Equations}, 7023 journal = {Hopkins Undergraduate Research Journal}, 7024 year = {2003}, 7025 url = {http://www.jhu.edu/hurj/issue2/09D%20Crow%20DistSolve.pdf}, 7026 petsc_uses = {KSP} 7027} 7028 7029@Unpublished{ petsc-python, 7030 title = {PETSc for Python}, 7031 author = {L. Dalcin}, 7032 url = {https://petsc.org/main/petsc4py}, 7033 note = {Provides Python bindings for PETSc}, 7034} 7035 7036@Unpublished{ cfdship, 7037 title = {{CFDShip-Iowa}}, 7038 author = {Pablo M. Carrica and Robert V. Wilson and Fred Stern}, 7039 institution = {University of Iowa}, 7040 url = {http://www.iihr.uiowa.edu/\~{ }cfdship/}, 7041 note = {CFDShip-Iowa is a multiblock free surface flow solver that uses overset 7042 structured grids, designed for ship applications}, 7043 petsc_uses = {KSP} 7044} 7045 7046@Unpublished{ bvw, 7047 title = {Multiflow}, 7048 author = {Berend van Wachem}, 7049 institution = {Mechanical Engineering - Chalmers University of Technology}, 7050 url = {http://www.tfd.chalmers.se/\~{ }berend/page3.html}, 7051 note = {MultiFlow is a curvlinear, multiblock, multiprocessor flowsolver for multiphase 7052 flows.}, 7053 petsc_uses = {KSP} 7054} 7055 7056@Unpublished{ dks2, 7057 title = {FENA - A Finite Element Model for the North Atlantic}, 7058 author = {Jens Schroeter}, 7059 institution = {Alfred-Wegener-Institute for Polar and Marine Research}, 7060 url = {http://www.awi-bremerhaven.de/Modelling/INVERSE/FENAdesc/FENAdesc.html}, 7061 petsc_uses = {KSP} 7062} 7063 7064@TechReport{ piwonski2010idea, 7065 title = {The Idea and Concept of {Metos3D}: {A} Marine Ecosystem Toolkit for Optimization 7066 and Simulation in {3-D}}, 7067 author = {Piwonski, J. and Slawig, T.}, 7068 year = {2010}, 7069 institution = {Christian-Albrechts-Universit\"at zu Kiel}, 7070 url = {http://www.informatik.uni-kiel.de/uploads/tx_publication/tr_1016_01.pdf}, 7071 petsc_uses = {KSP} 7072} 7073 7074@Unpublished{ metos3d-web, 7075 title = {{Metos3D}: {A} Marine Ecosystem Toolkit for Optimization and Simulation in 3-D}, 7076 author = {Piwonski, J. and Slawig, T.}, 7077 institution = {Christian-Albrechts-Universit\"at zu Kiel}, 7078 url = {http://www.informatik.uni-kiel.de/en/algorithmic-optimal-control/software/metos3d/}, 7079 petsc_uses = {KSP} 7080} 7081 7082@Unpublished{ magpar, 7083 author = {W. Scholz}, 7084 title = {Magpar: Parallel Micromagnetics Code}, 7085 institution = {Vienna University of Technology}, 7086 url = {http://magnet.atp.tuwien.ac.at/scholz/magpar/}, 7087 petsc_uses = {KSP} 7088} 7089 7090@Misc{ libmesh:sourceforge, 7091 author = {}, 7092 title = {{libMesh}:a C++ framework for the numerical simulation of partial differential 7093 equations on serial and parallel platforms}, 7094 note = {[Online]}, 7095 url = {http://libmesh.github.io}, 7096 petsc_uses = {KSP} 7097} 7098 7099@Misc{ moose-web-page, 7100 title = {Multiphysics {O}bject-{O}riented {S}imulation {E}nvironment ({MOOSE})}, 7101 author = {David Andrs and Cody Permann and Andrew Slaughter and Richard Martineau and Derek 7102 Gaston and John Peterson and Jason Miller}, 7103 institution = {Idaho National Laboratory}, 7104 howpublished = {\url{http://mooseframework.org}}, 7105 petsc_uses = {KSP} 7106} 7107 7108@Article{ gaston2009moose, 7109 title = {MOOSE: {A} parallel computational framework for coupled systems of nonlinear 7110 equations}, 7111 author = {Gaston, D. and Newman, C. and Hansen, G. and Lebrun-Grandi{\'e}, D.}, 7112 journal = {Nuclear Engineering and Design}, 7113 volume = {239}, 7114 number = {10}, 7115 pages = {1768--1778}, 7116 year = {2009}, 7117 publisher = {Elsevier}, 7118 petsc_uses = {KSP} 7119} 7120 7121@Article{ tonks2012object, 7122 title = {An object-oriented finite element framework for multiphysics phase field 7123 simulations}, 7124 author = {Tonks, M.R. and Gaston, D. and Millett, P.C. and Andrs, D. and Talbot, P.}, 7125 journal = {Computational Materials Science}, 7126 volume = {51}, 7127 number = {1}, 7128 pages = {20--29}, 7129 year = {2012}, 7130 publisher = {Elsevier}, 7131 petsc_uses = {KSP} 7132} 7133 7134@Misc{ pylithmanual, 7135 author = {Brad Aagaard and Sue Kientz and Matthew G. Knepley and Surendra Somala and Leif 7136 Strand and Charles Williams}, 7137 title = {{PyLith} User Manual Version 2.0.0}, 7138 year = {2014}, 7139 url = {http://geodynamics.org/cig/software/github/pylith/v2.0.0/pylith-2.0.0_manual.pdf}, 7140 petsc_uses = {KSP} 7141} 7142 7143@Misc{ pylith-web-page, 7144 author = {Brad Aagaard and Matthew G. Knepley and Charles Williams}, 7145 title = {{PyLith}}, 7146 year = {2012}, 7147 url = {http://geodynamics.org/resources/pylith/}, 7148 howpublished = {\url{http://geodynamics.org/resources/pylith/}}, 7149 petsc_uses = {KSP} 7150} 7151 7152@Misc{ galemanual, 7153 author = {Walter Landry and Luke Hodkinson and Susan Kientz}, 7154 title = {Gale User Manual Version 2.0.0}, 7155 year = {2011}, 7156 url = {http://geodynamics.org/cig/software/gale/gale.pdf}, 7157 petsc_uses = {KSP} 7158} 7159 7160@Unpublished{ underworld, 7161 author = {Louis Moresi}, 7162 title = {{UnderWorld}: A Geodynamics Modelling Code}, 7163 institution = {Monash University}, 7164 url = {http://www.mcc.monash.edu/twiki/view/Codes}, 7165 petsc_uses = {KSP} 7166} 7167 7168@Article{ moresi2007computational, 7169 title = {Computational approaches to studying non-linear dynamics of the crust and 7170 mantle}, 7171 author = {Moresi, L. and Quenette, S. and Lemiale, V. and Meriaux, C. and Appelbe, B. and 7172 M{\"u}hlhaus, H.B.}, 7173 journal = {Physics of the Earth and Planetary Interiors}, 7174 volume = {163}, 7175 number = {1-4}, 7176 pages = {69--82}, 7177 year = {2007}, 7178 publisher = {Elsevier}, 7179 petsc_uses = {KSP} 7180} 7181 7182@Article{ pitt2009chaste, 7183 title = {Chaste: a test-driven approach to software development for biological modelling}, 7184 author = {Pitt-Francis, J. and Pathmanathan, P. and Bernabeu, M.O. and Bordas, R. and 7185 Cooper, J. and Fletcher, A.G. and Mirams, G.R. and Murray, P. and Osborne, J.M. 7186 and Walter, A. and others}, 7187 journal = {Computer Physics Communications}, 7188 volume = {180}, 7189 number = {12}, 7190 pages = {2452--2471}, 7191 year = {2009}, 7192 publisher = {Elsevier}, 7193 petsc_uses = {KSP} 7194} 7195 7196@Misc{ fenicsproject, 7197 title = {{The FEniCS project}}, 7198 author = {Logg, A. and {\O}lgaard, K. and Rognes, M.E. and Wells, G.N. and Jansson, J. and 7199 Kirby, R.C. and Knepley, M.G. and Lindbo, D. and Skavhaug, O.}, 7200 note = {A continually updated technical report. \url{http://fenicsproject.org}}, 7201 url = {http://fenicsproject.org}, 7202 year = {2011}, 7203 petsc_uses = {KSP} 7204} 7205 7206@Unpublished{ snark, 7207 title = {Snark: A suite of software for geoscientific applications and a philosophy of 7208 scientific software development}, 7209 institution = {Victorian Partnership for Advanced Computing}, 7210 url = {http://vpac.org/Snark}, 7211 petsc_uses = {KSP} 7212} 7213 7214@Misc{ imoose:sourceforge, 7215 author = {Guido Arians and Thomas Bauer and Christian Kaehler and Wolfgang Mai and 7216 Christoph Monzel and Dirk {van Riesen} and Christoph Schlensok}, 7217 title = {Innovative Modern Object-Oriented Solving Environment - {iMOOSE}}, 7218 note = {[Online]}, 7219 url = {http://imoose.sourceforge.net}, 7220 petsc_uses = {KSP} 7221} 7222 7223@Unpublished{ fossi, 7224 author = {Stephan Frickenhaus}, 7225 title = {FoSSI: Family of Simplified Solver Interfaces, offers scalable access to 7226 MPI-parallel solvers from CSR-matrix format frequently used in sequential/vector 7227 codes}, 7228 institution = {AWI-Bremerhaven, Germanny}, 7229 url = {http://www.awi.de/en/research/scientific_computing/research_topics_of_scientific_computing/fossi/}, 7230 petsc_uses = {KSP} 7231} 7232 7233@Unpublished{ fun3dweb, 7234 author = {Dinesh Kaushik}, 7235 title = {PETSC-FUN3D Benchmark Page}, 7236 institution = {ODU/ANL}, 7237 url = {http://www.mcs.anl.gov/petsc-fun3d}, 7238 note = {CFD Benchmark of some solvers in PETSc}, 7239 petsc_uses = {KSP} 7240} 7241 7242@Unpublished{ scirun, 7243 author = {SCIRun Development Team}, 7244 title = {SCIRun}, 7245 institution = {University of Utah}, 7246 url = {http://www.sci.utah.edu/stories/2001/jul_scirun120.html}, 7247 note = {SCIRun now uses PETSc linear solvers}, 7248 petsc_uses = {KSP} 7249} 7250 7251@Misc{ prometheus, 7252 author = {Mark F. Adams}, 7253 title = {Prometheus - A scalable unstructured finite element solver}, 7254 institution = {Berkeley}, 7255 howpublished = {\url{http://www.cs.berkeley.edu/~madams/prometheus}}, 7256 url = {http://www.cs.berkeley.edu/\~{ }madams/prometheus}, 7257 petsc_uses = {KSP} 7258} 7259 7260@Unpublished{ illuminator, 7261 author = {Adam C. Powell, IV}, 7262 title = {Illuminator Distributed Visualization Library}, 7263 url = {http://lyre.mit.edu/\~{ }powell/Illuminator.html}, 7264 petsc_uses = {KSP} 7265} 7266 7267@Unpublished{ rheoplast, 7268 title = {RheoPlast Phase Field Multi-Physics Code}, 7269 author = {Adam Powell and David Dussault and Bo Zhou}, 7270 url = {http://lyre.mit.edu/\~{ }powell/rheoplast.html}, 7271 petsc_uses = {KSP} 7272} 7273 7274@Misc{ tao-web-page, 7275 title = {{Toolkit for Advanced Optimization (TAO)} {W}eb Page}, 7276 author = {Alp Dener and Adam Denchfield and Todd Munson and Jason Sarich and Stefan Wild 7277 and Steve Benson and Lois Curfman McInnes and Jorge Mor{\'e}}, 7278 institution = {Mathematics and Computer Science Division, Argonne National Laboratory}, 7279 howpublished = {\url{http://www.mcs.anl.gov/tao}}, 7280 petsc_uses = {KSP} 7281} 7282 7283@TechReport{ tao-user-ref, 7284 title = {{Toolkit for Advanced Optimization (TAO) users manual}}, 7285 author = {Alp Dener and Adam Denchfield and Todd Munson and Jason Sarich and Stefan Wild 7286 and Steve Benson and Lois Curfman McInnes}, 7287 institution = {Argonne National Laboratory}, 7288 year = {2019}, 7289 number = {ANL/MCS-TM-322 - Rev 3.12}, 7290 petsc_uses = {KSP} 7291} 7292 7293% url = "http://www.mcs.anl.gov/tao", 7294@Unpublished{ mefpp-web-page, 7295 title = {{MEF++} {W}eb {P}age}, 7296 url = {http://www.giref.ulaval.ca/ressources/projets/mefpp.html}, 7297 institution = {Groupe Interdisiplinaire de Recherche en Elements Finis}, 7298 author = {Eric Chamberland}, 7299 note = {A finite element code for fluid dynamics, solid mechanics, thermal and 7300 multiphysics}, 7301 petsc_uses = {KSP} 7302} 7303 7304@Unpublished{ tipetsc-web-page, 7305 title = {Ti-PETSc - an interface to PETSc from Titanium}, 7306 institution = {Berkeley}, 7307 url = {http://www.nersc.gov/\~{ }yunhe/cs267/final/paper.pdf}, 7308 petsc_uses = {KSP} 7309} 7310 7311@Unpublished{ ptatin-web-page, 7312 title = {ptatin3d}, 7313 author = {Jed Brown and Laetitia {Le Pourhiet} and Dave A. May and Patrick Sanan}, 7314 url = {https://bitbucket.org/jedbrown/ptatin3d}, 7315 year = {2018}, 7316 petsc_uses = {KSP} 7317} 7318 7319@Misc{ multiphase-web-page, 7320 author = {Q. Zou}, 7321 title = {Multiphase flow with {PETSc}}, 7322 institution = {LANL}, 7323 howpublished = {\url{http://cnls-www.lanl.gov/~qzou}}, 7324 url = {http://cnls-www.lanl.gov/\~{ }qzou}, 7325 lab = {LANL}, 7326 petsc_uses = {KSP} 7327} 7328 7329@Misc{ electromag-web-page, 7330 title = {{EMSolve Web} page}, 7331 institution = {LLNL}, 7332 howpublished = {http://www.llnl.gov/casc/emsolve}, 7333 url = {http://www.Llnl.gov/casc/emsolve}, 7334 author = {Daniel {White et al.}}, 7335 lab = {LLNL}, 7336 petsc_uses = {KSP} 7337} 7338 7339@Unpublished{ fe-software-web-page, 7340 institution = {Kuleuven}, 7341 title = {Finite element software}, 7342 url = {http://www.esat.kuleuven.ac.be/elen/research/software-development}, 7343 petsc_uses = {KSP} 7344} 7345 7346@Misc{ petsc-web-page, 7347 author = {Satish Balay and Shrirang Abhyankar and Mark~F. Adams and Steven Benson and Jed 7348 Brown and Peter Brune and Kris Buschelman and Emil~M. Constantinescu and Lisandro 7349 Dalcin and Alp Dener and Victor Eijkhout and Jacob Faibussowitsch and William~D. 7350 Gropp and V\'{a}clav Hapla and Tobin Isaac and Pierre Jolivet and Dmitry Karpeev 7351 and Dinesh Kaushik and Matthew~G. Knepley and Fande Kong and Scott Kruger and 7352 Dave~A. May and Lois Curfman McInnes and Richard Tran Mills and Lawrence Mitchell 7353 and Todd Munson and Jose~E. Roman and Karl Rupp and Patrick Sanan and Jason Sarich 7354 and Barry~F. Smith and Stefano Zampini and Hong Zhang and Hong Zhang and Junchao 7355 Zhang}, 7356 title = {{PETS}c {W}eb page}, 7357 url = {https://petsc.org/}, 7358 howpublished = {\url{https://petsc.org/}}, 7359 year = {2023} 7360} 7361 7362@Unpublished{ petsc-debian-package, 7363 author = {Adam C. Powell, IV}, 7364 title = {Debian package for PETSc}, 7365 url = {http://lyre.mit.edu/\~{ }powell/petsc.html}, 7366 petsc_uses = {KSP} 7367} 7368 7369@Unpublished{ cactus, 7370 title = {Cactus Website}, 7371 url = {http://www.cactuscode.org/}, 7372 note = {Provides two interface to the PETSc solvers}, 7373 petsc_uses = {KSP} 7374} 7375 7376@Unpublished{ petsc-fem, 7377 author = {Mario Storti and Norberto Nigro}, 7378 title = {PETSc-FEM: A General Purpose, Parallel, Multi-Physics FEM Program}, 7379 institution = {Centro Internacional de Metodos Computacionales en Ingenieria (CIMEC)}, 7380 url = {http://www.cimec.org.ar/petscfem}, 7381 petsc_uses = {KSP} 7382} 7383 7384@Misc{ fidap, 7385 title = {FIDAP 8.5}, 7386 howpublished = {\url{http://www.fluent.com}}, 7387 url = {http://www.fluent.com}, 7388 note = {Fluent's commercial finite element fluid code uses PETSc for parallel linear 7389 solves.}, 7390 key = {FIDAP 8.5}, 7391 petsc_uses = {KSP} 7392} 7393 7394@Unpublished{ slepc, 7395 author = {Carmen Campos and Jos\'e E. Rom\'an and Eloy Romero and Andr\'es Tom\'as and 7396 Vicente Hern\'andez and Vicent Vidal}, 7397 title = {{SLEPc} Website}, 7398 url = {http://slepc.upv.es/}, 7399 note = {Scalable Library for Eigenvalue Problem Computations}, 7400 petsc_uses = {KSP} 7401} 7402 7403@TechReport{ slepc-users-manual, 7404 author = {Carmen Campos and Jos\'e E. Rom\'an and Eloy Romero and Andr\'es Tom\'as and 7405 Vicente Hern\'andez and Vicent Vidal}, 7406 title = {{SLEPc} Users Manual}, 7407 number = {DISC-II/24/02}, 7408 url = {http://slepc.upv.es/}, 7409 note = {Scalable Library for Eigenvalue Problem Computations}, 7410 petsc_uses = {KSP} 7411} 7412 7413@Misc{ deal.ii, 7414 title = {deal.II}, 7415 howpublished = {\url{http://www.dealii.org}}, 7416 url = {http://www.dealii.org}, 7417 note = {deal.II is a C++ library targeting adaptive finite elements and error estimation. 7418 It allows PETSc linear algebra and solvers to be used underneath.}, 7419 key = {deal.II 5.0}, 7420 petsc_uses = {KSP} 7421} 7422 7423@Article{ bangerth2007deal, 7424 title = {{deal.II---A general-purpose object-oriented finite element library}}, 7425 author = {Bangerth, W. and Hartmann, R. and Kanschat, G.}, 7426 journal = {ACM Transactions on Mathematical Software (TOMS)}, 7427 volume = {33}, 7428 number = {4}, 7429 pages = {24--es}, 7430 issn = {0098-3500}, 7431 year = {2007}, 7432 publisher = {ACM}, 7433 petsc_uses = {KSP} 7434} 7435 7436@Misc{ globalarrays, 7437 author = {Jarek {Nieplocha et al.}}, 7438 title = {Global Arrays}, 7439 institution = {Pacific Northwest National Laboratories}, 7440 howpublished = {\url{http://www.emsl.pnl.gov/docs/global}}, 7441 url = {http://www.emsl.pnl.gov/docs/global}, 7442 note = {Global arrays can use PETSc linear solvers}, 7443 lab = {PNNL}, 7444 petsc_uses = {KSP} 7445} 7446 7447% LiteralHTML: 7448% LiteralHTML: <a name="software"><H3><center>Software Engineering</center></H3> 7449% LiteralHTML: 7450@Article{ petsccommunity2022, 7451 title = {The Community is the Infrastructure: A Short Discussion of the {PETSc} User 7452 Community}, 7453 author = {Mark Adams and Satish Balay and Jed Brown and Victor Eijkhout and Jacob 7454 Faibussowitsch and Fande Kong and Matthew Knepley and Scott Kruger and Oana Marin 7455 and Richard Mills and Todd Munson and Patrick Sanan and Barry Smith and Hong Zhang 7456 and Hong Zhang and Junchao Zhang}, 7457 journal = {Computing in Science and Engineering}, 7458 volume = {24}, 7459 number = {03}, 7460 pages = {6--15}, 7461 issn = {1558-366X}, 7462 doi = {10.1109/MCSE.2022.3169974}, 7463 publisher = {IEEE Computer Society}, 7464 address = {Los Alamitos, CA, USA}, 7465 month = may, 7466 year = {2022}, 7467 url = {https://figshare.com/articles/conference_contribution/The_Community_is_the_Infrastructure_A_Short_Discussion_of_the_PETSc_User_Community/16523043}, 7468 petsc_uses = {KSP} 7469} 7470 7471@Article{ brownknepleysmith14, 7472 author = {Jed Brown and Matthew G. Knepley and Barry Smith}, 7473 title = {Run-time extensibility and librarization of simulation software}, 7474 journal = {IEEE Computing in Science and Engineering}, 7475 month = jan, 7476 volume = {17}, 7477 number = {1}, 7478 pages = {38--45}, 7479 doi = {10.1109/MCSE.2014.95}, 7480 year = {2015}, 7481 petsc_uses = {KSP} 7482} 7483 7484@TechReport{ ass2012, 7485 author = {Shrirang Abhyankar and Barry Smith and Kerry Stevens}, 7486 title = {Preliminary implementation of Hybrid {MPI}/pthread programming model in {PETSc}}, 7487 institution = {Argonne National Laboratory}, 7488 type = {Preprint}, 7489 year = {2012}, 7490 number = {ANL/MCS-P2011-0112}, 7491 petsc_uses = {KSP} 7492} 7493 7494@TechReport{ clearyknepley99, 7495 author = {Andrew Cleary and Matthew G. Knepley}, 7496 title = {Solvers as Operators}, 7497 institution = {Lawrence Livermore National Laboratory}, 7498 type = {Technical Report}, 7499 number = {UCRL-ID-135342}, 7500 year = {1999}, 7501 petsc_uses = {KSP} 7502} 7503 7504@TechReport{ smcabbkz2012, 7505 author = {Barry Smith and Lois Curfman McInnes and Emil Constantinescu and Mark Adams and 7506 Satish Balay and Jed Brown and Matthew Knepley and Hong Zhang}, 7507 title = {{PETSc's} software strategy for the design space of composable extreme-scale 7508 solvers}, 7509 institution = {Argonne National Laboratory}, 7510 type = {Preprint}, 7511 note = {{DOE} Exascale Research Conference, April 16-18, 2012, Portland, OR}, 7512 year = {2012}, 7513 number = {ANL/MCS-P2059-0312}, 7514 petsc_uses = {KSP} 7515} 7516 7517@InProceedings{ mhwpmhs2009, 7518 author = {R. T. Mills and F. M. Hoffman and P. H. Worley and K. S. Pwerumalla and A. Mirin 7519 and G. E. Hammond and B. Smith}, 7520 title = {Coping at the User-Level with Resource Limitations in the {Cray} Message Passing 7521 Toolkit {MPI} at Scale}, 7522 booktitle = {Cray Users Group Conference}, 7523 year = {2009}, 7524 petsc_uses = {KSP} 7525} 7526 7527@InProceedings{ msmhls2010, 7528 author = {R. T. Mills and V. Sripathi and G. Mahinthakumar and G. Hammond and P. C. 7529 Lichtner and B. F. Smith}, 7530 title = {Engineering {PFLOTRAN} for Scalable Performance on {Cray} {XT} and {IBM} 7531 {BlueGene} Architectures}, 7532 booktitle = {Proceedings of SciDAC 2010 Annual Meeting}, 7533 year = {2010}, 7534 petsc_uses = {KSP} 7535} 7536 7537@InCollection{ msk2013, 7538 author = {Victor Minden and Barry F. Smith and Matthew G. Knepley}, 7539 title = {Preliminary Implementation of {PETSc} Using {GPUs}}, 7540 booktitle = {GPU Solutions to Multi-scale Problems in Science and Engineering}, 7541 series = {Lecture Notes in Earth System Sciences}, 7542 editor = {David A. Yuen and Long Wang and Xuebin Chi and Lennart Johnsson and Wei Ge and 7543 Yaolin Shi}, 7544 doi = {10.1007/978-3-642-16405-7_7}, 7545 publisher = {Springer Berlin Heidelberg}, 7546 pages = {131--140}, 7547 year = {2013}, 7548 isbn = {978-3-642-16404-0}, 7549 petsc_uses = {KSP} 7550} 7551 7552@InCollection{ knepleyyuen13, 7553 author = {Matthew G. Knepley and David A. Yuen}, 7554 title = {Why Scientists and Engineers need {GPU}s today}, 7555 booktitle = {GPU Solutions to Multi-scale Problems in Science and Engineering}, 7556 series = {Lecture Notes in Earth System Sciences}, 7557 editor = {David A. Yuen and Long Wang and Xuebin Chi and Lennart Johnsson and Wei Ge and 7558 Yaolin Shi}, 7559 doi = {10.1007/978-3-642-16405-7_1}, 7560 publisher = {Springer Berlin Heidelberg}, 7561 pages = {131--140}, 7562 year = {2013}, 7563 isbn = {978-3-642-16404-0}, 7564 petsc_uses = {KSP} 7565} 7566 7567@InCollection{ karpeevknepleybrune13, 7568 author = {Dmitry A. Karpeev and Matthew G. Knepley and Peter R. Brune}, 7569 title = {Accurate Evaluation of Local Averages on {GPGPUs}}, 7570 booktitle = {GPU Solutions to Multi-scale Problems in Science and Engineering}, 7571 series = {Lecture Notes in Earth System Sciences}, 7572 editor = {David A. Yuen and Long Wang and Xuebin Chi and Lennart Johnsson and Wei Ge and 7573 Yaolin Shi}, 7574 doi = {10.1007/978-3-642-16405-7_30}, 7575 publisher = {Springer Berlin Heidelberg}, 7576 pages = {487--501}, 7577 year = {2013}, 7578 isbn = {978-3-642-16404-0}, 7579 petsc_uses = {KSP} 7580} 7581 7582@InCollection{ zhengetal13, 7583 title = {{GPU} Implementation of Multigrid Solver for {S}tokes Equation with Strongly 7584 Variable Viscosity}, 7585 author = {Liang Zheng and Taras Gerya and Matthew G. Knepley and David A. Yuen and Huai 7586 Zhang and Yaolin Shi}, 7587 booktitle = {GPU Solutions to Multi-scale Problems in Science and Engineering}, 7588 series = {Lecture Notes in Earth System Sciences}, 7589 editor = {David A. Yuen and Long Wang and Xuebin Chi and Lennart Johnsson and Wei Ge and 7590 Yaolin Shi}, 7591 doi = {10.1007/978-3-642-16405-7_21}, 7592 publisher = {Springer Berlin Heidelberg}, 7593 pages = {321--333}, 7594 year = {2013}, 7595 isbn = {978-3-642-16404-0}, 7596 petsc_uses = {KSP} 7597} 7598 7599@Article{ zhengetal13b, 7600 title = {Implementation of a multigrid solver on {GPU} for {S}tokes equations with 7601 strongly variable viscosity based on {M}atlab and {CUDA}}, 7602 author = {Liang Zheng and Taras Gerya and Matthew G. Knepley and David A. Yuen and Huai 7603 Zhang and Yaolin Shi}, 7604 journal = {IJHPCA}, 7605 volume = {28}, 7606 number = {1}, 7607 pages = {50--60}, 7608 doi = {10.1177/1094342013478640}, 7609 year = {2013}, 7610 petsc_uses = {KSP} 7611} 7612 7613@InBook{ s2011, 7614 author = {B. Smith}, 7615 chapter = {PETSc, the Portable, Extensible Toolkit for Scientific computing}, 7616 title = {Encyclopedia of Parallel Computing}, 7617 bookeditor = {D. Padua}, 7618 publisher = {Springer}, 7619 year = {2011}, 7620 petsc_uses = {KSP} 7621} 7622 7623@Article{ acostamejia06, 7624 author = {Carlos D. Acosta and Carlos E. Mej\'ia}, 7625 title = {Computaci\'on cient\'ifica en paralelo con interfaz MATLAB a PETSc}, 7626 journal = {Lecturas Matem\'aticas}, 7627 volume = {27}, 7628 year = {2006}, 7629 pages = {213--224}, 7630 petsc_uses = {KSP} 7631} 7632 7633@InProceedings{ quenettemoresisunterappelbe07, 7634 author = {Steve Quenette and Louis Moresi and {P. D.} Sunter and Bill F. Appelbe}, 7635 title = {Explaining StGermain: An aspect oriented environment for building extensible 7636 computational mechanics modeling software}, 7637 booktitle = {Parallel and Distributed Processing Symposium, IPDPS 2007}, 7638 publisher = {IEEE}, 7639 pages = {1--8}, 7640 yerar = {2007}, 7641 petsc_uses = {KSP} 7642} 7643 7644@Article{ dfm1, 7645 title = {Vectorized sparse matrix multiply for compressed row storage format}, 7646 author = {E. F. D'Azevedo and M. R. Fahey and R. T. Mills}, 7647 journal = {Lecture Notes in Computer Science}, 7648 year = {2005}, 7649 pages = {99--106}, 7650 volume = {3514}, 7651 lab = {ORNL}, 7652 petsc_uses = {KSP} 7653} 7654 7655@InProceedings{ laniquintinokimpedeconinckvandewallepoedts05, 7656 author = {Andrea Lani and Tiago Quintino and Dries Kimpe and Herman Deconinck and Stefan 7657 Vandewalle and Stefaan Poedts}, 7658 title = {The COOLFluiD Framework: Design Solutions for High Performance Object Oriented 7659 Scientific Computing Software}, 7660 booktitle = {Computational Science ICCS 2005: 5th International Conference}, 7661 year = {2005}, 7662 note = {Lecture Notes in Computer Science}, 7663 volume = {3514}, 7664 publisher = {Springer-Verlag GmbH}, 7665 petsc_uses = {KSP} 7666} 7667 7668@InProceedings{ dalcin-paz-storti, 7669 author = {L. Dalcin and R. Paz and M. Storti}, 7670 title = {Desarrollo de Aplicaciones Paralelas en Python}, 7671 booktitle = {Proceedings of *XIV Congress on Numerical Methods and its Applications (ENIEF). 7672 Bariloche, Argentina}, 7673 year = {2004}, 7674 petsc_uses = {KSP} 7675} 7676 7677@Article{ mpi-python, 7678 author = {L. Dalcin and R. Paz and M. Storti}, 7679 title = {MPI for Python}, 7680 journal = {Journal of Parallel and Distributed Computing}, 7681 year = {2005}, 7682 petsc_uses = {KSP} 7683} 7684 7685@Unpublished{ hrv02a, 7686 title = {{SLEPc}: Scalable Library for Eigenvalue Problem Computations}, 7687 author = {V. Hernandex and J. E. Roman and V. Vidal}, 7688 note = {Submited to VecPar 2002}, 7689 year = {2002}, 7690 petsc_uses = {KSP} 7691} 7692 7693@Article{ knyazev2007block, 7694 title = {Block Locally Optimal Preconditioned Eigenvalue Xolvers {(BLOPEX)} in {Hypre} and 7695 {PETSc}}, 7696 author = {Knyazev, A. V. and Argentati, M. E. and Lashuk, I. and Ovtchinnikov, E. E.}, 7697 journal = {SIAM Journal on Scientific Computing}, 7698 volume = {29}, 7699 pages = {2224-2239}, 7700 doi = {10.1137/060661624}, 7701 year = {2007}, 7702 petsc_uses = {KSP} 7703} 7704 7705@MastersThesis{ aarrestad-master, 7706 author = {Asbjorn Hoiland Aarrestad}, 7707 title = {Time Dependent Solution of the Schrodinger Equation for Parallel Computers}, 7708 school = {University of Bergen}, 7709 month = aug, 7710 year = {2003}, 7711 url = {http://www.parallab.uib.no/projects/molecul/matrix/}, 7712 note = {Implemented Runge-Kutta methods using PETSc}, 7713 petsc_uses = {KSP} 7714} 7715 7716@PhDThesis{ kaushik-phd, 7717 author = {D. K. Kaushik}, 7718 title = {Performance Modeling and Prediction for the Scalable Solution of Partial 7719 Differential Equations on Unstructured Grids}, 7720 school = {Old Dominion University}, 7721 month = dec, 7722 year = {2002}, 7723 url = {http://www.mcs.anl.gov/\~{ }kaushik/Papers/thesis.ps}, 7724 petsc_uses = {KSP} 7725} 7726 7727@TechReport{ rb1, 7728 author = {Rickard Bergstrom}, 7729 title = {Object Oriented Implementation of a General Finite Element Code}, 7730 number = {2002-13}, 7731 institution = {Chalmers Finite Element Center, Chalmers University of Technology}, 7732 year = {2002}, 7733 url = {http://www.phi.chalmers.se/pub/preprints/pdf/phiprint-2002-13.pdf}, 7734 note = {Discribes a finite element software package that uses PETSc for its solvers}, 7735 petsc_uses = {KSP} 7736} 7737 7738@InProceedings{ dbl1, 7739 author = {Enzo A. Dari and Gustavo C. Buscaglia and Adrian J. Lew}, 7740 title = {A Parallel General Purpose Finite Element System}, 7741 booktitle = {IX SIAM Conference on Parallel Processing for Scientific Computing}, 7742 publisher = {SIAM}, 7743 year = {1999}, 7744 url = {http://cabmec1.cnea.gov.ar/papers/apgpfes.ps.gz}, 7745 note = {Describes software that uses PETSc for its parallel linear solves}, 7746 petsc_uses = {KSP} 7747} 7748 7749@Article{ p1, 7750 title = {Parallel Components for PDEs and Optimization: Some Issues and Experiences}, 7751 author = {B. Norris and S. Balay and S. Benson and L. Freitag and P. Hovland and L. McInnes 7752 and B. Smith}, 7753 journal = {Parallel Computing}, 7754 year = {2002}, 7755 pages = {1811--1831}, 7756 volume = {28 (12)}, 7757 petsc_uses = {KSP} 7758} 7759 7760@Article{ automatic-ad, 7761 author = {Paul Hovland and Boyana Norris and Barry Smith}, 7762 title = {Making Automatic Differentiation Truly Automatic: Coupling {PETSc} with {ADIC}}, 7763 year = {2005}, 7764 journal = {Future Generation Computer Systems}, 7765 volume = {21}, 7766 number = {8}, 7767 pages = {1426--1438}, 7768 petsc_uses = {KSP} 7769} 7770 7771@TechReport{ remote-math, 7772 author = {Elizabeth Dolan and Paul Hovland and Jorge Mor\'e and Boyana Norris and Barry 7773 Smith}, 7774 title = {Remote Access to Mathematical Software}, 7775 number = {ANL/MCS-P889-0601}, 7776 institution = {Mathematics and Computer Science Division, Argonne National Laboratory}, 7777 month = jun, 7778 year = {2001}, 7779 url = {http://icm.mcs.kent.edu/research/iamc01proceedings.html}, 7780 petsc_uses = {KSP} 7781} 7782 7783@InProceedings{ gropp98, 7784 author = {William D. Gropp}, 7785 title = {Exploiting Existing Software in Libraries: Successes, Failures, and Reasons Why}, 7786 publisher = {SIAM}, 7787 booktitle = {Proceedings of the SIAM Workshop on Object Oriented Methods for Inter-operable 7788 Scientific and Engineering Computing}, 7789 year = {1999}, 7790 pages = {21-29}, 7791 petsc_uses = {KSP} 7792} 7793 7794@InProceedings{ knepleysarin99, 7795 author = {Matthew Knepley and Vivek Sarin}, 7796 title = {Algorithm Development for Large Scale Computing}, 7797 publisher = {SIAM}, 7798 booktitle = {Proceedings of the SIAM Workshop on Object Oriented Methods for Inter-operable 7799 Scientific and Engineering Computing}, 7800 note = {\url{http://books.google.com/books?id=2Da5OcnjPSgC&lpg=PA58&ots=TJCK64BUeg&dq=Bill%20Gropp%20Science%20Engineering%20Object%20Oriented&pg=PA138#v=onepage&q&f=false}}, 7801 year = {1999}, 7802 petsc_uses = {KSP} 7803} 7804 7805@InBook{ bgms00, 7806 author = {S. Balay and W. D. Gropp and L. C. McInnes and B. F. Smith}, 7807 chapter = {Software for the Scalable Solution of {PDEs}}, 7808 url = {ftp://info.mcs.anl.gov/pub/tech_reports/reports/P834.ps.Z}, 7809 title = {CRPC Handbook of Parallel Computing}, 7810 editor = {J. Dongarra and I. Foster and G. Fox and B. Gropp and K. Kennedy and L. Torczon 7811 and A. White}, 7812 publisher = {Morgan Kaufmann Publishers}, 7813 year = {2002}, 7814 petsc_uses = {KSP} 7815} 7816 7817@InProceedings{ hovland_norris_smith98, 7818 author = {Paul Hovland and Boyana Norris and Lucas Roh and Barry Smith}, 7819 title = {Developing a Derivative-Enhanced Object-Oriented Toolkit for Scientific 7820 Computations}, 7821 publisher = {SIAM}, 7822 booktitle = {Proceedings of the SIAM Workshop on Object Oriented Methods for Inter-operable 7823 Scientific and Engineering Computing}, 7824 url = {ftp://info.mcs.anl.gov/pub/tech_reports/reports/P731.ps.Z}, 7825 note = {also available as Argonne preprint ANL/MCS-P731-1098}, 7826 year = {1999}, 7827 pages = {129-137}, 7828 petsc_uses = {KSP} 7829} 7830 7831@InProceedings{ efficient, 7832 author = {Satish Balay and William D. Gropp and Lois Curfman McInnes and Barry F. Smith}, 7833 title = {Efficient Management of Parallelism in Object Oriented Numerical Software 7834 Libraries}, 7835 booktitle = {Modern Software Tools in Scientific Computing}, 7836 editor = {E. Arge and A. M. Bruaset and H. P. Langtangen}, 7837 publisher = {Birkhauser Press}, 7838 pages = {163--202}, 7839 year = {1997}, 7840 petsc_uses = {KSP} 7841} 7842 7843% url = "ftp://info.mcs.anl.gov/pub/tech_reports/reports/P634.ps.Z" 7844@TechReport{ petsc-user-ref, 7845 author = {Satish Balay and Shrirang Abhyankar and Mark~F. Adams and Steven Benson and Jed 7846 Brown and Peter Brune and Kris Buschelman and Emil Constantinescu and Lisandro 7847 Dalcin and Alp Dener and Victor Eijkhout and Jacob Faibussowitsch and William~D. 7848 Gropp and V\'{a}clav Hapla and Tobin Isaac and Pierre Jolivet and Dmitry Karpeev 7849 and Dinesh Kaushik and Matthew~G. Knepley and Fande Kong and Scott Kruger and 7850 Dave~A. May and Lois Curfman McInnes and Richard Tran Mills and Lawrence Mitchell 7851 and Todd Munson and Jose~E. Roman and Karl Rupp and Patrick Sanan and Jason Sarich 7852 and Barry~F. Smith and Stefano Zampini and Hong Zhang and Hong Zhang and Junchao 7853 Zhang}, 7854 title = {{PETSc/TAO} Users Manual}, 7855 institution = {Argonne National Laboratory}, 7856 number = {ANL-21/39 - Revision 3.19}, 7857 doi = {10.2172/1968587}, 7858 year = {2023} 7859} 7860 7861% url = {https://petsc.org/release} 7862@TechReport{ petsc-developers, 7863 author = {Scott Kruger and Patrick Sanan and Barry~F. Smith}, 7864 title = {{PETS}c Developers Guide}, 7865 institution = {Argonne National Laboratory}, 7866 number = {ANL-18/18}, 7867 year = {2018}, 7868 url = {https://petsc.org/release/developers}, 7869 petsc_uses = {KSP} 7870} 7871 7872@Unpublished{ alice-memory-snooper, 7873 author = {Ibrahima Ba and Barry~F. Smith}, 7874 title = {The {ALICE} Memory Snooper}, 7875 year = {1999}, 7876 petsc_uses = {KSP} 7877} 7878 7879@TechReport{ petsc-user-ref-polish, 7880 author = {Marcin Bojko and Piotr Krzyzanowski}, 7881 title = {Rozwiazywanie ukladow rownan przy pomocy pakietu PETSc}, 7882 institution = {Instytut Matematyki, Stosowanej i Mechaniki, Uniwersytet Warszawski}, 7883 year = {1998}, 7884 note = {An introduction to PETSc in Polish}, 7885 petsc_uses = {KSP} 7886} 7887 7888@InProceedings{ abghmn00, 7889 title = {Integrating Automatic Differentiation with Object-Oriented Toolkits for 7890 High-Performance Scientific Computing}, 7891 author = {J. Abate and S. Benson and L. Grignon and P. Hovland and L. C. McInnes and B. 7892 Norris}, 7893 url = {ftp://info.mcs.anl.gov/pub/tech_reports/reports/P820.ps.Z}, 7894 booktitle = {Automatic Differentiation of Algorithms: From Simulation to Optimization}, 7895 editor = {George Corliss and Christ\`{e}le Faure and Andreas Griewank and Laurent 7896 Hasco\"{e}t and Uwe Naumann}, 7897 publisher = {Springer}, 7898 year = {2002}, 7899 petsc_uses = {KSP} 7900} 7901 7902@Unpublished{ petsc-mpi-paper, 7903 author = {Lois Curfman McInnes and Barry F. Smith}, 7904 title = {{PETS}c 2.0: A Case Study of Using {MPI} to Develop Numerical Software 7905 Libraries}, 7906 note = {Proceedings of the MPI Developers Conference, Notre Dame, IN}, 7907 month = jun, 7908 year = {1995}, 7909 petsc_uses = {KSP} 7910} 7911 7912@InProceedings{ miss-paper, 7913 author = {William D. Gropp and Barry F. Smith}, 7914 title = {Scalable, Extensible, and Portable Numerical Libraries}, 7915 publisher = {IEEE}, 7916 year = {1994}, 7917 booktitle = {Proceedings of the Scalable Parallel Libraries Conference}, 7918 address = {Mississippi State University}, 7919 pages = {87--93}, 7920 keyword = {numerical libraries, scientific computing, parallel computing}, 7921 petsc_uses = {KSP} 7922} 7923 7924@InProceedings{ snes-paper, 7925 author = {William D. Gropp and Lois Curfman McInnes and Barry F. Smith}, 7926 title = {Scalable Libraries for Solving Systems of Nonlinear Equations and Unconstrained 7927 Minimization Problems}, 7928 publisher = {IEEE}, 7929 year = {1995}, 7930 booktitle = {Proceedings of the Scalable Parallel Libraries Conference}, 7931 address = {Mississippi State University}, 7932 pages = {60-67}, 7933 keyword = {nonlinear equations, optimization, superconductivity, parallel computing}, 7934 petsc_uses = {KSP} 7935} 7936 7937@Article{ dsneutral, 7938 author = {Barry F. Smith and William D. Gropp}, 7939 title = {The Design of Data-structure-neutral Libraries for the Iterative Solution of 7940 Sparse Linear Systems}, 7941 journal = {Scientific Programming}, 7942 volume = {5}, 7943 pages = {329--336}, 7944 key = {GroppSmith96 ! KSP design}, 7945 year = {1996}, 7946 petsc_uses = {KSP} 7947} 7948 7949@InProceedings{ bgms98, 7950 author = {Satish Balay and William D. Gropp and Lois Curfman McInnes and Barry F. Smith}, 7951 title = {A Microkernel Design for Component-based Parallel Numerical Software Systems}, 7952 booktitle = {Proceedings of the SIAM Workshop on Object Oriented Methods for Inter-operable 7953 Scientific and Engineering Computing}, 7954 publisher = {SIAM}, 7955 pages = {58-67}, 7956 url = {ftp://info.mcs.anl.gov/pub/tech_reports/reports/P727.ps.Z}, 7957 year = {1998}, 7958 petsc_uses = {KSP} 7959} 7960 7961@Article{ hkm98, 7962 author = {M. E. Hayder and D. E. Keyes and P. Mehrotra}, 7963 title = {A Comparison of the {PETSc} Library and {HPF} Implementations of an Archetypal 7964 {PDE} Computation}, 7965 journal = {Advances in Engineering Software}, 7966 volume = {29}, 7967 pages = {415-424}, 7968 year = {1998}, 7969 petsc_uses = {KSP} 7970} 7971 7972@TechReport{ pdpta99, 7973 author = {L. A. Freitag and W. D. Gropp and P. D. Hovland and L. C. McInnes and B. F. 7974 Smith}, 7975 title = {Infrastructure and Interfaces for Large-Scale Numerical Software}, 7976 note = {to appear in the Proceedings of the 1999 International Conference on Parallel and 7977 Distributed Processing Techniques and Applications, June 28 - July 1, 1999, Las 7978 Vegas, Nevada}, 7979 institution = {Mathematics and Computer Science Division, Argonne National Laboratory}, 7980 url = {ftp://info.mcs.anl.gov/pub/tech_reports/reports/P751.ps.Z}, 7981 number = {ANL/MCS-P751-0599}, 7982 year = {1999}, 7983 petsc_uses = {KSP} 7984} 7985 7986@InProceedings{ bbh:com, 7987 author = {C. H. Bischof and H. M. B{\"u}cker and P. D. Hovland}, 7988 title = {{On Combining Computational Differentiation and Toolkits for Parallel Scientific 7989 Computing}}, 7990 booktitle = {Euro-Par 2000 -- Parallel Processing, Proceedings of the 6th International 7991 Euro-Par Conference, Munich, Germany, August/September 2000}, 7992 year = {2000}, 7993 editor = {A. Bode and T. Ludwig and W. Karl and R. Wism{\"u}ller}, 7994 volume = {1900}, 7995 series = {Lecture Notes in Computer Science}, 7996 pages = {86--94}, 7997 address = {Berlin}, 7998 publisher = {Springer}, 7999 url = {ftp://info.mcs.anl.gov/pub/tech_reports/reports/P797.ps.Z}, 8000 petsc_uses = {KSP} 8001} 8002 8003@InProceedings{ overture00, 8004 author = {K. R. Buschelman and W. D. Gropp and L. C. McInnes and B. F. Smith}, 8005 title = { {PETSc and Overture}: Lessons Learned Developing an Interface between 8006 Components}, 8007 url = {ftp://info.mcs.anl.gov/pub/tech_reports/reports/P858.ps.Z}, 8008 booktitle = {Proceedings of the International Federation for Information Processing Working 8009 Conference on Software Architectures for Scientific Computing, Kluwer}, 8010 year = {2000}, 8011 pages = {57--68}, 8012 petsc_uses = {KSP} 8013} 8014 8015@TechReport{ smith97, 8016 title = {An Interface for Efficient Vector Scatters and Gathers on Parallel Machines}, 8017 url = {ftp://info.mcs.anl.gov/pub/tech_reports/reports/P701.ps.Z}, 8018 number = {ANL/MCS-P701}, 8019 author = {Barry F. Smith}, 8020 institution = {Mathematics and Computer Science Division, Argonne National Laboratory}, 8021 petsc_uses = {KSP} 8022} 8023 8024@Article{ smith98, 8025 author = {Barry Smith}, 8026 title = {The Transition of Numerical Software: From Nuts-and-Bolts to Abstraction}, 8027 journal = {SIGNUM Newsletter}, 8028 year = {1998}, 8029 url = {ftp://info.mcs.anl.gov/pub/tech_reports/reports/P712.ps.Z}, 8030 petsc_uses = {KSP} 8031} 8032 8033@TechReport{ ad-petsc-tm, 8034 title = {Using {ADIFOR} and {ADIC} to Provide a {J}acobian for the {SNES} Component of 8035 {PETSc}}, 8036 author = {Christian Bischof and Paul Hovland and Po-Ting Wu}, 8037 year = {1997}, 8038 type = {Technical Memorandum}, 8039 institution = {ANL}, 8040 url = {ftp://info.mcs.anl.gov/pub/tech_reports/reports/TM233.ps.Z}, 8041 number = {ANL/MCS-TM-233}, 8042 petsc_uses = {KSP} 8043} 8044 8045% LiteralHTML: 8046% LiteralHTML: <a name="algorithm"><H3><center>Algorithm design and analysis</center></H3> 8047% LiteralHTML: 8048@PhDThesis{ klotzthesis2019, 8049 author = {Thomas S. Klotz}, 8050 title = {Numerical Analysis of Nonlinear Boundary Integral Equations Arising in Molecular 8051 Biology}, 8052 school = {Rice University}, 8053 year = {2019}, 8054 petsc_uses = {KSP} 8055} 8056 8057@Article{ klotzbardhanknepley2018, 8058 title = {Efficient Evaluation of Ellipsoidal Harmonics for Potential Modeling}, 8059 author = {Thomas S. Klotz and Jaydeep Bardhan and Matthew G. Knepley}, 8060 journal = {Communications in Applied Mathematics and Computational Science}, 8061 note = {In review}, 8062 url = {https://arxiv.org/abs/1708.06028}, 8063 year = {2018}, 8064 petsc_uses = {KSP} 8065} 8066 8067@Misc{ brown2016, 8068 title = {Threading Tradeoffs in Domain Decomposition}, 8069 author = {Jed Brown}, 8070 note = {SIAM Parallel Processing Conference, To Thread or Not To Thread Minisymposium, 8071 \url{https://www.cse.buffalo.edu/~knepley/presentations/SIAMPP2016_1.pdf}}, 8072 url = {https://www.cse.buffalo.edu/~knepley/presentations/SIAMPP2016_1.pdf}, 8073 year = {2016}, 8074 petsc_uses = {KSP} 8075} 8076 8077@Article{ changnakshatralaknepleyjohnsson2017, 8078 title = {A performance spectrum for parallel computational frameworks that solve {PDEs}}, 8079 author = {Justin Chang and Kalyana B. Nakshatrala and Matthew G. Knepley and Lennart 8080 Johnsson}, 8081 journal = {Concurency: Practice and Experience}, 8082 volume = {30}, 8083 number = {11}, 8084 eprint = {1705.03625}, 8085 doi = {10.1002/cpe.4401}, 8086 year = {2017}, 8087 petsc_uses = {KSP} 8088} 8089 8090@Article{ changfabienknepleymills2018, 8091 title = {Comparative study of finite element methods using the Time-Accuracy-Size {(TAS)} 8092 spectrum analysis}, 8093 author = {Justin Chang and Maurice S. Fabien and Matthew G. Knepley and Richard T. Mills}, 8094 journal = {SIAM Journal on Scientific Computing}, 8095 volume = {40}, 8096 number = {6}, 8097 pages = {C779--C802}, 8098 eprint = {1802.07832}, 8099 doi = {10.1137/18M1172260}, 8100 year = {2018}, 8101 petsc_uses = {KSP} 8102} 8103 8104@Article{ joshaghanichangnakshatralaknepley2019, 8105 title = {Composable solvers for the four-field double porosity/permeability model}, 8106 author = {M. S. Joshaghani and Justin Chang and Kalyana B. Nakshatrala and Matthew G. 8107 Knepley}, 8108 journal = {Journal of Computational Physics}, 8109 volume = {386}, 8110 pages = {428--466}, 8111 doi = {10.1016/j.jcp.2019.02.020}, 8112 year = {2019}, 8113 petsc_uses = {KSP} 8114} 8115 8116@InProceedings{ barralknepleylangepiggottgorman2016, 8117 title = {Anisotropic mesh adaptation in {Firedrake} with {PETSc} {DMPlex}}, 8118 author = {Nicolas Barral and Matthew G. Knepley and Michael Lange and Matthew D. Piggott 8119 and Gerard J. Gorman}, 8120 booktitle = {25th International Meshing Roundtable}, 8121 editor = {Steve Owen and Hang Si}, 8122 month = sep, 8123 address = {Washington, DC}, 8124 pages = {1--5}, 8125 url = {http://imr.sandia.gov/papers/imr25/2026_imr25RN_Barral.pdf}, 8126 year = {2016}, 8127 petsc_uses = {KSP} 8128} 8129 8130@Article{ adamsbrownknepleysamtaney2016, 8131 title = {Segmental Refinement: A Multigrid Technique for Data Locality}, 8132 author = {Mark F. Adams and Jed Brown and Matthew G. Knepley and Ravi Samtaney}, 8133 journal = {SIAM Journal on Scientific Computing}, 8134 url = {http://epubs.siam.org/toc/sjoce3/38/4 }, 8135 epub = {http://arxiv.org/abs/1406.7808}, 8136 volume = {8}, 8137 number = {4}, 8138 pages = {C426--C440}, 8139 doi = {10.1137/140975127}, 8140 year = {2016}, 8141 petsc_uses = {KSP} 8142} 8143 8144@InProceedings{ maysananruppknepleysmith2016, 8145 title = {Extreme-Scale Multigrid Components within {PETSc}}, 8146 author = {Dave A. May and Patrick Sanan and Karl Rupp and Matthew G. Knepley and Barry F. 8147 Smith}, 8148 booktitle = {Proceedings of the {Platform for Advanced Scientific Computing Conference}}, 8149 series = {PASC '16}, 8150 isbn = {978-1-4503-4126-4}, 8151 location = {Lausanne, Switzerland}, 8152 pages = {5:1--5:12}, 8153 articleno = {5}, 8154 numpages = {12}, 8155 doi = {10.1145/2929908.2929913}, 8156 acmid = {2929913}, 8157 publisher = {ACM}, 8158 address = {New York, NY, USA}, 8159 keywords = {GPU, HPC, agglomeration, coarse-level solver, multigrid, parallel computing, 8160 preconditioning}, 8161 year = {2016}, 8162 petsc_uses = {KSP} 8163} 8164 8165@Article{ liu2015field, 8166 title = {Field-Split Preconditioned Inexact Newton Algorithms}, 8167 author = {Lulu Liu and David E Keyes}, 8168 journal = {SIAM Journal on Scientific Computing}, 8169 volume = {37}, 8170 number = {3}, 8171 pages = {A1388--A1409}, 8172 year = {2015}, 8173 publisher = {SIAM}, 8174 petsc_uses = {KSP} 8175} 8176 8177@Article{ lujiaomissirlis2014, 8178 title = {A hybrid geometric+ algebraic multigrid method with semi-iterative smoothers}, 8179 author = {Cao Lu and Xiangmin Jiao and Nikolaos Missirlis}, 8180 journal = {Numerical Linear Algebra with Applications}, 8181 volume = {21}, 8182 number = {2}, 8183 pages = {221--238}, 8184 year = {2014}, 8185 publisher = {Wiley Online Library}, 8186 petsc_uses = {KSP} 8187} 8188 8189@Article{ badiamartinprincipe2013, 8190 title = {Enhanced balancing Neumann-Neumann preconditioning in computational fluid and 8191 solid mechanics}, 8192 author = {Santiago Badia and Alberto F. Mart\'in and Javier Principe}, 8193 journal = {International Journal for Numerical Methods in Engineering}, 8194 volume = {96}, 8195 number = {4}, 8196 pages = {203--230}, 8197 year = {2013}, 8198 petsc_uses = {KSP} 8199} 8200 8201@Article{ morganknepleysananscott2016, 8202 title = {A Stochastic Performance Model for Pipelined {Krylov} Methods}, 8203 author = {Hannah Morgan and Matthew G. Knepley and Patrick Sanan and L. Ridgway Scott}, 8204 journal = {Concurrency and Computation: Practice and Experience}, 8205 volume = {28}, 8206 pages = {4532--4542}, 8207 year = {2016}, 8208 url = {http://arxiv.org/abs/1602.04873}, 8209 doi = {10.1002/cpe.3820}, 8210 petsc_uses = {KSP} 8211} 8212 8213@Article{ morgansananknepleymills2020, 8214 title = {Understanding performance variability in standard and pipelined parallel {Krylov} 8215 solvers}, 8216 author = {Hannah Morgan and Patrick Sanan and Matthew G. Knepley and Richard Tran Mills}, 8217 journal = {The International Journal of High Performance Computing Applications}, 8218 volume = {35}, 8219 issue = {1}, 8220 doi = {10.1177/1094342020966835}, 8221 url = {https://doi.org/10.1177/1094342020966835}, 8222 eprint = {https://doi.org/10.1177/1094342020966835}, 8223 year = {2020}, 8224 petsc_uses = {KSP} 8225} 8226 8227@Article{ msz2013, 8228 title = {Efficient Sparse Matrix-Matrix Products Using Colorings}, 8229 author = {M. McCourt and B. F. Smith and H. Zhang}, 8230 journal = {SIAM Journal on Matrix Analysis and Applications}, 8231 year = {2015}, 8232 note = {To appear}, 8233 petsc_uses = {KSP} 8234} 8235 8236@Article{ bassi2014agglomeration, 8237 title = {Agglomeration-based physical frame d{G} discretizations: {A}n attempt to be mesh 8238 free}, 8239 author = {Bassi, Francesco and Botti, Lorenzo and Colombo, Alessandro}, 8240 journal = {Mathematical Models and Methods in Applied Sciences}, 8241 volume = {24}, 8242 number = {08}, 8243 pages = {1495--1539}, 8244 year = {2014}, 8245 publisher = {World Scientific}, 8246 petsc_uses = {KSP} 8247} 8248 8249@Article{ jhuranidemkowicz12, 8250 author = {{Jhurani}, C. and {Demkowicz}, L.}, 8251 title = {{Multiscale modeling using goal-oriented adaptivity and numerical homogenization. 8252 Part II: Algorithms for the Moore-Penrose pseudoinverse}}, 8253 journal = {Computer Methods in Applied Mechanics and Engineering}, 8254 volume = {213}, 8255 pages = {418-426}, 8256 year = {2012}, 8257 month = mar, 8258 doi = {10.1016/j.cma.2011.06.003}, 8259 adsurl = {http://adsabs.harvard.edu/abs/2012CMAME.213..418J}, 8260 petsc_uses = {KSP} 8261} 8262 8263@Article{ yangcai11, 8264 author = {Yang, Haijian and Cai, Xiao-Chuan}, 8265 title = {Parallel Two-Grid Semismooth Newton-Krylov-Schwarz Method for Nonlinear 8266 Complementarity Problems}, 8267 journal = {J. Sci. Comput.}, 8268 issue_date = {May 2011}, 8269 volume = {47}, 8270 number = {2}, 8271 month = may, 8272 pages = {258--280}, 8273 year = {2011}, 8274 issn = {0885-7474}, 8275 numpages = {23}, 8276 doi = {10.1007/s10915-010-9436-4}, 8277 acmid = {1971246}, 8278 publisher = {Plenum Press}, 8279 address = {New York, NY, USA}, 8280 keywords = {Complementarity problem, Grid sequencing, Parallel computing, Schwarz 8281 preconditioners, Semismooth Newton, Two-level methods}, 8282 petsc_uses = {KSP} 8283} 8284 8285@Article{ rheinbach09, 8286 author = {Rheinbach, Oliver}, 8287 title = {Parallel Iterative Substructuring in Structural Mechanics}, 8288 journal = {Archives of Computational Methods in Engineering}, 8289 volume = {16}, 8290 number = {4}, 8291 pages = {425-463}, 8292 year = {2009}, 8293 issn = {1134-3060}, 8294 doi = {10.1007/s11831-009-9035-4}, 8295 publisher = {Springer Netherlands}, 8296 language = {English}, 8297 petsc_uses = {KSP} 8298} 8299 8300@Article{ knepleyterrel2013, 8301 author = {Matthew G. Knepley and Andy R. Terrel}, 8302 title = {Finite Element Integration on {GPUs}}, 8303 journal = {{ACM} Transactions on Mathematical Software}, 8304 volume = {39}, 8305 number = {2}, 8306 accepted = {17 April 2012}, 8307 year = {2013}, 8308 abstract = {We present a novel finite element integration method for low order elements on 8309 GPUs. We achieve more than 100GF for element integration on first order 8310 discretizations of both the Laplacian and Elasticity operators on an NVIDIA 8311 GTX285, which has a nominal single precision peak flop rate of 1 TF/s and 8312 bandwidth of 159 GB/s, corresponding to a bandwidth limited peak of 40 GF/s.}, 8313 url = {http://arxiv.org/abs/1103.0066}, 8314 note = {no. 10, \url{http://arxiv.org/abs/1103.0066}}, 8315 petsc_uses = {KSP} 8316} 8317 8318@Article{ knepleyruppterrel2016, 8319 title = {Finite Element Integration with Quadrature on the GPU}, 8320 journal = {ArXiv e-prints}, 8321 author = {Matthew G. Knepley and Karl Rupp and Andy R. Terrel}, 8322 version = {1}, 8323 date = {2016-07-14}, 8324 eprinttype = {arxiv}, 8325 eprintclass = {cs.MS}, 8326 eprint = {1607.04245v1}, 8327 petsc_uses = {KSP} 8328} 8329 8330@Article{ klawonnlanserrheinbach2014, 8331 title = {Nonlinear {FETI-DP} and {BDDC} Methods}, 8332 author = {Axel Klawonn and Martin Lanser and Oliver Rheinbach}, 8333 journal = {SIAM Journal on Scientific Computing}, 8334 volume = {36}, 8335 number = {2}, 8336 pages = {A737--A765}, 8337 year = {2014}, 8338 petsc_uses = {KSP} 8339} 8340 8341@TechReport{ pbmkbsxt2012, 8342 title = {Composing Scalable Nonlinear Algebraic Solvers}, 8343 author = {Peter R. Brune and Matthew G. Knepley and Barry F. Smith and Xuemin Tu}, 8344 year = {2013}, 8345 type = {Preprint}, 8346 number = {ANL/MCS-P2010-0112}, 8347 institution = {Argonne National Laboratory}, 8348 petsc_uses = {KSP} 8349} 8350 8351@Article{ bruneknepleysmithtu15, 8352 title = {Composing Scalable Nonlinear Algebraic Solvers}, 8353 author = {Peter R. Brune and Matthew G. Knepley and Barry F. Smith and Xuemin Tu}, 8354 journal = {SIAM Review}, 8355 volume = {57}, 8356 number = {4}, 8357 pages = {535--565}, 8358 note = {\url{http://www.mcs.anl.gov/papers/P2010-0112.pdf}}, 8359 url = {http://www.mcs.anl.gov/papers/P2010-0112.pdf}, 8360 doi = {10.1137/130936725}, 8361 year = {2015}, 8362 petsc_uses = {KSP} 8363} 8364 8365@Article{ mszm2014, 8366 title = {Hierarchical {Krylov} and nested {Krylov} methods for extreme-scale computing}, 8367 author = {Lois Curfman McInnes and Barry Smith and Hong Zhang and Richard Tran Mills}, 8368 volume = {40}, 8369 pages = {17--31}, 8370 year = {2014}, 8371 journal = {Parallel Computing}, 8372 doi = {10.1016/j.parco.2013.10.001}, 8373 petsc_uses = {KSP} 8374} 8375 8376@TechReport{ mszm2012, 8377 title = {Hierarchical {Krylov} and Nested {Krylov} Methods for Extreme-Scale Computing}, 8378 author = {Lois Curfman McInnes and Barry Smith and Hong Zhang and Richard Tran Mills}, 8379 year = {2012}, 8380 number = {ANL/MCS-P2097-0512}, 8381 institution = {Argonne National Laboratory}, 8382 petsc_uses = {KSP} 8383} 8384 8385@InProceedings{ bkmms2012, 8386 author = {Jed Brown and Matthew G. Knepley and David A. May and Lois C. McInnes and Barry 8387 F. Smith}, 8388 title = {Composable linear solvers for multiphysics}, 8389 booktitle = {Proceeedings of the 11th {International Symposium on Parallel and Distributed 8390 Computing} ({ISPDC} 2012)}, 8391 year = {2012}, 8392 doi = {10.1109/ISPDC.2012.16}, 8393 publisher = {IEEE Computer Society}, 8394 pages = {55--62}, 8395 petsc_uses = {KSP} 8396} 8397 8398@Article{ bourdinbucuroudet2009, 8399 author = {Blaise Bourdin and D. Bucur and E. Oudet}, 8400 title = {Optimal Partitions for Eigenvalues}, 8401 journal = {SIAM J. Sci. Comput.}, 8402 volume = {31}, 8403 number = {6}, 8404 pages = {4100--4114}, 8405 year = {2009}, 8406 petsc_uses = {KSP} 8407} 8408 8409@InBook{ kimnbourdin2007, 8410 author = {J.-H. Kimn and Blaise Bourdin}, 8411 title = {Numerical implementation of overlapping balancing domain decomposition methods on 8412 unstructured meshes}, 8413 editor = {O. B. Widlund and D. E. Keyes}, 8414 booktitle = {Domain Decomposition Methods in Science and Engineering XVI}, 8415 series = {Lecture Notes in Computational Science and Engineering}, 8416 number = {55}, 8417 publisher = {Springer-Verlag}, 8418 pages = {309--315}, 8419 url = {http://www.cims.nyu.edu/dd16/proceedings/kimn_bourdin_mini_6.pdf}, 8420 year = {2007}, 8421 petsc_uses = {KSP} 8422} 8423 8424@Article{ bjm2005, 8425 author = {AH Baker and ER Jessup and T Manteuffel}, 8426 title = {A Technique for Accelerating the Convergence of Restarted GMRES}, 8427 journal = {SIAM JOURNAL ON MATRIX ANALYSIS AND APPLICATIONS}, 8428 year = {2005}, 8429 petsc_uses = {KSP} 8430} 8431 8432@Unpublished{ sundar-2008a, 8433 author = {R.S. Sampath and G. Biros}, 8434 title = {A parallel geometric multigrid method for finite elements on octree meshes}, 8435 url = {http://www.seas.upenn.edu/\~{ }rahulss}, 8436 petsc_uses = {KSP} 8437} 8438 8439@Article{ sundar-2008, 8440 author = {H. Sundar and R.S. Sampath and G. Biros}, 8441 title = {Bottom-up construction and 2:1 balance refinement of linear octrees in parallel}, 8442 journal = {SIAM Journal on Scientific Computing}, 8443 year = {2008}, 8444 url = {http://www.seas.upenn.edu/\~{ }rahulss}, 8445 petsc_uses = {KSP} 8446} 8447 8448@InProceedings{ sundar-2007, 8449 author = {H. Sundar and R.S. Sampath and S.S. Adavani and C. Davatzikos and G. Biros}, 8450 title = {Low-constant parallel algorithms for finite element simulations using linear 8451 octrees}, 8452 booktitle = {SC'07: ACM/IEEE Conference on Supercomputing}, 8453 year = {2007}, 8454 url = {http://www.seas.upenn.edu/\~{ }rahulss}, 8455 petsc_uses = {KSP} 8456} 8457 8458@InProceedings{ adams-98a, 8459 author = {Adams, Mark ~F.}, 8460 title = {A Parallel Maximal Independent Set Algorithm}, 8461 booktitle = {Proceedings 5th copper mountain conference on iterative methods}, 8462 year = {1998}, 8463 petsc_uses = {KSP} 8464} 8465 8466@Article{ akcelik2005ddd, 8467 title = {{Dynamic data-driven inversion for terascale simulations: real-time 8468 identification of airborne contaminants}}, 8469 author = {Ak\c{c}elik, V. and Biros, G. and Draganescu, A. and Hill, J. and Ghattas, O. and 8470 van Bloemen Waanders, B.}, 8471 journal = {Proceedings of the 2005 ACM/IEEE conference on Supercomputing}, 8472 year = {2005}, 8473 publisher = {IEEE Computer Society Washington, DC, USA}, 8474 petsc_uses = {KSP} 8475} 8476 8477@InBook{ akcelik-2006, 8478 author = {V. Akcelik and G. Biros and Omar Ghattas and J. Hill and David Keyes and B. van 8479 Bloemen Waanders}, 8480 bookeditor = {M. Heroux and P. Raghaven and H. Simon}, 8481 title = {Frontiers of Parallel Computing}, 8482 chapter = {Parallel algorithms for {PDE}-constrained optimization}, 8483 publisher = {SIAM}, 8484 year = {2006}, 8485 petsc_uses = {KSP} 8486} 8487 8488@Article{ dt, 8489 author = {Matthew F. Dixon and C. J. Kenneth Tan}, 8490 title = {Using Distributed Computers to Deterministically Approximate Higher Dimensional 8491 Convection Diffusion Equations}, 8492 journal = {The Journal of Supercomputing}, 8493 year = {2004}, 8494 pages = {235--253}, 8495 volume = {28}, 8496 url = {http://www.springerlink.com/(nekina45nmdgrib5izizn3ip)/app/home/contribution.asp?referrer=parent&backto=issue,8,8;journal,20,73;linkingpublicationresults,1:100302,1}, 8497 petsc_uses = {KSP} 8498} 8499 8500@PhDThesis{ hwang2004, 8501 author = {Feng-Nan Hwang}, 8502 title = {Some Parallel Linear and Nonlinear {Schwarz} Methods with Applications in 8503 Computational Fluid Dynamics}, 8504 school = {University of Colorado at Boulder}, 8505 year = {2004}, 8506 petsc_uses = {KSP} 8507} 8508 8509@PhDThesis{ baker, 8510 author = {{A. H.} Baker}, 8511 title = {On improving the performance of the linear solver restarted {GMRES}}, 8512 school = {University of Colorado at Boulder}, 8513 year = {2003}, 8514 petsc_uses = {KSP} 8515} 8516 8517@TechReport{ klawonnrheinbach601, 8518 author = {Axel Klawonn and Oliver Rheinbach}, 8519 title = {A Parallel Implementation of Dual-Primal FETI-DP Methods for Three Dimensional 8520 Linear Elasticity Using a Transformation of Basis}, 8521 institution = {Universit\"at Duisburg-Essen}, 8522 year = {2005}, 8523 type = {Technical Report}, 8524 number = {SM-E-601}, 8525 petsc_uses = {KSP} 8526} 8527 8528@TechReport{ klawonnrheinbach609, 8529 author = {Axel Klawonn and Oliver Rheinbach}, 8530 title = {Inexact FETI-DP Methods}, 8531 institution = {Universit\"at Duisburg-Essen}, 8532 year = {2005}, 8533 type = {Technical Report}, 8534 number = {SM-E-609}, 8535 petsc_uses = {KSP} 8536} 8537 8538@TechReport{ klawonnrheinbach607, 8539 author = {Axel Klawonn and Oliver Rheinbach}, 8540 title = {Robust FETI-DP Methods for Heterogeneous Three Dimensional Elasticity Problems}, 8541 institution = {Universit\"at Duisburg-Essen}, 8542 year = {2005}, 8543 type = {Technical Report}, 8544 number = {SM-E-607}, 8545 petsc_uses = {KSP} 8546} 8547 8548@Article{ kul-natraj-pbp, 8549 author = {Kshitij Kulshreshtha and Neela Nataraj and Michael Jung}, 8550 title = {Performance of a parallel mixed finite element implementation for fourth order 8551 clamped anisotropic plate bending problems in distributed memory environments}, 8552 journal = {Applied Mathematics and Computation}, 8553 volume = {155}, 8554 year = {2004}, 8555 number = {3}, 8556 pages = {753--777}, 8557 petsc_uses = {KSP} 8558} 8559 8560@Article{ bramkamp2006uej, 8561 author = {F. D. Bramkamp and H. M. B{\"u}cker and A. Rasch}, 8562 title = {Using Exact {J}acobians in an Implicit {N}ewton-{K}rylov Method}, 8563 journal = {Computers \& Fluids}, 8564 volume = {35}, 8565 number = {10}, 8566 pages = {1063--1073}, 8567 doi = {10.1016/j.compfluid.2005.10.003}, 8568 abstract = {In an implicit Newton-Krylov method for inviscid, compressible fluid flow, the 8569 derivation of the analytic flux Jacobian can become quite complicated depending on 8570 the complexity of the numerical flux calculation. Practically, the derivation of 8571 the exact Jacobian by hand is an unrealistic option because of the enormous 8572 man-hour investment needed. In this work, automatic differentiation is used to 8573 evaluate the exact Jacobian of upwind schemes implemented in the flow solver 8574 QUADFLOW. We compare the use of exact Jacobians and Jacobians numerically 8575 approximated by first-order forward differences. For a two-dimensional airfoil 8576 under three different flight conditions (quasi-incompressible flow, compressible 8577 subsonic flow, and transonic flow), we show that the robustness and performance of 8578 the present finite volume scheme is significantly improved by using exact 8579 Jacobians.}, 8580 year = {2006}, 8581 petsc_uses = {KSP} 8582} 8583 8584@Article{ shahbazi1, 8585 author = {Khosro Shahbazi}, 8586 title = {An explicit expression for the penalty parameter of the interior penalty method}, 8587 journal = {Journal of Computational Physics}, 8588 volume = {205}, 8589 year = {2005}, 8590 pages = {401--407}, 8591 petsc_uses = {KSP} 8592} 8593 8594@TechReport{ kk, 8595 title = {A Parallel Lanczos Algorithm for Eigensystem Calculation}, 8596 author = {Hans-Peter Kersken and Uwe Kuster}, 8597 year = {1999}, 8598 institution = {University of Stuttgart}, 8599 url = {http://elib.uni-stuttgart.de/opus/volltexte/1999/310/pdf/310.pdf}, 8600 number = {310}, 8601 petsc_uses = {KSP} 8602} 8603 8604@Article{ miha-mija, 8605 author = {M. D. Mihajlovi and S. Mijalkovi}, 8606 title = {A component decomposition preconditioning for 3D stress analysis problems}, 8607 journal = {Numerical Linear Algebra with Applications}, 8608 volume = {9}, 8609 year = {2002}, 8610 pages = {567--583}, 8611 url = {http://www3.interscience.wiley.com/cgi-bin/abstract/98516459/ABSTRACT}, 8612 petsc_uses = {KSP} 8613} 8614 8615@Article{ bjm, 8616 author = {M Benzi and W Joubert and G Mateescu}, 8617 journal = {Electronic Transactions on Numerical Analysis}, 8618 year = {1999}, 8619 volume = {8}, 8620 pages = {88--114}, 8621 title = {Numerical experiments with parallel orderings for {ILU} preconditioners}, 8622 url = {http://scholar.google.com/url?sa=U&q=http://emis.bibl.cwi.nl/journals/ETNA/vol.8.1999/pp88-114.dir/pp88-114.ps}, 8623 petsc_uses = {KSP} 8624} 8625 8626@PhDThesis{ hyde, 8627 author = {EMK Hyde}, 8628 title = {Fast, High-Order Methods for Scattering by Inhomogeneous Media}, 8629 school = {Caltech}, 8630 year = {2003}, 8631 url = {http://www.acm.caltech.edu/\~{ }bruno/02hyde_thesis_print.pdf}, 8632 petsc_uses = {KSP} 8633} 8634 8635@Article{ km2003, 8636 author = {A. Keese and H. G. Matthies}, 8637 journal = {Proceedings in Applied Mathematics and Mechanics}, 8638 year = {2003}, 8639 volume = {2}, 8640 pages = {485--486}, 8641 title = {Parallel Solution of Stochastic PDEs}, 8642 url = {http://www3.interscience.wiley.com/cgi-bin/abstract/104087421/ABSTRACT}, 8643 petsc_uses = {KSP} 8644} 8645 8646@Article{ whszss, 8647 author = {Joachim Weickert and Josef Heers and Christoph Schnorr and Karel J. Zuiderveld 8648 and Otmar Scherzer and H. Siegfried Stiehl}, 8649 journal = {Real Time Imaging}, 8650 year = {2001}, 8651 volume = {7}, 8652 pages = {31--45}, 8653 title = {Fast parallel algorithms for a broad class of nonlinear variational diffusion 8654 approaches}, 8655 url = {http://www.mia.uni-saarland.de/weickert/Papers/TR_5_99.ps.gz}, 8656 petsc_uses = {KSP} 8657} 8658 8659@TechReport{ baker1, 8660 title = {An Efficient Block Variant of GMRES}, 8661 author = {A. H. Baker and J. M. Dennis and E. R. Jessup}, 8662 year = {2003}, 8663 type = {Technical Report}, 8664 institution = {University of Colorado, Boulder}, 8665 url = {http://www.scd.ucar.edu/css/staff/dennis/papers/block.pdf}, 8666 number = {CU-CS-957-03}, 8667 petsc_uses = {KSP} 8668} 8669 8670@InProceedings{ mc2003, 8671 author = {Leszek Marcinkowski and Xiao-Chuan Cai}, 8672 title = {Parallel Performance of Some Two-Level {ASPIN} Algorithms}, 8673 booktitle = {Proceedings of the 15th International Conference on Domain Decomposition 8674 Methods}, 8675 pages = {639--646}, 8676 publisher = {Springer, Lecture Notes in Computational Science and Engineering (LNCSE).}, 8677 note = {}, 8678 url = {http://www.ddm.org/DD15/proceedings-dd15.html}, 8679 year = {2003}, 8680 petsc_uses = {KSP} 8681} 8682 8683@InProceedings{ kt2003, 8684 author = {Deepak V. Kulkarni and Daniel A. Tortorelli}, 8685 title = {A Domain Decomposition Based Two-Level Newton Scheme for Nonlinear Problems}, 8686 booktitle = {Proceedings of the 15th International Conference on Domain Decomposition 8687 Methods}, 8688 pages = {615--622}, 8689 publisher = {Springer, Lecture Notes in Computational Science and Engineering (LNCSE).}, 8690 note = {}, 8691 url = {http://www.ddm.org/DD15/proceedings-dd15.html}, 8692 year = {2003}, 8693 petsc_uses = {KSP} 8694} 8695 8696@InProceedings{ krw2003, 8697 author = {Axel Klawonn and Oliver Rheinbach and Olof B. Widlund}, 8698 title = {Some Computational Results for Dual-Primal FETI Methods for Elliptic Problems in 8699 3D}, 8700 booktitle = {Proceedings of the 15th International Conference on Domain Decomposition 8701 Methods}, 8702 pages = {361--368}, 8703 publisher = {Springer, Lecture Notes in Computational Science and Engineering (LNCSE).}, 8704 note = {}, 8705 url = {http://www.ddm.org/DD15/proceedings-dd15.html}, 8706 year = {2003}, 8707 petsc_uses = {KSP} 8708} 8709 8710@InProceedings{ hc2003, 8711 author = {Feng-Nan Hwang and Xiao-Chuan Cai}, 8712 title = {Improving Robustness and Parallel Scalability of {Newton's} Method Through 8713 Nonlinear Preconditioning}, 8714 booktitle = {Proceedings of the 15th International Conference on Domain Decomposition 8715 Methods}, 8716 pages = {201--208}, 8717 publisher = {Springer, Lecture Notes in Computational Science and Engineering (LNCSE).}, 8718 note = {}, 8719 url = {http://www.ddm.org/DD15/proceedings-dd15.html}, 8720 year = {2003}, 8721 petsc_uses = {KSP} 8722} 8723 8724@InProceedings{ g2003, 8725 author = {P. Goldfeld}, 8726 title = {Balancing {Neumann-Neumann} for (In)Compressible Linear Elasticity and 8727 (Generalized) {Stokes} and Parallel Implementation}, 8728 booktitle = {Proceedings of the 14th International Conference on Domain Decomposition 8729 Methods}, 8730 pages = {209--216}, 8731 editor = {I. Herrera and D. Keyes and O. Widlund and R. Yates}, 8732 publisher = {National Autonomous University of Mexico (UNAM)}, 8733 note = {}, 8734 url = {http://www.ddm.org/DD14}, 8735 year = {2003}, 8736 petsc_uses = {KSP} 8737} 8738 8739@InProceedings{ dhv2003, 8740 author = {Zdenek Dostal and David Horak and Oldrich Vlach}, 8741 title = {Toward scalable FETI algorithm for variational inequalities with applications to 8742 composites}, 8743 booktitle = {Proceedings of the 14th International Conference on Domain Decomposition 8744 Methods}, 8745 pages = {395--401}, 8746 editor = {I. Herrera and D. Keyes and O. Widlund and R. Yates}, 8747 publisher = {National Autonomous University of Mexico (UNAM)}, 8748 note = {}, 8749 url = {http://www.ddm.org/DD14}, 8750 year = {2003}, 8751 petsc_uses = {KSP} 8752} 8753 8754@InProceedings{ dhsv2002, 8755 author = {Zdenek Dostal and David Horak and Jan Szweda and Vit Vondrak}, 8756 title = {Scalabilities of FETI for variational inequalities and contact shape 8757 optimization}, 8758 booktitle = {Proceedings of the 13th International Conference on Domain Decomposition 8759 Methods}, 8760 pages = {359--367}, 8761 editor = {N. Debit and M.Garbey and R. Hoppe and J. Periaux and D. Keyes and Y. Kuznetsov}, 8762 publisher = {CIMNE, Barcelona, Spain}, 8763 note = {}, 8764 url = {http://www.ddm.org/DD13}, 8765 year = {2002}, 8766 petsc_uses = {KSP} 8767} 8768 8769@InProceedings{ cky2002, 8770 author = {Xiao-Chuan Cai and David E. Keyes and David P. Young}, 8771 title = {A Nonlinear Additive Schwarz Preconditioned Inexact Newton Method for Shocked 8772 Duct Flows}, 8773 booktitle = {Proceedings of the 13th International Conference on Domain Decomposition 8774 Methods}, 8775 pages = {343--350}, 8776 editor = {N. Debit and M.Garbey and R. Hoppe and J. Periaux and D. Keyes and Y. Kuznetsov}, 8777 publisher = {CIMNE, Barcelona, Spain}, 8778 note = {}, 8779 url = {http://www.ddm.org/DD13}, 8780 year = {2002}, 8781 petsc_uses = {KSP} 8782} 8783 8784@Conference{ li-etal:03, 8785 author = {Li, Z. and Lanteri S. and Saad, Y.}, 8786 title = {Multiplicative-additive preconditioning combination for general sparse linear 8787 systems}, 8788 booktitle = {2003 International Conference on Preconditioning Techniques for Large Sparse 8789 Matrix Problems in Scientific and Industrial Applications}, 8790 address = {Napa, California, USA}, 8791 date = {october 27-29}, 8792 year = {2003}, 8793 petsc_uses = {KSP} 8794} 8795 8796@Article{ bashir2008hessian, 8797 title = {Hessian-based model reduction for large-scale systems with initial-condition 8798 inputs}, 8799 author = {Bashir, O. and Willcox, K. and Ghattas, O. and van Bloemen Waanders, B. and Hill, 8800 J.}, 8801 journal = {International journal for numerical methods in engineering}, 8802 volume = {73}, 8803 number = {6}, 8804 pages = {844--868}, 8805 year = {2008}, 8806 publisher = {Wiley Online Library}, 8807 petsc_uses = {KSP} 8808} 8809 8810@Article{ bashir2007hessian, 8811 title = {Hessian-Based Model Reduction for Large-Scale Data Assimilation Problems}, 8812 author = {Bashir, O. and Ghattas, O. and Hill, J. and van Bloemen Waanders, B. and Willcox, 8813 K.}, 8814 journal = {Computational Science--ICCS 2007}, 8815 pages = {1010--1017}, 8816 year = {2007}, 8817 publisher = {Springer}, 8818 petsc_uses = {KSP} 8819} 8820 8821@Article{ akcelik2011fast, 8822 title = {Fast algorithms for {B}ayesian uncertainty quantification in large-scale linear 8823 inverse problems based on low-rank partial {H}essian approximations}, 8824 author = {Ak\c{c}elik, V. and Flath, H.P. and Ghattas, O. and Hill, J. and van Bloemen 8825 Waanders, B. and Wilcox, L.}, 8826 journal = {SIAM Journal on Scientific Computing}, 8827 volume = {33}, 8828 number = {1}, 8829 year = {2011}, 8830 petsc_uses = {KSP} 8831} 8832 8833@InProceedings{ ff2003, 8834 author = {Abul K. M. Fahimuddin and Heike Fassbender}, 8835 title = {Model Reduction for Large Scale Applications in Microsystem Technology}, 8836 booktitle = {Proceedings of the 2004 SIAM Parallel Processing Conference}, 8837 year = {2003}, 8838 petsc_uses = {KSP} 8839} 8840 8841@InProceedings{ d2b2004, 8842 author = {Masoud Darbandi and Gerry E. Schneider and Seyed Mehi Bostandoost}, 8843 title = {Parallel Computation of a Fully Implicit Finite Volume Method Using Different 8844 Ordering Strategies}, 8845 booktitle = {Proceedings of AIAA Conference, Reno, Nevada}, 8846 year = {2004}, 8847 petsc_uses = {KSP} 8848} 8849 8850@InProceedings{ d2v2005, 8851 author = {Masoud Darbandi and Gerry E. Schneider and Soheyl Vakili}, 8852 title = {A Comparative Study of Preconditioned Methods for Solving Fully Coupled Fluid 8853 Flow Equations}, 8854 booktitle = {The 13th Annual Conference on Computational Fluid Dynamics}, 8855 year = {2005}, 8856 petsc_uses = {KSP} 8857} 8858 8859@InProceedings{ dvs2006, 8860 author = {Masoud Darbandi and Soheyl Vakili and Gerry E. Schneider}, 8861 title = {The Employment of Algebraic Multigrid as a Preconditioner to Solve Fully Implicit 8862 Mixed Convection Equations}, 8863 booktitle = { The 44th AIAA Aerospace Sciences Meeting and Exhibit}, 8864 year = {2006}, 8865 petsc_uses = {KSP} 8866} 8867 8868@Article{ dsv2006, 8869 author = {Masoud Darbandi and Gerry E. Schneider and Soheyl Vakili}, 8870 title = {Using Different Preconditioned Krylov Subspace Methods to Solve Coupled Fluid 8871 Flow Equations}, 8872 journal = {Computational Fluid Dynamics}, 8873 year = {2006}, 8874 volume = {15}, 8875 number = {1}, 8876 petsc_uses = {KSP} 8877} 8878 8879@Article{ lahaye03, 8880 author = {Lahaye, D. and Vandewalle, S. and Hameyer, K.}, 8881 title = {An Algebraic Multilevel Preconditioner for Field-Circuit Coupled Problems}, 8882 journal = {J. Comput. Appl. Math.}, 8883 year = {2004}, 8884 pages = {267--275}, 8885 volume = {168}, 8886 petsc_uses = {KSP} 8887} 8888 8889@TechReport{ brmn, 8890 title = {Faster {PDE}-based Simulations Using Robust Composite Linear Solvers}, 8891 author = {S. Bhowmick and P. Raghavan and L. McInnes and B. Norris}, 8892 year = {2002}, 8893 type = {Technical Report}, 8894 institution = {ANL}, 8895 number = {ANL/MCS-P993-0902}, 8896 note = {To appear in Future Generation Computer Systems}, 8897 petsc_uses = {KSP} 8898} 8899 8900@InProceedings{ mnbr, 8901 author = {L. McInnes and B. Norris and S. Bhowmick and P. Raghavan}, 8902 title = {Adaptive Sparse Linear Solvers for Implicit {CFD} Using {Newton-Krylov} 8903 Algorithms}, 8904 booktitle = {Proceedings of the Second MIT Conference on Computational Fluid and Solid 8905 Mechanics}, 8906 year = {2003}, 8907 petsc_uses = {KSP} 8908} 8909 8910@InProceedings{ bmnr, 8911 author = {S. Bhowmick and L. McInnes and B. Norris and P. Raghavan}, 8912 title = {The Role of Multi-Method Linear Solvers in {PDE}-based Simulations}, 8913 booktitle = {Proceedings of the 2003 International Conference on Computational Science and its 8914 Applications, Lecture notes in Computer Science 2677}, 8915 editor = {V. Kumar and M. L. Gavrilova and C. J. K. Tan and P. L'Ecuyer}, 8916 pages = {828--839}, 8917 year = {2003}, 8918 petsc_uses = {KSP} 8919} 8920 8921@Article{ ph03, 8922 author = {M. Pernice and R. D. Hornung}, 8923 title = {Newton-Krylov-FAC Methods for Problems Discretized on Locally Refined Grids}, 8924 journal = {Computing and Visualization in Science}, 8925 year = {2003}, 8926 lab = {LANL}, 8927 petsc_uses = {KSP} 8928} 8929 8930@Article{ adams-02, 8931 author = {Adams, M.~F. and Brezina, M. and Hu, J. J. and Tuminaro, R. S}, 8932 journal = {J. Comp. Phys.}, 8933 number = {2}, 8934 pages = {593-610}, 8935 title = {Parallel multigrid smoothing: polynomial versus {G}auss--{S}eidel}, 8936 volume = {188}, 8937 year = {2003}, 8938 petsc_uses = {KSP} 8939} 8940 8941@InProceedings{ adams2001distributed, 8942 title = {A distributed memory unstructured {G}auss-{S}eidel algorithm for multigrid 8943 smoothers}, 8944 author = {Adams, M.F.}, 8945 booktitle = {Supercomputing, ACM/IEEE 2001 Conference}, 8946 pages = {14--14}, 8947 year = {2001}, 8948 organization = {IEEE}, 8949 petsc_uses = {KSP} 8950} 8951 8952@PhDThesis{ els01, 8953 author = {Ulrich Elsner}, 8954 title = {Static and Dynamic Graph Partitioning. A comparative study of existing 8955 algorithms}, 8956 school = {Technical University Chemnitz}, 8957 year = {2002}, 8958 publisher = {Logos Verlag, Berlin}, 8959 isbn = {3-89722-923-4}, 8960 annote = {Uses PETSc's high quality parallel algorithms to provide a framework to compare 8961 different graph partitioning algorithms}, 8962 petsc_uses = {KSP} 8963} 8964 8965@TechReport{ ckk02, 8966 title = {Pseudo-Transient Continuation and Differential-Algebraic Equations}, 8967 author = {Todd S. Coffey and C. T. Kelley and David E. Keyes}, 8968 year = {2002}, 8969 type = {Technical Report}, 8970 institution = {ODU}, 8971 url = {http://www.math.odu.edu/\~{ }keyes}, 8972 note = {Submitted to the special issue of the SIAM Journal of Scientific Computing 8973 dedicated to papers from the 2002 Copper Mountain Conference on Iterative 8974 Methods}, 8975 petsc_uses = {KSP} 8976} 8977 8978@Article{ gpw2002, 8979 title = {Balancing Neumann-Neumann Preconditioners for Mixed Approximations of 8980 Heterogeneous Problems in Linear Elasticity}, 8981 author = {Paulo Goldfeld and Luca F. Pavarino and Olof B. Widlund}, 8982 year = {2003}, 8983 pages = {283--324}, 8984 volume = {95}, 8985 url = {http://www.cs.nyu.edu/csweb/Research/TechReports/TR2002-825/TR2002-825.pdf}, 8986 journal = {Numerische Mathematik}, 8987 petsc_uses = {KSP} 8988} 8989 8990@Article{ dh1, 8991 title = {Scalability and FETI based algorithm for large discretized variational 8992 inequalities}, 8993 author = {Z Dostal and D Horak}, 8994 year = {2003}, 8995 pages = {347--357}, 8996 volume = {61}, 8997 url = {http://portal.acm.org/citation.cfm?id=770222.770239}, 8998 journal = {Mathematics and Computers in Simulation}, 8999 petsc_uses = {KSP} 9000} 9001 9002@InProceedings{ dhsv1, 9003 author = {Zdenek Dostal and David Horak and Jan Szweda and Vit Vondrak}, 9004 url = {http://cdcsp.univ-lyon1.fr/\~{ }dd13/DD13proc/Dostal.pdf}, 9005 title = {36 Scalabilities of FETI for Variational Inequalities and Contact Shape 9006 Optimization}, 9007 booktitle = {Proceedings of the 13th International Conference on Domain Decomposition 9008 Methods}, 9009 editor = { N. Debit and M. Garbey and R. Hoppe and J. Periaus and D. Keyes and Y. 9010 Kuznetsov}, 9011 petsc_uses = {KSP} 9012} 9013 9014@Article{ lahaye02, 9015 author = {Domenico Lahaye and S. Vandewalle and K. Hameyer}, 9016 title = {An Algebraic Multilevel Preconditioner for Field-Circuit Coupled Problems}, 9017 journal = {IEEEMAGN}, 9018 year = {2002}, 9019 volume = {38}, 9020 number = {2}, 9021 pages = {413-416}, 9022 petsc_uses = {KSP} 9023} 9024 9025@Article{ ckm01, 9026 author = {X.-C. Cai and D. E. Keyes and L. Marcinkowski}, 9027 url = {http://www.cs.colorado.edu/homes/cai/public_html/papers/10page.ps}, 9028 title = {Nonlinear additive {Schwarz} preconditioners and applications in computational 9029 fluid dynamics}, 9030 journal = {International Journal of Numerical Methods in Fluid Mechanics}, 9031 year = {2002}, 9032 volume = {40}, 9033 pages = {1463--1470}, 9034 petsc_uses = {KSP} 9035} 9036 9037@InProceedings{ cky01, 9038 author = {X.-C. Cai and D. E. Keyes and D. P. Young}, 9039 url = {http://www.cs.colorado.edu/homes/cai/public_html/papers/dd13_1d.ps}, 9040 title = {A nonlinear additive {Schwarz} preconditioned inexact {Newton} method for shocked 9041 duct flow}, 9042 booktitle = {Proceedings of the 13th International Conference on Domain Decomposition 9043 Methods}, 9044 editor = { N. Debit and M. Garbey and R. Hoppe and J. Periaus and D. Keyes and Y. 9045 Kuznetsov}, 9046 year = {2002}, 9047 petsc_uses = {KSP} 9048} 9049 9050@Article{ ck02, 9051 author = {X.-C. Cai and D. E. Keyes}, 9052 url = {http://www.cs.colorado.edu/homes/cai/public_html/papers/aspin.ps}, 9053 title = {Nonlinearly preconditioned inexact {Newton} algorithms}, 9054 journal = {SIAM J. Sci. Comput.}, 9055 year = {2002}, 9056 pages = {183--200}, 9057 volume = {24}, 9058 petsc_uses = {KSP} 9059} 9060 9061@Article{ c04, 9062 author = {Feng-Nan Hwang and X.-C. Cai}, 9063 url = {http://amath.colorado.edu/student/hwangf/papers/one-level-aspin.pdf}, 9064 title = {A parallel nonlinear additive {Schwarz} preconditioned inexact {Newton} algorithm 9065 for incompressible {Navier-Stokes} equations}, 9066 journal = {Journal of Computational Physics}, 9067 year = {2005}, 9068 volume = {204}, 9069 pages = {666--691}, 9070 petsc_uses = {KSP} 9071} 9072 9073@Article{ hc06, 9074 author = {Feng-Nan Hwang and X.-C. Cai}, 9075 url = {http://www.cs.colorado.edu/\~{ }cai/papers/aspin2_06.pdf}, 9076 title = {A Class of Parallel Two-Level Nonlinear {Schwarz} Preconditioned Inexact {Newton} 9077 Algorithms}, 9078 journal = {Computer Methods in Applied Mechanics and Engineering}, 9079 year = {2006}, 9080 volume = {196}, 9081 pages = {1603--1611}, 9082 petsc_uses = {KSP} 9083} 9084 9085@InProceedings{ adams-01, 9086 author = {Mark F. Adams}, 9087 title = {A Distributed Memory Unstructured {G}auss-{S}eidel Algorithm for Multigrid 9088 Smoothers}, 9089 booktitle = {ACM/IEEE Proceedings of SC2001: High Performance Networking and Computing}, 9090 address = {Denver, Colorado}, 9091 month = nov, 9092 year = {2001}, 9093 petsc_uses = {KSP} 9094} 9095 9096@Book{ 1dl, 9097 author = {Domenico Lahaye}, 9098 title = {Algebraic Multigrid for Two Dimensional Time-Harmonic Magnetic Field 9099 Computations}, 9100 year = {2001}, 9101 publisher = {Katholieke Universiteit Leuven}, 9102 notes = {Thesis}, 9103 petsc_uses = {KSP} 9104} 9105 9106@Article{ adams-00, 9107 author = {Adams, M.~F.}, 9108 journal = {International Journal for Numerical Methods in Engineering}, 9109 number = {8}, 9110 pages = {1241-1262}, 9111 title = {Parallel Multigrid Solvers for 3{D} Unstructured Finite Element Problems in Large 9112 Deformation Elasticity and Plasticity}, 9113 volume = {48}, 9114 year = {2000}, 9115 petsc_uses = {KSP} 9116} 9117 9118@Article{ adams2002evaluation, 9119 author = {Adams, M.~F.}, 9120 journal = {International Journal for Numerical Methods in Engineering}, 9121 number = {1}, 9122 pages = {519-534}, 9123 title = {Evaluation of Three Unstructured Multigrid Methods on 3{D} Finite Element 9124 Problems in Solid Mechanics}, 9125 volume = {55}, 9126 year = {2002}, 9127 petsc_uses = {KSP} 9128} 9129 9130@Article{ lahaye00, 9131 author = {Domenico Lahaye and De Gersem, H. and Vandewalle, S. and Hameyer, K.}, 9132 title = {Algebraic Multigrid for Complex Symmetric Systems}, 9133 journal = {IEEEMAGN}, 9134 year = {2000}, 9135 volume = {36}, 9136 number = {4}, 9137 pages = {1535--1538}, 9138 petsc_uses = {KSP} 9139} 9140 9141@InProceedings{ adams-99c, 9142 author = {Mark F. Adams and J. Demmel}, 9143 title = {Parallel Multigrid Solver Algorithms and Implementations for 3{D} Unstructured 9144 Finite Element Problems}, 9145 booktitle = {Proceedings of SC99: High Performance Networking and Computing}, 9146 address = {Portland, Oregon}, 9147 month = nov, 9148 year = {1999}, 9149 petsc_uses = {KSP} 9150} 9151 9152@Article{ chan95, 9153 author = {T. Chan and B. Smith and J. Zou}, 9154 title = {Overlapping {S}chwarz Methods on Unstructured Meshes using Non-matching Coarse 9155 Grids}, 9156 journal = {Numer. Math.}, 9157 year = {1995}, 9158 volume = {73}, 9159 pages = {149--167}, 9160 petsc_uses = {KSP} 9161} 9162 9163@TechReport{ adams-csd-98-993, 9164 pages = {11}, 9165 year = {1998}, 9166 type = {Technical Report}, 9167 number = {CSD-98-993}, 9168 institution = {University of California, Berkeley}, 9169 title = {A Parallel Maximal Independent Set Algorithm}, 9170 bibdate = {March 11, 1998}, 9171 author = {Mark F. Adams and James Demmel}, 9172 abstract = {The parallel construction of maximal independent sets is a useful building block 9173 for many algorithms in the computational sciences, including graph coloring and 9174 multigrid coarse grid creation on unstructured meshes. We present an efficient 9175 asynchronous maximal independent set algorithm for use on parallel computers, for 9176 ``well partitioned'' graphs, that arise from finite element (FE) models. For 9177 appropriately partitioned bounded degree graphs, it is shown that the running time 9178 of our algorithm under the P-RAM computational model is of $O(1)$, which is an 9179 improvement over the previous best P-RAM complexity for this class of graphs. We 9180 present numerical experiments on an IBM SP, that confirm our P-RAM complexity 9181 model is indicative of the performance one can expect with practical partitions on 9182 graphs from FE problems.}, 9183 month = mar, 9184 petsc_uses = {KSP} 9185} 9186 9187@TechReport{ k676, 9188 year = {1994}, 9189 type = {Technical Report}, 9190 number = {TR1994-676}, 9191 institution = {New York University}, 9192 title = {An Optimal Preconditioner for a Class of Saddle Point Problems with a Penalty 9193 Term}, 9194 author = {Axel Klawonn}, 9195 url = {http://www.cs.nyu.edu/csweb/Research/TechReports/TR1994-676/TR1994-676.pdf}, 9196 petsc_uses = {KSP} 9197} 9198 9199@Book{ ak1, 9200 author = {Axel Klawonn}, 9201 title = {Preconditioners for Indefinite Problems}, 9202 year = {1995}, 9203 publisher = {Westfalishen Wilhelms-Universitat Munster}, 9204 url = {http://www.cs.nyu.edu/csweb/Research/TechReports/TR1996-716/TR1996-716.pdf}, 9205 notes = {Thesis}, 9206 petsc_uses = {KSP} 9207} 9208 9209@TechReport{ knepleykarpeev05, 9210 pages = {41}, 9211 year = {2005}, 9212 type = {Technical Report}, 9213 number = {ANL/MCS-P1295-1005}, 9214 institution = {Argonne National Laboratory}, 9215 title = {Flexible Representation of Computational Meshes}, 9216 author = {Matthew G. Knepley and Dmitry A. Karpeev}, 9217 abstract = {}, 9218 url = {ftp://info.mcs.anl.gov/pub/tech_reports/reports/P1295.pdf}, 9219 note = {\url{ftp://info.mcs.anl.gov/pub/tech_reports/reports/P1295.pdf}}, 9220 month = oct, 9221 petsc_uses = {DMPlex} 9222} 9223 9224@TechReport{ knepleykarpeev07a, 9225 pages = {14}, 9226 year = {2007}, 9227 type = {Technical Report}, 9228 number = {ANL/MCS-P1455-0907}, 9229 institution = {Argonne National Laboratory}, 9230 title = {Mesh Algorithms for {PDE} with {Sieve} {I}: {Mesh} Distribution}, 9231 author = {Matthew G. Knepley and Dmitry A. Karpeev}, 9232 abstract = {}, 9233 url = {ftp://info.mcs.anl.gov/pub/tech_reports/reports/P1455.pdf}, 9234 note = {\url{ftp://info.mcs.anl.gov/pub/tech_reports/reports/P1455.pdf}}, 9235 month = feb, 9236 petsc_uses = {DMPlex} 9237} 9238 9239@Article{ knepleykarpeev09, 9240 author = {Matthew G. Knepley and Dmitry A. Karpeev}, 9241 title = {Mesh Algorithms for {PDE} with {Sieve} {I}: {Mesh} Distribution}, 9242 journal = {Scientific Programming}, 9243 volume = {17}, 9244 number = {3}, 9245 pages = {215--230}, 9246 year = {2009}, 9247 doi = {10.3233/SPR-2009-0249}, 9248 url = {http://arxiv.org/abs/0908.4427}, 9249 note = {\url{http://arxiv.org/abs/0908.4427}}, 9250 petsc_uses = {DMPlex} 9251} 9252 9253@Article{ biezuner2012computing, 9254 author = {Biezuner, Rodney and Brown, Jed and Ercole, Grey and Martins, Eder}, 9255 affiliation = {Departamento de Matem\'atica—ICEx, Universidade Federal de Minas Gerais, Av. 9256 Ant\^onio Carlos 6627, Caixa Postal 702, 30161-970 Belo Horizonte, MG, Brazil}, 9257 title = {Computing the First Eigenpair of the $p$-{L}aplacian via Inverse Iteration of 9258 Sublinear Supersolutions}, 9259 journal = {Journal of Scientific Computing}, 9260 publisher = {Springer Netherlands}, 9261 issn = {0885-7474}, 9262 keyword = {Mathematics and Statistics}, 9263 pages = {180--201}, 9264 volume = {52}, 9265 issue = {1}, 9266 year = {2012}, 9267 doi = {10.1007/s10915-011-9540-0}, 9268 petsc_uses = {KSP} 9269} 9270 9271% LiteralHTML: 9272% LiteralHTML: <a name="books"><H3><center>Books</center></H3> 9273% LiteralHTML: 9274@Book{ knepley2017, 9275 title = {Computational Science I}, 9276 author = {Matthew G. Knepley}, 9277 url = {https://www.cse.buffalo.edu/~knepley/classes/caam519/CSBook.pdf}, 9278 note = {\url{https://www.cse.buffalo.edu/~knepley/classes/caam519/CSBook.pdf}}, 9279 publisher = {PETSc}, 9280 year = {2017}, 9281 petsc_uses = {KSP} 9282} 9283 9284@Article{ verleyeuser, 9285 title = {{User friendly permeability predicting software for technical textiles}}, 9286 author = {Verleye, B. and Morren, G. and Lomov, S.V. and Sol, H. and Verpoest, I. and 9287 Roose, D.}, 9288 journal = {status: published}, 9289 issn = {1560-6074}, 9290 publisher = {Hong Kong Polytechnic University, Hong Kong Institution of Textile and Apparel}, 9291 petsc_uses = {KSP} 9292} 9293 9294@Book{ pacheco, 9295 author = {Peter Pacheco}, 9296 title = {Parallel Programming with MPI}, 9297 year = {1997}, 9298 publisher = {Morgan-Kaufmann}, 9299 note = {Devotes a couple of sections to PETSc}, 9300 petsc_uses = {KSP} 9301} 9302 9303@Book{ 1sbg, 9304 author = {Barry F. Smith and Petter Bj{\o}rstad and William D. Gropp}, 9305 title = {Domain Decomposition: Parallel Multilevel Methods for Elliptic Partial 9306 Differential Equations}, 9307 year = {1996}, 9308 publisher = {Cambridge University Press}, 9309 url = {http://www.mcs.anl.gov/~bsmith/ddbook.html}, 9310 petsc_uses = {KSP} 9311} 9312 9313@Misc{ petsc-fem:homepage, 9314 title = {{PETSc-FEM}: A General Purpose, Parallel, Multi-physics {FEM} Program}, 9315 author = {M. Storti and N. Nigro and R. Paz and L. Dalcin and E. Lopez and L. Battaglia and 9316 G. Rodriguez and G. Filippini}, 9317 howpublished = {\url{http://www.cimec.org.ar/twiki/bin/view/Cimec/PETScFEM}}, 9318 petsc_uses = {KSP} 9319} 9320 9321@Misc{ petsc4py-web-page, 9322 author = {Lisandro Dalcin}, 9323 title = {{PETSc} for {Python} -- {Python} bindings for {PETSc} libraries}, 9324 howpublished = {\url{http://code.google.com/p/petsc4py/}}, 9325 note = {http://code.google.com/p/petsc4py/}, 9326 petsc_uses = {KSP} 9327} 9328 9329@Article{ libmeshpaper06, 9330 author = {B.~S.~Kirk and J.~W.~Peterson and R.~H.~Stogner and G.~F.~Carey}, 9331 title = {{\texttt{libMesh}: A C++ Library for Parallel Adaptive Mesh Refinement/Coarsening 9332 Simulations}}, 9333 journal = {Engineering with Computers}, 9334 volume = {22}, 9335 number = {3--4}, 9336 pages = {237--254}, 9337 year = {2006}, 9338 doi = {10.1007/s00366-006-0049-3}, 9339 petsc_uses = {KSP} 9340} 9341 9342@Misc{ sisiphus:homepage, 9343 title = {{SISIPHUS}: Scalable Ice-Sheet Solvers and Infrastructure for Petascale, 9344 High-Resolution, Unstructured Simulations}, 9345 author = {T. {Tautges et al.}}, 9346 howpublished = {\url{http://trac.mcs.anl.gov/projects/sisiphus/wiki}}, 9347 petsc_uses = {KSP} 9348} 9349 9350@Misc{ pflotran:homepage, 9351 title = {{PFLOTRAN} project}, 9352 author = {Ben Andre and Gautam Bisht and Nathan Collier and Glenn Hammond and Satish Karra 9353 and Jitendra Kumar and Peter Lichtner and Richard Mills}, 9354 howpublished = {\url{http://pflotran.org/}}, 9355 petsc_uses = {KSP} 9356} 9357 9358@Misc{ pism:homepage, 9359 title = {{PISM}: A Parallel Ice Sheet Model}, 9360 author = {E. {Bueler et al.}}, 9361 howpublished = {\url{http://pism-docs.org}}, 9362 petsc_uses = {KSP} 9363} 9364 9365@Misc{ dohp:homepage, 9366 title = {Dohp: Dual order $hp$-finite elements}, 9367 author = {J. Brown}, 9368 howpublished = {\url{http://dohp.org}}, 9369 petsc_uses = {KSP} 9370} 9371 9372@Article{ mccourtrognlienetal12, 9373 title = {Improving parallel scalability for edge plasma transport simulations with neutral 9374 gas species}, 9375 author = {M. McCourt and T. D. Rognlien and L. C. McInnes and H. Zhang}, 9376 journal = {Computational Science and Discovery}, 9377 year = {2012}, 9378 volume = {5}, 9379 number = {014012}, 9380 doi = {10.1088/1749-4699/5/1/014012}, 9381 note = {Focus on 22nd International Conference on Numerical Simulations of Plasmas (ICNSP 9382 2011)}, 9383 petsc_uses = {KSP} 9384} 9385 9386@Misc{ petclaw-github, 9387 title = {Pet{C}law Software}, 9388 author = {Kyle T. Mandli and David I. Ketcheson and Amal Alghamdi and Aron Ahmadia}, 9389 year = {2011}, 9390 howpublished = {\url{https://github.com/pyclaw/pyclaw}}, 9391 petsc_uses = {KSP} 9392} 9393 9394@Misc{ pyclaw-web-page, 9395 author = {Kyle T. Mandli and David I. Ketcheson and others}, 9396 title = {{PyClaw} software}, 9397 howpublished = {\url{http://clawpack.github.io/doc/pyclaw/}}, 9398 url = {http://clawpack.github.io/doc/pyclaw/}, 9399 year = {2012}, 9400 petsc_uses = {KSP} 9401} 9402 9403@Article{ ketcheson2011highorder, 9404 title = {High-order wave propagation algorithms for general hyperbolic systems}, 9405 author = {Ketcheson, David I. and Parsani, Matteo and LeVeque, Randall J.}, 9406 year = {2011}, 9407 note = {submitted}, 9408 petsc_uses = {KSP} 9409} 9410 9411@Article{ biros2005pln1, 9412 title = {{Parallel {Lagrange-Newton-Krylov-Schur} methods for {PDE} constrained 9413 optimization. Part I: The {Krylov-Schur} solver}}, 9414 author = {Biros, G. and Ghattas, O.}, 9415 journal = {SIAM Journal on Scientific Computing}, 9416 volume = {27}, 9417 number = {2}, 9418 pages = {687--713}, 9419 year = {2005}, 9420 publisher = {Society for Industrial and Applied Mathematics Philadelphia, PA, USA}, 9421 petsc_uses = {KSP} 9422} 9423 9424@Article{ biros2005pln2, 9425 title = {Parallel {Lagrange-Newton-Krylov-Schur} methods for {PDE}-constrained 9426 optimization. Part {II}: The {Lagrange Newton} solver, and its application to 9427 optimal control of steady viscous flows}, 9428 author = {Biros, G. and Ghattas, O.}, 9429 journal = {SIAM Journal on Scientific Computing}, 9430 volume = {27}, 9431 number = {2}, 9432 pages = {714--739}, 9433 year = {2005}, 9434 publisher = {Society for Industrial and Applied Mathematics Philadelphia, PA, USA}, 9435 petsc_uses = {KSP} 9436} 9437 9438@Misc{ issm:homepage, 9439 title = {{I}ce {S}heet {S}ystem {M}odel}, 9440 author = {Eric Larour and Mathieu Morlighem and Helene Seroussi}, 9441 year = {2010}, 9442 note = {\href{http://issm.jpl.nasa.gov}{\url{issm.jpl.nasa.gov}}}, 9443 petsc_uses = {KSP} 9444} 9445 9446@Article{ morlighem2010spatial, 9447 title = {Spatial patterns of basal drag inferred using control methods from a 9448 full-{S}tokes and simpler models for {P}ine {I}sland {G}lacier, {W}est 9449 {A}ntarctica}, 9450 author = {Morlighem, M. and Rignot, E. and Seroussi, H. and Larour, E. and Dhia, H.B. and 9451 Aubry, D.}, 9452 journal = {Geophysical Research Letters}, 9453 volume = {37}, 9454 number = {14}, 9455 pages = {L14502}, 9456 year = {2010}, 9457 publisher = {American Geophysical Union}, 9458 petsc_uses = {KSP} 9459} 9460 9461@Article{ jardin2012plasmas, 9462 title = {Multiple timescale calculations of sawteeth and other global macroscopic dynamics 9463 of tokamak plasmas}, 9464 author = {S. C. Jardin and N. Ferraro and J. Breslau and J. Chen}, 9465 journal = {Computational Science \& Discovery}, 9466 volume = {5}, 9467 number = {1}, 9468 url = {http://stacks.iop.org/1749-4699/5/014002}, 9469 year = {2012}, 9470 petsc_uses = {KSP} 9471} 9472 9473@Article{ cmz2016, 9474 title = {Analysis and Practical Use of Flexible {BiCGStab}}, 9475 author = {Jie Chen and Lois Curfman McInnes and Hong Zhang}, 9476 journal = {Journal of Scientific Computing}, 9477 publisher = {Springer}, 9478 pages = {803--825}, 9479 volume = {68}, 9480 issue = {2}, 9481 url = {http://link.springer.com/article/10.1007/s10915-015-0159-4}, 9482 doi = {10.1007/s10915-015-0159-4}, 9483 year = {2016}, 9484 note = {Also preprint ANL/MCS-P3039-0912}, 9485 petsc_uses = {KSP} 9486} 9487 9488@Article{ knepleybrownruppsmith13, 9489 author = {{Knepley}, M.~G. and {Brown}, J. and {Rupp}, K. and {Smith}, B.~F.}, 9490 title = {Achieving High Performance with Unified Residual Evaluation}, 9491 journal = {ArXiv e-prints}, 9492 eprint = {1309.1204}, 9493 archiveprefix = {arXiv}, 9494 primaryclass = {cs.MS}, 9495 keywords = {Computer Science - Mathematical Software, Computer Science - Computational 9496 Engineering, Finance, and Science}, 9497 year = {2013}, 9498 month = sep, 9499 adsurl = {http://adsabs.harvard.edu/abs/2013arXiv1309.1204K}, 9500 adsnote = {Provided by the SAO/NASA Astrophysics Data System}, 9501 petsc_uses = {KSP} 9502} 9503 9504@Book{ fenicsbook, 9505 title = {Automated Solution of Differential Equations by the Finite Element Method: The 9506 FEniCS Book}, 9507 series = {Lecture Notes in Computational Science and Engineering}, 9508 volume = {84}, 9509 editor = {Anders Logg, Kent-Andre Mardal, Garth Wells}, 9510 publisher = {Springer}, 9511 isbn = {978-3-642-23098-1}, 9512 year = {2012}, 9513 petsc_uses = {KSP} 9514} 9515 9516@Article{ demidovahnertruppgottschling12, 9517 author = {{Demidov}, D. and {Ahnert}, K. and {Rupp}, K. and {Gottschling}, P.}, 9518 title = {{Programming CUDA and OpenCL: A Case Study Using Modern C++ Libraries}}, 9519 journal = {ArXiv e-prints}, 9520 archiveprefix = {arXiv}, 9521 eprint = {1212.6326}, 9522 primaryclass = {cs.MS}, 9523 keywords = {Computer Science - Mathematical Software, Computer Science - Distributed, 9524 Parallel, and Cluster Computing, Physics - Computational Physics}, 9525 year = {2012}, 9526 month = dec, 9527 adsurl = {http://adsabs.harvard.edu/abs/2012arXiv1212.6326D}, 9528 adsnote = {Provided by the SAO/NASA Astrophysics Data System}, 9529 petsc_uses = {KSP} 9530} 9531 9532@InProceedings{ viennacl, 9533 author = {Rupp, K. and Rudolf, F. and Weinbub, J.}, 9534 title = {{ViennaCL - A High Level Linear Algebra Library for GPUs and Multi-Core CPUs}}, 9535 booktitle = {Intl.~Workshop on GPUs and Scientific Applications}, 9536 year = {2010}, 9537 pages = {51-56}, 9538 petsc_uses = {KSP} 9539} 9540 9541@Article{ knepleybrownmcinnessmithruppadams2015, 9542 title = {Exascale Computing without Threads}, 9543 author = {Matthew G. Knepley and Jed Brown and Lois Curfman McInnes and Barry Smith and 9544 Karl Rupp and Mark Adams}, 9545 url = {https://figshare.com/articles/Exascale_Computing_without_Threads-Barry_Smith_pdf/5824950}, 9546 note = {Whitepaper for the DOE High Performance Computing Operational Review (HPCOR) on 9547 Scientific Software Architecture for Portability and Performance}, 9548 doi = {10.6084/m9.figshare.5824950.v1}, 9549 year = {2015}, 9550 petsc_uses = {KSP} 9551} 9552 9553@Article{ knepleybrownmcinnessmithruppadams2015b, 9554 title = {Overview of the {PETSc} Library}, 9555 author = {Matthew G. Knepley and Jed Brown and Lois Curfman McInnes and Barry Smith and 9556 Karl Rupp and Mark Adams}, 9557 url = {http://www.orau.gov/hpcor2015/whitepapers/Overview_of_the_PETSc_Library-Lois_McInnes.pdf}, 9558 note = {Whitepaper for the DOE High Performance Computing Operational Review (HPCOR) on 9559 Scientific Software Architecture for Portability and Performance}, 9560 year = {2015}, 9561 petsc_uses = {KSP} 9562} 9563 9564@InBook{ balaybrownknepleymcinnessmith2015, 9565 author = {Satish Balay and Jed Brown and Matthew G. Knepley and Lois McInnes and Barry 9566 Smith}, 9567 bookeditor = {J. Carver}, 9568 title = {Software Engineering for Science}, 9569 chapter = {Providing Mixed Language and Legacy Support within a Library}, 9570 publisher = {Taylor \& Francis}, 9571 year = {2015}, 9572 petsc_uses = {KSP} 9573} 9574 9575@Article{ ruppbalaybrownknepleymcinnessmith2015, 9576 title = {On The Evolution Of User Support Topics in Computational Science and Engineering 9577 Software}, 9578 author = {Karl Rupp and Satish Balay and Jed Brown and Matthew G. Knepley and Lois Curfman 9579 McInnes and Barry F. Smith}, 9580 note = {Whitepaper for Computational Science \& Engineering Software Sustainability and 9581 Productivity Challenges}, 9582 journal = {ArXiv e-prints}, 9583 archiveprefix = {arXiv}, 9584 eprint = {1510.01122}, 9585 year = {2015}, 9586 petsc_uses = {KSP} 9587} 9588 9589@InProceedings{ knepley2013accurately, 9590 title = {Accurately Citing Software and Algorithms Used in Publications}, 9591 author = {Knepley, Matthew G. and Brown, Jed and McInnes, Lois Curfman and Smith, Barry 9592 F.}, 9593 year = {2013}, 9594 booktitle = {First Workshop on Sustainable Software for Science: Practice and Experiences 9595 (WSSSPE), held at SC13}, 9596 doi = {10.6084/m9.figshare.785731}, 9597 petsc_uses = {KSP} 9598} 9599 9600@InProceedings{ milleretal2013, 9601 title = {Package Management Practice Essential for Interoperability: Lessons Learned and 9602 Strategies Developed for {FASTMath}}, 9603 author = {Mark C. Miller and Lori Diachin and Satish Balay and Lois Curfman McInnes and 9604 Barry Smith}, 9605 year = {2013}, 9606 booktitle = {First Workshop on Sustainable Software for Science: Practice and Experiences 9607 (WSSSPE), held at SC13}, 9608 doi = {10.6084/m9.figshare.789055}, 9609 petsc_uses = {KSP} 9610} 9611 9612@TechReport{ dudsonetal2012, 9613 title = {Improved Nonlinear Solvers in {BOUT++}}, 9614 author = {Ben Dudson and Sean Farley and Lois Curfman McInnes}, 9615 institution = {Argonne National Laboratory}, 9616 number = {ANL/MCS-P3025-0812}, 9617 year = {2012}, 9618 petsc_uses = {KSP} 9619} 9620 9621@Misc{ brown13, 9622 author = {J. Brown}, 9623 title = {Scalable Repository Workflows}, 9624 note = {whitepaper submitted to DOE Workshop on Software Productivity for Extreme-Scale 9625 Science, available via \url{http://www.orau.gov/swproductivity2014/papers.htm}}, 9626 year = {2013}, 9627 petsc_uses = {KSP} 9628} 9629 9630@Misc{ starforest11, 9631 title = {Star forests as a parallel communication model}, 9632 author = {Jed Brown}, 9633 url = {https://jedbrown.org/files/StarForest.pdf}, 9634 year = {2011}, 9635 petsc_uses = {KSP} 9636} 9637 9638@Misc{ brownknepleysmith13, 9639 author = {J. Brown and M. Knepley and B. Smith}, 9640 title = {Run-time Extensibility: Anything Less is Unsustainable}, 9641 note = {whitepaper submitted to DOE Workshop on Software Productivity for Extreme-Scale 9642 Science, available via \url{http://www.orau.gov/swproductivity2014/papers.htm}}, 9643 year = {2013}, 9644 petsc_uses = {KSP} 9645} 9646 9647@Article{ jzhaoyliwkliu15, 9648 author = {J. Zhao and Y. Li and W.K. Liu}, 9649 title = {Predicting band structure of 3{D} mechanical metamaterials with complex geometry 9650 via {XFEM}}, 9651 journal = {Computational Mechanics}, 9652 year = {2015}, 9653 url = {http://link.springer.com/article/10.1007/s00466-015-1129-2}, 9654 petsc_uses = {KSP} 9655} 9656 9657@Article{ alisic14, 9658 author = {L. Alisic and J.F. Rudge and R.F. Katz and G. Wells and S. Rhebergen}, 9659 title = {Compaction around a rigid, circular inclusion in partially molten rock}, 9660 journal = {J. Geophys. Res.}, 9661 year = {2014}, 9662 volume = {119}, 9663 number = {7}, 9664 pages = {5903-5920}, 9665 doi = {10.1002/2013JB010906}, 9666 petsc_uses = {KSP} 9667} 9668 9669@Article{ rhebergen14, 9670 author = {S. Rhebergen and G. Wells and R.F. Katz and A. Wathen}, 9671 title = {Analysis of block preconditioners for models of coupled magma mantle dynamics}, 9672 journal = {SIAM J. Sci. Comp.}, 9673 year = {2014}, 9674 volume = {36}, 9675 number = {4}, 9676 pages = {1960-1977}, 9677 doi = {10.1137/130946678}, 9678 petsc_uses = {KSP} 9679} 9680 9681@Article{ allwright14, 9682 author = {J. Allwright and R.F. Katz}, 9683 title = {Pipe Poiseuille flow of viscously anisotropic, partially molten rock}, 9684 journal = {Geophys. J. Int.}, 9685 year = {2014}, 9686 volume = {199}, 9687 number = {3}, 9688 pages = {1608--1624}, 9689 doi = {10.1093/gji/ggu345}, 9690 petsc_uses = {KSP} 9691} 9692 9693@Misc{ gropp10, 9694 author = {William D. Gropp}, 9695 title = {Update on libraries for {B}lue {W}aters}, 9696 address = {Bordeaux, France}, 9697 year = {2010}, 9698 url = {http://jointlab.ncsa.illinois.edu/events/workshop3/pdf/presentations/Gropp-Update-on-Libraries.pdf}, 9699 petsc_uses = {KSP} 9700} 9701 9702@Article{ ssm2016, 9703 author = {P. Sanan and S.M. Schnepp and D.A. May}, 9704 title = {Pipelined, Flexible {Krylov} Subspace Methods}, 9705 journal = {SIAM Journal on Scientific Computing}, 9706 volume = {38}, 9707 number = {5}, 9708 pages = {C441-C470}, 9709 year = {2016}, 9710 doi = {10.1137/15M1049130}, 9711 petsc_uses = {KSP} 9712} 9713 9714@InProceedings{ mayknepley2017, 9715 title = {{DMSwarm}: Particles in {PETSc}}, 9716 author = {Dave A May and Matthew G Knepley}, 9717 booktitle = {EGU General Assembly Conference Abstracts}, 9718 volume = {19}, 9719 pages = {10133}, 9720 year = {2017}, 9721 petsc_uses = {KSP} 9722} 9723 9724@InProceedings{ adamsbrownknepley2013, 9725 author = {Mark F. Adams and Jed Brown and Matthew G. Knepley}, 9726 title = {Low-communication techniques for extreme-scale multilevel solvers}, 9727 booktitle = {Exascale Mathematics Workshop, Aug 21--22, Washington, DC}, 9728 organization = {DOE Office of Advanced Scientific Computing Research}, 9729 year = {2013}, 9730 petsc_uses = {KSP} 9731} 9732 9733@Article{ bhallagriffithknepleyadamsguy2017, 9734 title = {Scalable smoothing strategies for a geometric multigrid method for the immersed 9735 boundary equations}, 9736 author = {Amneet Pal Singh Bhalla and Boyce E. Griffith and Matthew G. Knepley and Mark F. 9737 Adams and Robert D. Guy}, 9738 journal = {Advances in Computational Mathematics}, 9739 eprint = {1612.02208}, 9740 note = {In review}, 9741 year = {2017}, 9742 petsc_uses = {KSP} 9743} 9744 9745@Article{ zampini2016pcbddc, 9746 title = {{PCBDDC}: a class of robust dual-primal methods in {PETSc}}, 9747 author = {Zampini, Stefano}, 9748 journal = {SIAM Journal on Scientific Computing}, 9749 volume = {38}, 9750 number = {5}, 9751 pages = {S282--S306}, 9752 year = {2016}, 9753 publisher = {SIAM}, 9754 petsc_uses = {KSP} 9755} 9756 9757@Article{ jolivetromanzampini2020, 9758 title = {{KSPHPDDM} and {PCHPDDM}: extending {PETSc} with advanced {Krylov} methods and 9759 robust multilevel overlapping {Schwarz} preconditioners}, 9760 author = {Pierre Jolivet and Jose Roman and Stefano Zampini}, 9761 journal = {Computers and Mathematics with Applications}, 9762 volume = {84}, 9763 pages = {277--295}, 9764 year = {2020} 9765} 9766 9767@Article{ zampinitu2017, 9768 title = {Multilevel {BDDC} deluxe algorithms with adaptive coarse spaces for flow in 9769 porous media}, 9770 author = {Stefano Zampini and Xuemin Tu}, 9771 journal = {SIAM Journal of Scientific Computing}, 9772 volume = {39}, 9773 number = {4}, 9774 pages = {A1389--A1415}, 9775 year = {2017} 9776} 9777 9778@Article{ ohwidlundzampinidohrmann2017, 9779 title = {{BDDC} algorithms with deluxe scaling and adaptive selection of primal 9780 constraints for {Raviart-Thomas} vector fields}, 9781 author = {D.-S. Oh and Olof B. Widlund and Stefano Zampini and Clark Dohrmann}, 9782 journal = {Mathematics of Computation}, 9783 volume = {87}, 9784 number = {310}, 9785 pages = {659--692}, 9786 year = {2017} 9787} 9788 9789@Article{ veigapavarinoscacchiwidlundzampini2016, 9790 title = {Adaptive selection of primal constraints for isogeometric {BDDC} deluxe 9791 preconditioners}, 9792 author = {L. Beirao Da Veiga and Luca F. Pavarino and S. Scacchi and Olof B. Widlund and 9793 Stefano Zampini}, 9794 journal = {SIAM Journal of Scientific Computing}, 9795 volume = {39}, 9796 number = {1}, 9797 pages = {A281--A302}, 9798 year = {2016} 9799} 9800 9801@Article{ pavarinoscacchiwidlundzampini2018, 9802 title = {Isogeometric {BDDC} deluxe preconditioners for linear elasticity for isogeometric 9803 analysis}, 9804 author = {Luca F. Pavarino and S. Scacchi and Olof B. Widlund and Stefano Zampini}, 9805 journal = {Mathematical Models and Methods in Applied Sciences}, 9806 volume = {28}, 9807 number = {7}, 9808 pages = {1337--1370}, 9809 year = {2018} 9810} 9811 9812@Article{ bergervergiatwaisman2017, 9813 title = {An overlapping Domain Decomposition preconditioning method for monolithic 9814 solution of shear bands}, 9815 author = {Luc Berger-Vergiat and Haim Waisman}, 9816 journal = {Computer Methods in Applied Mechanics and Engineering}, 9817 volume = {318}, 9818 pages = {33--60}, 9819 year = {2017}, 9820 petsc_uses = {KSP} 9821} 9822 9823@Article{ abhyankarmaldonadosmithzhang2020, 9824 title = {{PETSc} {DMNetwork}: A Library for Scalable Network PDE-Based Multiphysics 9825 Simulations}, 9826 author = {S. Abhyankar and G. Betrie and D.A. Maldonado and L.C. McInnes and B. Smith and 9827 H. Zhang}, 9828 journal = {ACM Transactions on Mathematical Software}, 9829 volume = {46}, 9830 number = {1}, 9831 year = {2020}, 9832 doi = {10.1145/3344587}, 9833 petsc_uses = {KSP} 9834} 9835 9836@InProceedings{ zhangellpack2018, 9837 author = {Hong Zhang and Richard T. Mills and Karl Rupp and Barry F. Smith}, 9838 title = {Vectorized Parallel Sparse Matrix-Vector Multiplication in {PETSc} Using 9839 {AVX-512}}, 9840 booktitle = {Proceedings of the 47th International Conference on Parallel Processing}, 9841 year = {2018}, 9842 petsc_uses = {KSP} 9843} 9844 9845@Misc{ petsc-user-meetings:website, 9846 title = {{PETSc User Meetings}}, 9847 key = {PETSc User Meetings}, 9848 howpublished = {\url{https://petsc.org/release/community/meetings/meeting}}, 9849 petsc_uses = {KSP} 9850} 9851 9852@Article{ flexible-bicgstab-chen16, 9853 title = {Analysis and Practical Use of Flexible {BiCGStab}}, 9854 author = {J. Chen and L.C. McInnes and H. Zhang}, 9855 journal = {Journal of Scientific Computing}, 9856 volume = {68}, 9857 number = {2}, 9858 month = jul, 9859 year = {2016}, 9860 pages = {803--825}, 9861 doi = {10.1007/s10915-015-0159-4}, 9862 petsc_uses = {KSP} 9863} 9864 9865@Misc{ petsc-extensibility2016, 9866 author = {M. Knepley and D. A. May and J. Brown and B. Smith}, 9867 title = {{Extensibility in PETSc}}, 9868 note = {SIAM News, available via 9869 \url{https://sinews.siam.org/Details-Page/extensibility-in-petsc}}, 9870 year = {2016}, 9871 petsc_uses = {KSP} 9872} 9873 9874@Misc{ error-estimation-whitepaper2017, 9875 author = {E. Constantinescu and O. Marin and T. Munson and B. Smith and H. Zhang}, 9876 title = {End-to-end error estimation and control}, 9877 note = {whitepaper for 2017 ASCR Applied Mathematics PI Meeting}, 9878 doi = {10.6084/m9.figshare.5339866}, 9879 year = {2017}, 9880 petsc_uses = {KSP} 9881} 9882 9883@Misc{ petsc-user-support15, 9884 title = {On the Evolution of User Support Topics in Computational Science and Engineering 9885 Software}, 9886 author = {K. Rupp and S. Balay and J. Brown and M. Knepley and L. C. McInnes and B. Smith}, 9887 note = {Workshop on CSE Software Sustainability and Productivity (CSESSP) Challenges, Oct 9888 15-16, 2015}, 9889 year = {2015}, 9890 petsc_uses = {KSP} 9891} 9892 9893@InBook{ petsc-mixed-language-support2016, 9894 title = {Numerical Library Support for High-Performance Mixed Language Applications and 9895 Legacy Code}, 9896 author = {S. Balay and J. Brown and M. Knepley and L.C. McInnes and B. Smith}, 9897 booktitle = {Software Engineering for Science}, 9898 editors = {J. Carver et al.}, 9899 publisher = {CRC Press}, 9900 pages = {201--214}, 9901 year = {2016}, 9902 petsc_uses = {KSP} 9903} 9904 9905@InProceedings{ konolige2018parallel, 9906 title = {A Parallel Solver for Graph {L}aplacians}, 9907 author = {Tristan Konolige and Jed Brown}, 9908 booktitle = {Proceedings of the Platform for Advanced Scientific Computing (PASC)}, 9909 doi = {10.1145/3218176.3218227}, 9910 note = {Best Paper Award}, 9911 archiveprefix = {arXiv}, 9912 eprint = {1705.06266}, 9913 year = {2018}, 9914 petsc_uses = {KSP} 9915} 9916 9917@InProceedings{ werner-kimn2019, 9918 title = {Parallel implementation of AC optimal power flow and time-constrained optimal 9919 power flow using high-performance computing}, 9920 author = {Alex Werner and Kapil Duwadi and Nicholas Stegmeier and Timothy M. Hansen and 9921 Jung-Han Kimn}, 9922 booktitle = {IEEE 9th Annual Computing and Communication Workshop and Conference (CCWC 2019)}, 9923 note = {Best Paper in Track}, 9924 year = {2019}, 9925 petsc_uses = {KSP} 9926} 9927 9928@MastersThesis{ rinaldo-ceresoli18, 9929 author = {Stefano Guido Rinaldo and Andrea Ceresoli}, 9930 title = {Newton–Krylov–Schwarz Methods for Distributed Power Flow and Related 9931 Applications}, 9932 school = {Politecnico di Milano}, 9933 year = {2018}, 9934 month = apr, 9935 petsc_uses = {KSP} 9936} 9937 9938@Article{ sananschneppmay2016, 9939 title = {Pipelined, Flexible {K}rylov Subspace Methods}, 9940 author = {P. Sanan and S. M. Schnepp and D. A. May}, 9941 journal = {SIAM Journal on Scientific Computing}, 9942 volume = {38}, 9943 number = {5}, 9944 pages = {C441-C470}, 9945 year = {2016}, 9946 doi = {10.1137/15M1049130}, 9947 petsc_uses = {KSP} 9948} 9949 9950@Article{ petscsf2022, 9951 author = {Zhang, Junchao and Brown, Jed and Balay, Satish and Faibussowitsch, Jacob and 9952 Knepley, Matthew and Marin, Oana and Mills, Richard Tran and Munson, Todd and 9953 Smith, Barry F. and Zampini, Stefano}, 9954 journal = {IEEE Transactions on Parallel and Distributed Systems}, 9955 title = {The {PetscSF} Scalable Communication Layer}, 9956 year = {2022}, 9957 volume = {33}, 9958 number = {4}, 9959 pages = {842-853}, 9960 doi = {10.1109/TPDS.2021.3084070} 9961} 9962 9963@Article{ brandt2000, 9964 title = {General highly accurate algebraic coarsening}, 9965 author = {Achi Brandt}, 9966 journal = {Electronic Transactions on Numerical Analysis}, 9967 volume = {10}, 9968 number = {9680}, 9969 pages = {1--20}, 9970 issn = {10689613}, 9971 year = {2000} 9972} 9973 9974@Article{ dalcinpazklercosimo2011, 9975 title = {Parallel distributed computing using Python}, 9976 author = {Lisandro D. Dalcin and Rodrigo R. Paz and Pablo A. Kler and Alejandro Cosimo}, 9977 journal = {Advances in Water Resources}, 9978 volume = {34}, 9979 number = {9}, 9980 pages = {1124 - 1139}, 9981 note = {New Computational Methods and Software Tools}, 9982 issn = {0309-1708}, 9983 doi = {10.1016/j.advwatres.2011.04.013}, 9984 year = {2011} 9985} 9986 9987@Article{ behnelbradshawcitrodalcinseljebotnsmith2011, 9988 title = {Cython: The Best of Both Worlds}, 9989 author = {Behnel,Stefan and Bradshaw,Robert and Citro,Craig and Dalcin,Lisandro and 9990 Seljebotn,Dag Sverre and Smith,Kurt }, 9991 journal = {Computing in Science \& Engineering}, 9992 volume = {13}, 9993 number = {2}, 9994 pages = {31-39}, 9995 doi = {10.1109/MCSE.2010.118}, 9996 year = {2011} 9997} 9998 9999@Article{ dalcinpazstorti2005, 10000 title = {MPI for Python}, 10001 author = {Lisandro Dalcín and Rodrigo Paz and Mario Storti}, 10002 journal = {Journal of Parallel and Distributed Computing}, 10003 volume = {65}, 10004 number = {9}, 10005 pages = {1108 - 1115}, 10006 issn = {0743-7315}, 10007 doi = {10.1016/j.jpdc.2005.03.010}, 10008 year = {2005} 10009} 10010 10011@Article{ dalcincolliervignalcortescalo2016, 10012 title = {PetIGA: A framework for high-performance isogeometric analysis}, 10013 author = {Lisandro Dalcin and Nathan Collier and P. Vignal and A.M.A. Cortes and Victor M. 10014 Calo}, 10015 journal = {Computer Methods in Applied Mechanics and Engineering}, 10016 volume = {308}, 10017 pages = {151 - 181}, 10018 issn = {0045-7825}, 10019 doi = {10.1016/j.cma.2016.05.011}, 10020 year = {2016} 10021} 10022 10023@Article{ collierpardodalcinpaszynskicalo2012, 10024 title = {The cost of continuity: A study of the performance of isogeometric finite 10025 elements using direct solvers}, 10026 author = {Nathan Collier and David Pardo and Lisandro Dalcin and Maciej Paszynski and V.M. 10027 Calo}, 10028 journal = {Computer Methods in Applied Mechanics and Engineering}, 10029 volume = {213-216}, 10030 pages = {353 - 361}, 10031 issn = {0045-7825}, 10032 doi = {10.1016/j.cma.2011.11.002}, 10033 year = {2012} 10034} 10035 10036@Article{ collierdalcinpardocalo2013, 10037 title = {The Cost of Continuity: Performance of Iterative Solvers on Isogeometric Finite 10038 Elements}, 10039 author = {Nathan Collier and Lisandro Dalcin and David Pardo and Victor M. Calo}, 10040 journal = {SIAM Journal on Scientific Computing}, 10041 volume = {35}, 10042 number = {2}, 10043 pages = {A767-A784}, 10044 doi = {10.1137/120881038}, 10045 year = {2013} 10046} 10047 10048@Article{ dunning2017jump, 10049 title = {{JuMP}: a modeling language for mathematical optimization}, 10050 author = {Dunning, Iain and Huchette, Joey and Lubin, Miles}, 10051 journal = {SIAM Review}, 10052 volume = {59}, 10053 number = {2}, 10054 pages = {295--320}, 10055 year = {2017}, 10056 publisher = {SIAM} 10057} 10058 10059@InProceedings{ prudencioschulz2011, 10060 title = {The parallel {C++} statistical library {QUESO}: Quantification of Uncertainty for 10061 Estimation, Simulation and Optimization}, 10062 author = {Ernesto E Prudencio and Karl W Schulz}, 10063 booktitle = {European Conference on Parallel Processing}, 10064 pages = {398--407}, 10065 year = {2011} 10066} 10067 10068@Misc{ rol-website, 10069 key = {ROL}, 10070 title = {{Rapid Optimization Library} Website}, 10071 howpublished = {\url{https://trilinos.org/packages/rol}}, 10072 year = {2018} 10073} 10074 10075@Article{ more1994line, 10076 title = {Line search algorithms with guaranteed sufficient decrease}, 10077 author = {Mor{\'e}, Jorge J and Thuente, David J}, 10078 journal = {ACM Transactions on Mathematical Software}, 10079 volume = {20}, 10080 number = {3}, 10081 pages = {286--307}, 10082 year = {1994}, 10083 publisher = {ACM} 10084} 10085 10086@Article{ griewank2000algorithm, 10087 title = {Algorithm 799: revolve: an implementation of checkpointing for the reverse or 10088 adjoint mode of computational differentiation}, 10089 author = {Griewank, Andreas and Walther, Andrea}, 10090 journal = {ACM Transactions on Mathematical Software}, 10091 volume = {26}, 10092 number = {1}, 10093 pages = {19--45}, 10094 year = {2000}, 10095 publisher = {ACM} 10096} 10097 10098@Article{ metcalf2011seven, 10099 title = {The seven ages of fortran}, 10100 author = {Metcalf, Michael}, 10101 journal = {Journal of Computer Science \& Technology}, 10102 volume = {11}, 10103 year = {2011} 10104} 10105 10106@Article{ giraldo_2013, 10107 title = {Implicit-explicit formulations of a three-dimensional nonhydrostatic unified 10108 model of the atmosphere {(NUMA)}}, 10109 author = {F.X. Giraldo and J.F. Kelly and E.M. Constantinescu}, 10110 journal = {SIAM Journal on Scientific Computing}, 10111 year = {2013}, 10112 number = {5}, 10113 pages = {B1162-B1194}, 10114 volume = {35}, 10115 doi = {10.1137/120876034} 10116} 10117 10118@Article{ constantinescu_tr2016b, 10119 author = {Constantinescu, E.M.}, 10120 title = {Estimating Global Errors in Time Stepping}, 10121 journal = {ArXiv e-prints}, 10122 archiveprefix = {arXiv}, 10123 eprint = {1503.05166}, 10124 primaryclass = {math.NA}, 10125 keywords = {Mathematics - Numerical Analysis, 65L05, 65L06, 65L20, 65L70}, 10126 year = {2016}, 10127 month = mar, 10128 adsurl = {http://adsabs.harvard.edu/abs/2015arXiv150305166C}, 10129 adsnote = {Provided by the SAO/NASA Astrophysics Data System} 10130} 10131 10132@Article{ pareschi_2005, 10133 title = {Implicit-Explicit {R}unge-{K}utta Schemes and Applications to Hyperbolic Systems 10134 with Relaxation}, 10135 author = {L. Pareschi and G. Russo}, 10136 journal = {Journal of Scientific Computing}, 10137 year = {2005}, 10138 number = {1}, 10139 pages = {129--155}, 10140 volume = {25} 10141} 10142 10143@Article{ kennedy_2003, 10144 title = {Additive {R}unge-{K}utta schemes for convection-diffusion-reaction equations}, 10145 author = {C.A. Kennedy and M.H. Carpenter}, 10146 journal = {Appl. Numer. Math.}, 10147 year = {2003}, 10148 number = {1-2}, 10149 pages = {139--181}, 10150 volume = {44}, 10151 doi = {10.1016/S0168-9274(02)00138-1}, 10152 publisher = {Elsevier Science Publishers B. V.} 10153} 10154 10155@Unpublished{ boscarino_tr2011, 10156 title = {Implicit-Explicit {R}unge-{K}utta schemes for hyperbolic systems and kinetic 10157 equations in the diffusion limit}, 10158 author = {Boscarino, S. and Pareschi, L. and Russo, G.}, 10159 note = {Arxiv preprint arXiv:1110.4375}, 10160 year = {2011} 10161} 10162 10163@Article{ ascher_1997, 10164 title = {Implicit-explicit {R}unge-{K}utta methods for time-dependent partial differential 10165 equations}, 10166 author = {U.M. Ascher and S.J. Ruuth and R.J. Spiteri}, 10167 journal = {Applied Numerical Mathematics}, 10168 year = {1997}, 10169 pages = {151--167}, 10170 volume = {25} 10171} 10172 10173@Book{ ascherpetzold1998, 10174 title = {Computer methods for ordinary differential equations and differential-algebraic 10175 equations}, 10176 author = {Uri M Ascher and Linda R Petzold}, 10177 volume = {61}, 10178 publisher = {SIAM}, 10179 year = {1998} 10180} 10181 10182@Article{ colomesbadia2016, 10183 title = {Segregated {Runge}--{Kutta} methods for the incompressible {Navier}--{Stokes} 10184 equations}, 10185 author = {Oriol Colom{\'e}s and Santiago Badia}, 10186 journal = {International Journal for Numerical Methods in Engineering}, 10187 volume = {105}, 10188 number = {5}, 10189 pages = {372--400}, 10190 year = {2016} 10191} 10192 10193@Article{ sandu_1997, 10194 title = {Benchmarking stiff ode solvers for atmospheric chemistry problems {II}: 10195 {R}osenbrock solvers}, 10196 author = {A. Sandu and J.G. Verwer and J.G. Blom and E.J. Spee and G.R. Carmichael and F.A. 10197 Potra}, 10198 journal = {Atmospheric Environment}, 10199 year = {1997}, 10200 number = {20}, 10201 pages = {3459--3472}, 10202 volume = {31}, 10203 abstract = {In the numerical simulation of atmospheric transport-chemistry processes, a major 10204 task is the integration of the stiff systems of ordinary differential equations 10205 describing the chemical transformations. It is therefore of interest to 10206 systematically search for stiff solvers which can be identified as close to 10207 optimal for atmospheric applications. In this paper we continue our investigation 10208 from Sandu et al. (1996, CWI Report NM-R9603 and Report in Comput. Math., No. 85) 10209 and compare eight solvers on a set of seven box-models used in present day models. 10210 The focus is on Rosenbrock solvers. These turn out to be very well suited for our 10211 application when they are provided with highly efficient sparse matrix techniques 10212 to economize on the linear algebra. Two of the Rosenbrock solvers tested are from 10213 the literature, viz. and 4, and two are new and specially developed for air 10214 quality applications, viz. 3 and 3. } 10215} 10216 10217@Article{ rang_2005, 10218 title = {New {R}osenbrock {W}-methods of order 3 for partial differential algebraic 10219 equations of index 1}, 10220 author = {Rang, J. and Angermann, L.}, 10221 journal = {BIT Numerical Mathematics}, 10222 year = {2005}, 10223 number = {4}, 10224 pages = {761--787}, 10225 volume = {45}, 10226 publisher = {Springer} 10227} 10228 10229@Article{ gottliebketchesonshu2009, 10230 author = {Sigal Gottlieb and David I. Ketcheson and Chi Wang Shu}, 10231 title = {{High order strong stability preserving time discretizations}}, 10232 journal = {Journal of Scientific Computing}, 10233 volume = {38}, 10234 number = {3}, 10235 pages = {251--289}, 10236 doi = {10.1007/s10915-008-9239-z}, 10237 year = {2009} 10238} 10239 10240@Article{ ketcheson_2008, 10241 title = {Highly Efficient Strong Stability-Preserving {R}unge--{K}utta Methods with 10242 Low-Storage Implementations}, 10243 author = {D.I. Ketcheson}, 10244 journal = {SIAM Journal on Scientific Computing}, 10245 year = {2008}, 10246 number = {4}, 10247 pages = {2113--2136}, 10248 volume = {30}, 10249 doi = {10.1137/07070485X}, 10250 keywords = {method of lines, strong stability-preserving, monotonicity, low-storage, 10251 RungeKutta methods}, 10252 publisher = {SIAM} 10253} 10254 10255@Article{ jansen_2000, 10256 title = {A generalized-alpha method for integrating the filtered {N}avier--{S}tokes 10257 equations with a stabilized finite element method}, 10258 author = {Jansen, K.E. and Whiting, C.H. and Hulbert, G.M.}, 10259 journal = {Computer Methods in Applied Mechanics and Engineering}, 10260 year = {2000}, 10261 number = {3}, 10262 pages = {305--319}, 10263 volume = {190}, 10264 publisher = {Elsevier} 10265} 10266 10267@Article{ butcher_2007, 10268 title = {Error propagation of general linear methods for ordinary differential equations}, 10269 author = {J.C. Butcher and Z. Jackiewicz and W.M. Wright}, 10270 journal = {Journal of Complexity}, 10271 year = {2007}, 10272 number = {4-6}, 10273 pages = {560--580}, 10274 volume = {23}, 10275 abstract = {We discuss error propagation for general linear methods for ordinary differential 10276 equations up to terms of order p+2, where p is the order of the method. These 10277 results are then applied to the estimation of local discretization errors for 10278 methods of order p and for the adjacent order p+1. The results of numerical 10279 experiments confirm the reliability of these estimates. This research has 10280 applications in the design of robust stepsize and order changing strategies for 10281 algorithms based on general linear methods.}, 10282 doi = {10.1016/j.jco.2007.01.009}, 10283 issn = {0885-064X} 10284} 10285 10286@Article{ constantinescu_a2010a, 10287 title = {Extrapolated implicit-explicit time stepping}, 10288 author = {E.M. Constantinescu and A. Sandu}, 10289 journal = {SIAM Journal on Scientific Computing}, 10290 year = {2010}, 10291 number = {6}, 10292 pages = {4452-4477}, 10293 volume = {31}, 10294 comment = {Preprint \# ANL/MCS-P1612-0409}, 10295 doi = {10.1137/080732833} 10296} 10297 10298@InProceedings{ devito2011liszt, 10299 title = {Liszt: a domain specific language for building portable mesh-based PDE solvers}, 10300 author = {DeVito, Zachary and Joubert, Niels and Palacios, Francisco and Oakley, Stephen 10301 and Medina, Montserrat and Barrientos, Mike and Elsen, Erich and Ham, Frank and 10302 Aiken, Alex and Duraisamy, Karthik and others}, 10303 booktitle = {Proceedings of 2011 International Conference for High Performance Computing, 10304 Networking, Storage and Analysis}, 10305 pages = {9}, 10306 year = {2011}, 10307 organization = {ACM} 10308} 10309 10310@Article{ devito2011designing, 10311 title = {Designing the Language Liszt for Building Portable Mesh-based PDE Solvers}, 10312 author = {DeVito, Zachary and Hanrahan, Pat}, 10313 journal = {Scientific Discovery through Advanced Computing Program (SciDAC)}, 10314 year = {2011} 10315} 10316 10317@Misc{ pgasintro, 10318 author = {Tim Stitt}, 10319 title = {An Introduction to the Partitioned Global Address Space (PGAS) Programming 10320 Model}, 10321 note = {\url{http://cnx.org/content/m20649/latest/}} 10322} 10323 10324@InProceedings{ el2006upc, 10325 title = {UPC: unified parallel C}, 10326 author = {El-Ghazawi, Tarek and Smith, Lauren}, 10327 booktitle = {Proceedings of the 2006 ACM/IEEE conference on Supercomputing}, 10328 pages = {27}, 10329 year = {2006}, 10330 organization = {ACM} 10331} 10332 10333@InProceedings{ numrich1998co, 10334 title = {Co-Array Fortran for parallel programming}, 10335 author = {Numrich, Robert W and Reid, John}, 10336 booktitle = {ACM Sigplan Fortran Forum}, 10337 volume = {17}, 10338 number = {2}, 10339 pages = {1--31}, 10340 year = {1998}, 10341 organization = {ACM} 10342} 10343 10344@Article{ aiken1997titanium, 10345 title = {Titanium: A high-performance Java dialect}, 10346 author = {Aiken, Alex and Colella, Phil and Gay, David and Graham, Susan and Hilfinger, 10347 Paul and Krishnamurthy, Arvind and Liblit, Ben and Miyamoto, Carleton and Pike, 10348 Geoff and Semenzato, Luigi and others}, 10349 year = {1997} 10350} 10351 10352@Article{ charles2005x10, 10353 title = {X10: an object-oriented approach to non-uniform cluster computing}, 10354 author = {Charles, Philippe and Grothoff, Christian and Saraswat, Vijay and Donawa, 10355 Christopher and Kielstra, Allan and Ebcioglu, Kemal and Von Praun, Christoph and 10356 Sarkar, Vivek}, 10357 journal = {Acm Sigplan Notices}, 10358 volume = {40}, 10359 number = {10}, 10360 pages = {519--538}, 10361 year = {2005}, 10362 publisher = {ACM} 10363} 10364 10365@Article{ chamberlain2007parallel, 10366 title = {Parallel programmability and the chapel language}, 10367 author = {Chamberlain, Bradford L and Callahan, David and Zima, Hans P}, 10368 journal = {International Journal of High Performance Computing Applications}, 10369 volume = {21}, 10370 number = {3}, 10371 pages = {291--312}, 10372 year = {2007}, 10373 publisher = {SAGE Publications} 10374} 10375 10376@InProceedings{ charmppoopsla93, 10377 author = {{Kal\'{e}}, L.V. and Krishnan, S.}, 10378 title = {{CHARM++: A Portable Concurrent Object Oriented System Based on C++}}, 10379 editor = {Paepcke, A.}, 10380 fulleditor = {Paepcke, Andreas}, 10381 pages = {91--108}, 10382 month = sep, 10383 year = {1993}, 10384 booktitle = {{Proceedings of OOPSLA'93}}, 10385 publisher = {{ACM Press}} 10386} 10387 10388@InProceedings{ hewitt1973universal, 10389 title = {A universal modular actor formalism for artificial intelligence}, 10390 author = {Hewitt, Carl and Bishop, Peter and Steiger, Richard}, 10391 booktitle = {Proceedings of the 3rd international joint conference on Artificial 10392 intelligence}, 10393 pages = {235--245}, 10394 year = {1973}, 10395 organization = {Morgan Kaufmann Publishers Inc.} 10396} 10397 10398@Book{ yonezawa1990abcl, 10399 title = {ABCL: an object-oriented concurrent system}, 10400 author = {Yonezawa, Akinori}, 10401 year = {1990}, 10402 publisher = {MIT press} 10403} 10404 10405@InProceedings{ dally1988object, 10406 title = {Object-oriented concurrent programming in CST}, 10407 author = {Dally, William J and Chien, Andrew A}, 10408 booktitle = {Proceedings of the third conference on Hypercube concurrent computers and 10409 applications: Architecture, software, computer systems, and general issues-Volume 10410 1}, 10411 pages = {434--439}, 10412 year = {1988}, 10413 organization = {ACM} 10414} 10415 10416@Article{ grimshaw1993easy, 10417 title = {Easy-to-use object-oriented parallel processing with Mentat}, 10418 author = {Grimshaw, Andrew S.}, 10419 journal = {Computer}, 10420 volume = {26}, 10421 number = {5}, 10422 pages = {39--51}, 10423 year = {1993}, 10424 publisher = {IEEE} 10425} 10426 10427@InProceedings{ gannon1991object, 10428 title = {Object oriented parallelism: pC++ ideas and experiments}, 10429 author = {Gannon, Dennis and Lee, JK}, 10430 booktitle = {Proceedings of}, 10431 pages = {13--23}, 10432 year = {1991} 10433} 10434 10435@InProceedings{ lau1992object, 10436 title = {An object-oriented class library for scalable parallel heuristic search}, 10437 author = {Lau, Wing-cheong and Singh, Vineet}, 10438 booktitle = {ECOOP’92 European Conference on Object-Oriented Programming}, 10439 pages = {252--267}, 10440 year = {1992}, 10441 organization = {Springer} 10442} 10443 10444@Book{ chase1989amber, 10445 title = {The Amber system: Parallel programming on a network of multiprocessors}, 10446 author = {Chase, Jeffery and Amador, Franz and Lazowska, Edward and Levy, Henry and 10447 Littlefield, Richard}, 10448 volume = {23}, 10449 number = {5}, 10450 year = {1989}, 10451 publisher = {ACM} 10452} 10453 10454@InProceedings{ kaiser2009parallex, 10455 title = {Parallex an advanced parallel execution model for scaling-impaired applications}, 10456 author = {Kaiser, Hartmut and Brodowicz, Maciej and Sterling, Thomas}, 10457 booktitle = {Parallel Processing Workshops, 2009. ICPPW'09. International Conference on}, 10458 pages = {394--401}, 10459 year = {2009}, 10460 organization = {IEEE} 10461} 10462 10463@TechReport{ ipm, 10464 author = {Barry F. Smith}, 10465 title = {A New Parallel Programming Model for Computer Simulation}, 10466 institution = {Argonne National Laboratory}, 10467 year = {2014}, 10468 number = {ANL/MCS-P5135-0414} 10469} 10470 10471@Article{ groppsnir, 10472 author = {William Gropp and Marc Snir}, 10473 title = {Programming for Exascale Computers}, 10474 journal = {Computing in Science and Engineering}, 10475 volume = {15}, 10476 number = {6}, 10477 issn = {1521-9615}, 10478 year = {2013}, 10479 pages = {27-35}, 10480 doi = {10.1109/MCSE.2013.96}, 10481 publisher = {IEEE Computer Society}, 10482 address = {Los Alamitos, CA} 10483} 10484 10485@Book{ mpi3, 10486 title = {MPI: A Message-Passing Interface Standard, Version 3.0}, 10487 author = {Message Passing Interface Forum}, 10488 year = {2012}, 10489 publisher = {High Performance Computing Center Stuttgart (HLRS)} 10490} 10491 10492@Book{ openmp4, 10493 title = {OpenMP Application Program Interface, Version 4.0}, 10494 year = {2013}, 10495 publisher = {OpenMP Architecture Review Board} 10496} 10497 10498@InProceedings{ hartono2009annotation, 10499 title = {Annotation-based empirical performance tuning using {Orio}}, 10500 author = {Hartono, Albert and Norris, Boyana and Sadayappan, Ponnuswamy}, 10501 booktitle = {Parallel \& Distributed Processing, 2009. IPDPS 2009. IEEE International 10502 Symposium on}, 10503 pages = {1--11}, 10504 year = {2009}, 10505 organization = {IEEE} 10506} 10507 10508@Book{ toselli2005domain, 10509 title = {Domain Decomposition Methods: Algorithms and Theory}, 10510 author = {Toselli, Andrea and Widlund, Olof B}, 10511 volume = {34}, 10512 year = {2005}, 10513 publisher = {Springer} 10514} 10515 10516@InBook{ st2016, 10517 author = {Barry F. Smith and Xumin Tu}, 10518 chapter = {Domain Decomposition}, 10519 title = {Encyclopedia of Applied and Computational Mathematics}, 10520 bookeditor = {B. Engquist}, 10521 publisher = {Springer}, 10522 pages = {375--381}, 10523 year = {2016} 10524} 10525 10526@TechReport{ saws, 10527 author = {Matt Otten and Jed Brown and Barry F. Smith}, 10528 title = {Scientific Application Web Server {(SAWs)} Users Manual}, 10529 institution = {Argonne National Laboratory}, 10530 year = {2013} 10531} 10532 10533@Article{ smith1997domain, 10534 title = {Domain Decomposition Methods for Partial Differential Equations}, 10535 author = {Smith, B.F.}, 10536 journal = {ICASE LARC Interdisciplinary Series in Science and Engineering}, 10537 volume = {4}, 10538 pages = {225--244}, 10539 year = {1997}, 10540 publisher = {Citeseer} 10541} 10542 10543@Article{ spillane2011abstract, 10544 title = {Abstract robust coarse spaces for systems of {PDEs} via generalized eigenproblems 10545 in the overlaps}, 10546 author = {Spillane, N and Dolean, V and Hauret, P and Nataf, F and Pechstein, C and 10547 Scheichl, R}, 10548 journal = {NuMa-Report}, 10549 volume = {7}, 10550 pages = {2007}, 10551 year = {2011} 10552} 10553 10554@InProceedings{ jolivet2013scalabledd, 10555 title = {Scalable domain decomposition preconditioners for heterogeneous elliptic 10556 problems}, 10557 author = {Jolivet, Pierre and Hecht, Fr{\'e}d{\'e}ric and Nataf, Fr{\'e}d{\'e}ric and 10558 Prud'homme, Christophe}, 10559 booktitle = {Proceedings of SC13: International Conference for High Performance Computing, 10560 Networking, Storage and Analysis}, 10561 pages = {80}, 10562 year = {2013}, 10563 organization = {ACM} 10564} 10565 10566@Book{ ks2000, 10567 author = {D. Kinderlehrer and G. Stampacchia}, 10568 publisher = {Society for Industrial Mathematics}, 10569 title = {An Introduction to Variational Inequalities and Their Applications}, 10570 year = {2000} 10571} 10572 10573@Article{ wan2000energy, 10574 title = {An energy-minimizing interpolation for robust multigrid methods}, 10575 author = {Wan, W.L. and Chan, T.F. and Smith, B. F.}, 10576 journal = {SIAM Journal on Scientific Computing}, 10577 volume = {21}, 10578 number = {4}, 10579 pages = {1632--1649}, 10580 year = {2000}, 10581 publisher = {Philadelphia, PA: SIAM, c1993-} 10582} 10583 10584@Article{ chansmith1994, 10585 title = {Domain decomposition and multigrid algorithms for elliptic problems on 10586 unstructured meshes}, 10587 author = {Chan, T.F. and Smith, B.F.}, 10588 journal = {Electronic Transactions on Numerical Analysis}, 10589 volume = {2}, 10590 pages = {171--182}, 10591 year = {1994} 10592} 10593 10594@TechReport{ proto-fsp, 10595 author = {Venkatramani Balaji and Barry Smith and Brian Van Straalen and Priya Vashishta 10596 and Michael Zarnstorff and Michael Zika}, 10597 title = {Report of the {Proto-FSP} {Assessment Panel for the FSP}}, 10598 institution = {Princeton Plasma Physics Laboratory}, 10599 year = {2010}, 10600 url = {http://www.pppl.gov/fsp/documents/Proto-FSPAssessmentReport.pdf} 10601} 10602 10603@Article{ hirvijoki2021, 10604 title = {Structure-preserving marker-particle discretizations of {Coulomb} collisions for 10605 particle-in-cell codes}, 10606 journal = {Plasma Phys. Control. Fusion}, 10607 author = {Eero Hirvijoki}, 10608 note = {in press}, 10609 doi = {10.1088/1361-6587/abe884}, 10610 year = {2021} 10611} 10612 10613@Article{ ipsen2001, 10614 author = {Ilse C. F. Ipsen}, 10615 journal = {SIAM J. Sci. Comput.}, 10616 pages = {1050--1051}, 10617 volume = {23}, 10618 publisher = {SIAM}, 10619 title = {A Note on Preconditioning Nonsymmetric Matrices}, 10620 year = {2001} 10621} 10622 10623% Random papers on solvers for GPUs 10624@InProceedings{ gpus-suck, 10625 author = {Vuduc, R. and Chandramowlishwaran, A. and Choi, J. and Guney M. }, 10626 title = { On the Limits of {GPU} Acceleration}, 10627 booktitle = {HOTPAR: Proceedings of the 2nd USENIX Workshop on Hot Topics in Parallelism}, 10628 year = {2010}, 10629 publisher = {USENIX} 10630} 10631 10632@InProceedings{ 882364, 10633 author = {Bolz, Jeff and Farmer, Ian and Grinspun, Eitan and Schr\"{o}oder, Peter}, 10634 title = {Sparse matrix solvers on the {GPU}: conjugate gradients and multigrid}, 10635 booktitle = {SIGGRAPH '03: ACM SIGGRAPH 2003 Papers}, 10636 year = {2003}, 10637 isbn = {1-58113-709-5}, 10638 pages = {917--924}, 10639 location = {San Diego, California}, 10640 doi = {10.1145/1201775.882364}, 10641 publisher = {ACM}, 10642 address = {New York, NY} 10643} 10644 10645@Conference{ feng2008multigrid, 10646 author = {Feng, Z. and Li, P.}, 10647 booktitle = {IEEE/ACM International Conference on Computer-Aided Design, 2008. ICCAD 2008}, 10648 date-added = {2010-08-19 15:57:06 -0500}, 10649 date-modified = {2010-08-19 15:57:06 -0500}, 10650 pages = {647--654}, 10651 title = {Multigrid on {GPU}: Tackling power grid analysis on parallel SIMT platforms}, 10652 year = {2008} 10653} 10654 10655@Conference{ goodnight2003multigrid, 10656 author = {Goodnight, N. and Woolley, C. and Lewin, G. and Luebke, D. and Humphreys, G.}, 10657 booktitle = {Proceedings of the ACM SIGGRAPH/EUROGRAPHICS conference on Graphics hardware}, 10658 date-added = {2010-08-19 15:45:20 -0500}, 10659 date-modified = {2010-08-19 15:45:20 -0500}, 10660 organization = {Eurographics Association}, 10661 pages = {102--111}, 10662 title = {A multigrid solver for boundary value problems using programmable graphics 10663 hardware}, 10664 year = {2003} 10665} 10666 10667@Article{ buatois2007concurrent, 10668 author = {Buatois, L. and Caumon, G. and L{\'e}vy, B.}, 10669 date-added = {2010-08-19 15:45:02 -0500}, 10670 date-modified = {2010-08-19 15:45:02 -0500}, 10671 journal = {High Performance Computing and Communications}, 10672 pages = {358--371}, 10673 publisher = {Citeseer}, 10674 title = {Concurrent number cruncher: {A}n efficient sparse linear solver on the {GPU}}, 10675 year = {2007} 10676} 10677 10678@Article{ joldes2010real, 10679 author = {Joldes, G.R. and Wittek, A. and Miller, K.}, 10680 date-added = {2010-08-19 15:44:41 -0500}, 10681 date-modified = {2010-08-19 15:44:41 -0500}, 10682 journal = {Computer Methods in Applied Mechanics and Engineering}, 10683 publisher = {Elsevier}, 10684 title = {Real-time nonlinear finite element computations on {GPU}-application to 10685 neurosurgical simulation}, 10686 year = {2010} 10687} 10688 10689@Misc{ aharon2005gpu, 10690 author = {Aharon, S.}, 10691 date-added = {2010-08-19 15:44:32 -0500}, 10692 date-modified = {2010-08-19 15:44:32 -0500}, 10693 month = apr, 10694 note = {US Patent App. 11/115,642}, 10695 publisher = {Google Patents}, 10696 title = {{GPU}-based Finite Element}, 10697 year = {2005} 10698} 10699 10700@Article{ cevahir2009fast, 10701 author = {Cevahir, A. and Nukada, A. and Matsuoka, S.}, 10702 date-added = {2010-08-19 15:44:01 -0500}, 10703 date-modified = {2010-08-19 15:44:01 -0500}, 10704 journal = {Computational Science--ICCS 2009}, 10705 pages = {893--903}, 10706 publisher = {Springer}, 10707 title = {Fast conjugate gradients with multiple {GPU}s}, 10708 year = {2009} 10709} 10710 10711@Article{ maier1995symmetric, 10712 author = {Maier, G. and Miccoli, S. and Perego, U. and Novati, G.}, 10713 date-added = {2010-08-19 15:43:57 -0500}, 10714 date-modified = {2010-08-19 15:43:57 -0500}, 10715 journal = {Computational Mechanics}, 10716 number = {1}, 10717 pages = {115--129}, 10718 publisher = {Springer}, 10719 title = {Symmetric {G}alerkin boundary element method in plasticity and gradient 10720 plasticity}, 10721 volume = {17}, 10722 year = {1995} 10723} 10724 10725@Article{ corrigan-running, 10726 author = {Corrigan, A. and Camelli, F. and L{\\"o}hner, R. and Wallin, J.}, 10727 date-added = {2010-08-19 15:43:47 -0500}, 10728 date-modified = {2010-08-19 15:43:47 -0500}, 10729 journal = {International Journal for Numerical Methods in Fluids}, 10730 publisher = {John Wiley \& Sons}, 10731 title = {Running unstructured grid based CFD solvers on modern graphics hardware} 10732} 10733 10734@InProceedings{ volkov08, 10735 author = {Vasily Volkov and James W. Demmel}, 10736 title = {Benchmarking GPUs to tune dense linear algebra}, 10737 booktitle = {Proceedings of the 2008 ACM/IEEE Conference on Supercomputing (SC08)}, 10738 note = {\url{http://mc.stanford.edu/cgi-bin/images/6/65/SC08_Volkov_GPU.pdf}}, 10739 year = {2008} 10740} 10741 10742@TechReport{ cray-mvmult, 10743 author = {Guy~E. Blelloch and Michael~A. Heroux and Marco Zagha}, 10744 title = {Segmented Operations for Sparse Matrix Computation on Vector Multiprocessors}, 10745 institution = {School of Computer Science, Carnegie Mellon University}, 10746 number = {CMU-CS-93-173}, 10747 month = aug, 10748 year = {1993} 10749} 10750 10751@Conference{ bell2009implementing, 10752 author = {Bell, N. and Garland, M.}, 10753 booktitle = {Proceedings of the Conference on High Performance Computing Networking, Storage 10754 and Analysis}, 10755 date-added = {2010-08-19 15:43:42 -0500}, 10756 date-modified = {2010-08-19 15:43:42 -0500}, 10757 organization = {ACM}, 10758 pages = {1--11}, 10759 title = {Implementing sparse matrix-vector multiplication on throughput-oriented 10760 processors}, 10761 year = {2009} 10762} 10763 10764@Article{ bell2008efficient, 10765 author = {Bell, N. and Garland, M.}, 10766 date-added = {2010-08-19 15:43:36 -0500}, 10767 date-modified = {2010-08-19 15:43:36 -0500}, 10768 journal = {{NVIDIA} Corporation, {NVIDIA} Technical Report NVR-2008-004}, 10769 title = {Efficient sparse matrix-vector multiplication on {CUDA}}, 10770 year = {2008} 10771} 10772 10773@Article{ cohen-fast, 10774 author = {Cohen, J. and Molemaker, M.J.}, 10775 date-added = {2010-08-19 15:43:34 -0500}, 10776 date-modified = {2010-08-19 15:43:34 -0500}, 10777 journal = {Parallel Computational Fluid Dynamics: Recent Advances and Future Directions}, 10778 pages = {414}, 10779 publisher = {DEStech Publications}, 10780 title = {A fast double precision CFD code using CUDA} 10781} 10782 10783@Article{ kazhdan2008streaming, 10784 author = {Kazhdan, M. and Hoppe, H.}, 10785 date-added = {2010-08-19 15:43:32 -0500}, 10786 date-modified = {2010-08-19 15:43:32 -0500}, 10787 journal = {ACM Transactions on Graphics (TOG)}, 10788 number = {3}, 10789 pages = {21}, 10790 publisher = {ACM}, 10791 title = {Streaming multigrid for gradient-domain operations on large images}, 10792 volume = {27}, 10793 year = {2008} 10794} 10795 10796@Article{ bonnet1998symmetric, 10797 author = {Bonnet, M. and Maier, G. and Polizzotto, C.}, 10798 date-added = {2010-08-19 15:43:18 -0500}, 10799 date-modified = {2010-08-19 15:43:18 -0500}, 10800 journal = {Appl. Mech. Rev}, 10801 pages = {669--704}, 10802 title = {Symmetric {G}alerkin boundary element method.}, 10803 volume = {51}, 10804 year = {1998} 10805} 10806 10807@Conference{ zamith2007gpu, 10808 author = {Zamith, M. and Clua, E. and Pagliosa, P. and Conci, A. and Montenegro, A. and 10809 Valente, L.}, 10810 booktitle = {Proceedings of the VI Brazilian Symposium on Computer Games and Digital 10811 Entertainment}, 10812 date-added = {2010-08-19 15:43:14 -0500}, 10813 date-modified = {2010-08-19 15:43:14 -0500}, 10814 pages = {37--43}, 10815 title = {The {GPU} used as a math co-processor in real time applications}, 10816 year = {2007} 10817} 10818 10819@Article{ baskaran2009optimizing, 10820 author = {Baskaran, M.M. and Bordawekar, R.}, 10821 date-added = {2010-08-19 15:42:56 -0500}, 10822 date-modified = {2010-08-19 15:42:56 -0500}, 10823 journal = {IBM Research Report RC24704, IBM}, 10824 title = {Optimizing sparse matrix-vector multiplication on {GPU}s}, 10825 year = {2009} 10826} 10827 10828@Misc{ szeliski2006locally, 10829 author = {Szeliski, R.}, 10830 date-added = {2010-08-19 15:42:45 -0500}, 10831 date-modified = {2010-08-19 15:42:45 -0500}, 10832 month = jul, 10833 note = {US Patent App. 11/459,724}, 10834 publisher = {Google Patents}, 10835 title = {Locally adapted hierarchical basis preconditioning}, 10836 year = {2006} 10837} 10838 10839@Article{ jung2006cholesky, 10840 author = {Jung, J.H. and O'Leary, D.P.}, 10841 date-added = {2010-08-19 15:42:34 -0500}, 10842 date-modified = {2010-08-19 15:42:34 -0500}, 10843 journal = {Scholarly Paper, University of Maryland}, 10844 publisher = {Citeseer}, 10845 title = {Cholesky decomposition and linear programming on a {GPU}}, 10846 year = {2006} 10847} 10848 10849@Conference{ filipovic2009gpu, 10850 author = {Filipovic, J. and Peterlik, I. and Fousek, J.}, 10851 booktitle = {SAAHPC: Symposium on Application Accelerators in HPC}, 10852 date-added = {2010-08-19 15:42:33 -0500}, 10853 date-modified = {2010-08-19 15:42:33 -0500}, 10854 title = {{GPU} Acceleration of Equations Assembly in Finite Elements Method-Preliminary 10855 Results}, 10856 year = {2009} 10857} 10858 10859@Article{ taylor2009modelling, 10860 author = {Taylor, ZA and Comas, O. and Cheng, M. and Passenger, J. and Hawkes, DJ and 10861 Atkinson, D. and Ourselin, S.}, 10862 date-added = {2010-08-19 15:42:23 -0500}, 10863 date-modified = {2010-08-19 15:42:23 -0500}, 10864 journal = {Medical Image Analysis}, 10865 number = {2}, 10866 pages = {234--244}, 10867 publisher = {Elsevier}, 10868 title = {On modelling of anisotropic viscoelasticity for soft tissue simulation: Numerical 10869 solution and {GPU} execution}, 10870 volume = {13}, 10871 year = {2009} 10872} 10873 10874@Conference{ owens2007survey, 10875 author = {Owens, J.D. and Luebke, D. and Govindaraju, N. and Harris, M. and Kr{\\"u}ger, J. 10876 and Lefohn, A.E. and Purcell, T.J.}, 10877 booktitle = {Computer Graphics Forum}, 10878 date-added = {2010-08-19 15:42:21 -0500}, 10879 date-modified = {2010-08-19 15:42:21 -0500}, 10880 number = {1}, 10881 organization = {John Wiley \& Sons}, 10882 pages = {80--113}, 10883 title = {A survey of general-purpose computation on graphics hardware}, 10884 volume = {26}, 10885 year = {2007} 10886} 10887 10888@Article{ strzodka2005scientific, 10889 author = {Strzodka, R. and Doggett, M. and Kolb, A.}, 10890 date-added = {2010-08-19 15:42:18 -0500}, 10891 date-modified = {2010-08-19 15:42:18 -0500}, 10892 journal = {Simulation Modelling Practice and Theory}, 10893 number = {8}, 10894 pages = {667--680}, 10895 publisher = {Elsevier}, 10896 title = {Scientific computation for simulations on programmable graphics hardware}, 10897 volume = {13}, 10898 year = {2005} 10899} 10900 10901@Conference{ rumpf2001using, 10902 author = {Rumpf, M. and Strzodka, R.}, 10903 booktitle = {Proc. of IASTED Visualization, Imaging and Image Processing Conference 10904 (VIIP-01)}, 10905 date-added = {2010-08-19 15:42:15 -0500}, 10906 date-modified = {2010-08-19 15:42:15 -0500}, 10907 organization = {Citeseer}, 10908 pages = {193--202}, 10909 title = {Using graphics cards for quantized FEM computations}, 10910 year = {2001} 10911} 10912 10913@Article{ sirtori1992galerkin, 10914 author = {Sirtori, S. and Maier, G. and Novati, G. and Miccoli, S.}, 10915 date-added = {2010-08-19 15:42:14 -0500}, 10916 date-modified = {2010-08-19 15:42:14 -0500}, 10917 journal = {International Journal for Numerical Methods in Engineering}, 10918 number = {2}, 10919 pages = {255--282}, 10920 publisher = {John Wiley \& Sons}, 10921 title = {A {G}alerkin symmetric boundary-element method in elasticity: formulation and 10922 implementation}, 10923 volume = {35}, 10924 year = {1992} 10925} 10926 10927@Article{ tejada2005large, 10928 author = {Tejada, E. and Ertl, T.}, 10929 date-added = {2010-08-19 15:42:09 -0500}, 10930 date-modified = {2010-08-19 15:42:09 -0500}, 10931 journal = {Simulation Modelling Practice and Theory}, 10932 number = {8}, 10933 pages = {703--715}, 10934 publisher = {Elsevier}, 10935 title = {Large steps in {GPU}-based deformable bodies simulation}, 10936 volume = {13}, 10937 year = {2005} 10938} 10939 10940@Article{ goddeke2008using, 10941 author = {Goddeke, D. and Strzodka, R. and Mohd-Yusof, J. and McCormick, P. and Wobker, H. 10942 and Becker, C. and Turek, S.}, 10943 date-added = {2010-08-19 15:42:06 -0500}, 10944 date-modified = {2010-08-19 15:42:06 -0500}, 10945 journal = {International Journal of Computational Science and Engineering}, 10946 number = {1}, 10947 pages = {36--55}, 10948 publisher = {Inderscience}, 10949 title = {Using {GPU}s to improve multigrid solver performance on a cluster}, 10950 volume = {4}, 10951 year = {2008} 10952} 10953 10954@Article{ garland2008parallel, 10955 author = {Garland, M. and Le Grand, S. and Nickolls, J. and Anderson, J. and Hardwick, J. 10956 and Morton, S. and Phillips, E. and Zhang, Y. and Volkov, V.}, 10957 date-added = {2010-08-19 15:41:51 -0500}, 10958 date-modified = {2010-08-19 15:41:51 -0500}, 10959 journal = {IEEE Micro}, 10960 number = {4}, 10961 pages = {13--27}, 10962 title = {Parallel computing experiences with CUDA}, 10963 volume = {28}, 10964 year = {2008} 10965} 10966 10967@Article{ wong1985method, 10968 author = {Wong, SH and Ciric, IR}, 10969 date-added = {2010-08-19 15:41:48 -0500}, 10970 date-modified = {2010-08-19 15:41:48 -0500}, 10971 journal = {COMPEL: The International Journal for Computation and Mathematics in Electrical 10972 and Electronic Engineering}, 10973 publisher = {MCB UP Ltd}, 10974 title = {Method of conformal transformation for the finite-element solution of 10975 axisymmetric exterior-field problems}, 10976 volume = {4}, 10977 year = {1985} 10978} 10979 10980@Article{ turek-feast, 10981 author = {Turek, S. and G{\\"o}ddeke, D. and Becker, C. and Buijssen, S.H.M. and Wobker, 10982 H.}, 10983 date-added = {2010-08-19 15:41:47 -0500}, 10984 date-modified = {2010-08-19 15:41:47 -0500}, 10985 journal = {Concurrency and Computation: Practice and Experience}, 10986 publisher = {John Wiley \& Sons}, 10987 title = {FEAST-realization of hardware-oriented numerics for HPC simulations with finite 10988 elements} 10989} 10990 10991@Article{ abedi2006space, 10992 author = {Abedi, R. and Petracovici, B. and Haber, R.B.}, 10993 date-added = {2010-08-19 15:41:46 -0500}, 10994 date-modified = {2010-08-19 15:41:46 -0500}, 10995 journal = {Computer Methods in Applied Mechanics and Engineering}, 10996 number = {25-28}, 10997 pages = {3247--3273}, 10998 publisher = {Elsevier}, 10999 title = {A space-time discontinuous {G}alerkin method for linearized elastodynamics with 11000 element-wise momentum balance}, 11001 volume = {195}, 11002 year = {2006} 11003} 11004 11005@Conference{ georgii2005interactiveb, 11006 author = {Georgii, J. and Westermann, R.}, 11007 booktitle = {Proceedings of VMV}, 11008 date-added = {2010-08-19 15:41:36 -0500}, 11009 date-modified = {2010-08-19 15:41:36 -0500}, 11010 title = {Interactive simulation and rendering of heterogeneous deformable bodies}, 11011 year = {2005} 11012} 11013 11014@Article{ mosegaard2005gpu, 11015 author = {Mosegaard, J. and others}, 11016 date-added = {2010-08-19 15:41:35 -0500}, 11017 date-modified = {2010-08-19 15:41:35 -0500}, 11018 publisher = {IEEE Computer Society}, 11019 title = {{GPU} accelerated surgical simulators for complex morphology}, 11020 year = {2005} 11021} 11022 11023@Article{ meyer2007particle, 11024 author = {Meyer, M. and Nelson, B. and Kirby, R. and Whitaker, R.}, 11025 date-added = {2010-08-19 15:41:33 -0500}, 11026 date-modified = {2010-08-19 15:41:33 -0500}, 11027 journal = {IEEE Transactions on Visualization and Computer Graphics}, 11028 pages = {1015--1026}, 11029 publisher = {Published by the IEEE Computer Society}, 11030 title = {Particle systems for efficient and accurate high-order finite element 11031 visualization}, 11032 year = {2007} 11033} 11034 11035@Conference{ rumpf2001nonlinear, 11036 author = {Rumpf, M. and Strzodka, R.}, 11037 booktitle = {Data Visualization 2001: proceedings of the Joint Eurographics-IEEE TCVG 11038 Symposium on Visualization in Ascona, Switzerland, May 28-30, 2001}, 11039 date-added = {2010-08-19 15:41:29 -0500}, 11040 date-modified = {2010-08-19 15:41:29 -0500}, 11041 organization = {Springer Verlag Wien}, 11042 pages = {75}, 11043 title = {Nonlinear diffusion in graphics hardware}, 11044 year = {2001} 11045} 11046 11047@Article{ georgii2005interactive, 11048 author = {Georgii, J. and Echtler, F. and Westermann, R.}, 11049 date-added = {2010-08-19 15:41:28 -0500}, 11050 date-modified = {2010-08-19 15:41:28 -0500}, 11051 journal = {Simulation and Visualisation}, 11052 pages = {247--258}, 11053 publisher = {Citeseer}, 11054 title = {Interactive simulation of deformable bodies on {GPU}s}, 11055 volume = {2005}, 11056 year = {2005} 11057} 11058 11059@Article{ harish2007accelerating, 11060 author = {Harish, P. and Narayanan, P.}, 11061 date-added = {2010-08-19 15:41:27 -0500}, 11062 date-modified = {2010-08-19 15:41:27 -0500}, 11063 journal = {High Performance Computing--HiPC 2007}, 11064 pages = {197--208}, 11065 publisher = {Springer}, 11066 title = {Accelerating large graph algorithms on the {GPU} using CUDA}, 11067 year = {2007} 11068} 11069 11070@Article{ keunings1995parallel, 11071 author = {Keunings, R.}, 11072 date-added = {2010-08-19 15:41:19 -0500}, 11073 date-modified = {2010-08-19 15:41:19 -0500}, 11074 journal = {Computers and Chemical Engineering}, 11075 number = {6}, 11076 pages = {647--670}, 11077 publisher = {Oxford; New York: Pergamon Press, 1977-}, 11078 title = {Parallel finite element algorithms applied to computational rheology}, 11079 volume = {19}, 11080 year = {1995} 11081} 11082 11083@Conference{ taylor2007real, 11084 author = {Taylor, Z.A. and Cheng, M. and Ourselin, S.}, 11085 booktitle = {Proceedings of the 10th international conference on Medical image computing and 11086 computer-assisted intervention-Volume Part I}, 11087 date-added = {2010-08-19 15:41:17 -0500}, 11088 date-modified = {2010-08-19 15:41:17 -0500}, 11089 organization = {Springer-Verlag}, 11090 pages = {701--708}, 11091 title = {Real-time nonlinear finite element analysis for surgical simulation using 11092 graphics processing units}, 11093 year = {2007} 11094} 11095 11096@Article{ liu2000finite, 11097 author = {Liu, R. and Li, DY}, 11098 date-added = {2010-08-19 15:41:16 -0500}, 11099 date-modified = {2010-08-19 15:41:16 -0500}, 11100 journal = {Materials Science and Engineering A}, 11101 number = {1-2}, 11102 pages = {169--175}, 11103 publisher = {Elsevier}, 11104 title = {A finite element model study on wear resistance of pseudoelastic {TiNi} alloy}, 11105 volume = {277}, 11106 year = {2000} 11107} 11108 11109@Conference{ kakadiaris1994active, 11110 author = {Kakadiaris, I.A. and Metaxas, D. and Bajcsy, R.}, 11111 booktitle = {IEEE Computer Society Conference on Computer Vision and Pattern Recognition}, 11112 date-added = {2010-08-19 15:41:15 -0500}, 11113 date-modified = {2010-08-19 15:41:15 -0500}, 11114 organization = {Citeseer}, 11115 pages = {980--980}, 11116 title = {Active part-decomposition, shape, and motion estimation of articulated objects: A 11117 physics-based approach}, 11118 year = {1994} 11119} 11120 11121@Conference{ de2004gpu, 11122 author = {De Pascale, M. and De Pascale, G. and Prattichizzo, D. and Barbagli, F.}, 11123 booktitle = {Proceedings of Eurohaptics}, 11124 date-added = {2010-08-19 15:41:14 -0500}, 11125 date-modified = {2010-08-19 15:41:14 -0500}, 11126 organization = {Citeseer}, 11127 pages = {44--51}, 11128 title = {A {GPU}-friendly method for haptic and graphic rendering of deformable objects}, 11129 volume = {2004}, 11130 year = {2004} 11131} 11132 11133@Book{ taflove1995computational, 11134 author = {Taflove, A. and Hagness, S.C.}, 11135 date-added = {2010-08-19 15:41:14 -0500}, 11136 date-modified = {2010-08-19 15:41:14 -0500}, 11137 publisher = {Artech House Norwood, MA}, 11138 title = {Computational electrodynamics}, 11139 year = {1995} 11140} 11141 11142@Conference{ galoppo2005lu, 11143 author = {Galoppo, N. and Govindaraju, N.K. and Henson, M. and Manocha, D.}, 11144 booktitle = {Proceedings of the 2005 ACM/IEEE conference on Supercomputing}, 11145 date-added = {2010-08-19 15:41:13 -0500}, 11146 date-modified = {2010-08-19 15:41:13 -0500}, 11147 organization = {IEEE Computer Society}, 11148 pages = {3}, 11149 title = {{LU-GPU}: Efficient algorithms for solving dense linear systems on graphics 11150 hardware}, 11151 year = {2005} 11152} 11153 11154@Conference{ ryoo2008optimization, 11155 author = {Ryoo, S. and Rodrigues, C.I. and Baghsorkhi, S.S. and Stone, S.S. and Kirk, D.B. 11156 and Hwu, W.W.}, 11157 booktitle = {Proceedings of the 13th ACM SIGPLAN Symposium on Principles and practice of 11158 parallel programming}, 11159 date-added = {2010-08-19 15:41:12 -0500}, 11160 date-modified = {2010-08-19 15:41:12 -0500}, 11161 organization = {ACM}, 11162 pages = {73--82}, 11163 title = {Optimization principles and application performance evaluation of a multithreaded 11164 {GPU} using CUDA}, 11165 year = {2008} 11166} 11167 11168@Conference{ micikevicius20093d, 11169 author = {Micikevicius, P.}, 11170 booktitle = {Proceedings of 2nd Workshop on General Purpose Processing on Graphics Processing 11171 Units}, 11172 date-added = {2010-08-19 15:41:11 -0500}, 11173 date-modified = {2010-08-19 15:41:11 -0500}, 11174 organization = {ACM}, 11175 pages = {79--84}, 11176 title = {3D finite difference computation on {GPU}s using {CUDA}}, 11177 year = {2009} 11178} 11179 11180@Conference{ zhou2004pixel, 11181 author = {Zhou, Y. and Garland, M. and Haber, R.}, 11182 booktitle = {IEEE Visualization, 2004}, 11183 date-added = {2010-08-19 15:41:03 -0500}, 11184 date-modified = {2010-08-19 15:41:03 -0500}, 11185 pages = {425--432}, 11186 title = {Pixel-exact rendering of spacetime finite element solutions}, 11187 year = {2004} 11188} 11189 11190@Article{ komatitsch2009porting, 11191 author = {Komatitsch, D. and Mich{\'e}a, D. and Erlebacher, G.}, 11192 date-added = {2010-08-19 15:41:01 -0500}, 11193 date-modified = {2010-08-19 15:41:01 -0500}, 11194 journal = {Journal of Parallel and Distributed Computing}, 11195 number = {5}, 11196 pages = {451--460}, 11197 publisher = {Elsevier}, 11198 title = {Porting a high-order finite-element earthquake modeling application to NVIDIA 11199 graphics cards using CUDA}, 11200 volume = {69}, 11201 year = {2009} 11202} 11203 11204@Article{ komatitsch1998spectral, 11205 author = {Komatitsch, D. and Vilotte, J.P.}, 11206 date-added = {2010-08-19 15:40:59 -0500}, 11207 date-modified = {2010-08-19 15:40:59 -0500}, 11208 journal = {Bulletin of the Seismological Society of America}, 11209 number = {2}, 11210 pages = {368--392}, 11211 publisher = {[El Cerrito, Calif., etc., Seismological Society of America, etc.]}, 11212 title = {The spectral element method: {A}n efficient tool to simulate the seismic response 11213 of 2D and 3D geological structures}, 11214 volume = {88}, 11215 year = {1998} 11216} 11217 11218@Article{ wu2005improved, 11219 author = {Wu, W. and Heng, P.A.}, 11220 date-added = {2010-08-19 15:40:59 -0500}, 11221 date-modified = {2010-08-19 15:40:59 -0500}, 11222 journal = {The Visual Computer}, 11223 number = {8}, 11224 pages = {707--716}, 11225 publisher = {Springer}, 11226 title = {An improved scheme of an interactive finite element model for 3D soft-tissue 11227 cutting and deformation}, 11228 volume = {21}, 11229 year = {2005} 11230} 11231 11232@Article{ taylor2008high, 11233 author = {Taylor, Z.A. and Cheng, M. and Ourselin, S.}, 11234 date-added = {2010-08-19 15:40:57 -0500}, 11235 date-modified = {2010-08-19 15:40:57 -0500}, 11236 journal = {IEEE transactions on medical imaging}, 11237 number = {5}, 11238 pages = {650}, 11239 title = {High-speed nonlinear finite element analysis for surgical simulation using 11240 graphics processing units.}, 11241 volume = {27}, 11242 year = {2008} 11243} 11244 11245@Conference{ bolz2003sparse, 11246 author = {Bolz, J. and Farmer, I. and Grinspun, E. and Schr{\\"o}oder, P.}, 11247 booktitle = {ACM SIGGRAPH 2003 Papers}, 11248 date-added = {2010-08-19 15:40:55 -0500}, 11249 date-modified = {2010-08-19 15:40:55 -0500}, 11250 organization = {ACM}, 11251 pages = {924}, 11252 title = {Sparse matrix solvers on the {GPU}: conjugate gradients and multigrid}, 11253 year = {2003} 11254} 11255 11256@Article{ wu2004hybrid, 11257 author = {Wu, W. and Heng, P.A.}, 11258 date-added = {2010-08-19 15:40:54 -0500}, 11259 date-modified = {2010-08-19 15:40:54 -0500}, 11260 journal = {Computer Animation and Virtual Worlds}, 11261 number = {3-4}, 11262 pages = {219--227}, 11263 publisher = {John Wiley \& Sons}, 11264 title = {A hybrid condensed finite element model with {GPU} acceleration for interactive 11265 3D soft tissue cutting}, 11266 volume = {15}, 11267 year = {2004} 11268} 11269 11270% ---------------------------------------------------------------------------------------------------------------- 11271@TechReport{ davis97, 11272 author = {T. Davis}, 11273 title = {The {U}niversity of {F}lorida Sparse Matrix Collection}, 11274 institution = {University of Florida}, 11275 year = {1997} 11276} 11277 11278@Article{ davis2011, 11279 author = {Davis, T. A. and Hu, Y.}, 11280 title = {The {U}niversity of {F}lorida sparse matrix collection}, 11281 journal = {ACM Transactions on Mathematical Software}, 11282 volume = {38}, 11283 issue = {1}, 11284 year = {2011}, 11285 pages = {1--25} 11286} 11287 11288@Article{ davis2004algorithm, 11289 title = {Algorithm 832: {UMFPACK} V4.3---An Unsymmetric-Pattern Multifrontal Method}, 11290 author = {Davis, Timothy A}, 11291 journal = {ACM Transactions on Mathematical Software}, 11292 volume = {30}, 11293 number = {2}, 11294 pages = {196--199}, 11295 year = {2004}, 11296 publisher = {ACM} 11297} 11298 11299@TechReport{ streams, 11300 author = {J. D. McCalpin}, 11301 title = {{STREAM}: Sustainable memory bandwidth in high performance computers}, 11302 institution = {University of Virginia}, 11303 url = {http://www.cs.virginia.edu/stream}, 11304 year = {1995} 11305} 11306 11307@Article{ areusken_1988b, 11308 author = {A. Reusken}, 11309 title = {Convergence of the multigrid full approximation scheme for a class of elliptic 11310 mildly nonlinear boundary value problems}, 11311 journal = {Numer. Math.}, 11312 volume = {52}, 11313 year = {1988}, 11314 pages = {251--277} 11315} 11316 11317@Article{ areusken_1988c, 11318 author = {A. Reusken}, 11319 title = {Convergence of the multigrid full approximation scheme including the {V}--cycle}, 11320 journal = {Numer. Math.}, 11321 volume = {53}, 11322 year = {1988}, 11323 pages = {663--686} 11324} 11325 11326@Unpublished{ mgnet, 11327 title = {Multigrid Net; http://www.mgnet.org/}, 11328 author = {Craig Douglas}, 11329 note = {Contains enormous bibliography on multigrid publications}, 11330 year = {2009} 11331} 11332 11333@Unpublished{ copper, 11334 title = {Fourteenth Copper Mountain Conference on Multigrid Methods}, 11335 author = {}, 11336 note = {Held bi-annually}, 11337 year = {2009} 11338} 11339 11340@Book{ wessling1992, 11341 author = {Pieter Wesseling}, 11342 title = {An Introduction to Multigrid Methods}, 11343 year = {2004}, 11344 publisher = {R. T. Edwards} 11345} 11346 11347@Book{ bhm2000, 11348 author = {William L. Briggs and Van Emden Henson and Steve F. McCormick}, 11349 title = {A Multigrid Tutorial}, 11350 year = {2000}, 11351 publisher = {SIAM} 11352} 11353 11354@Book{ trottenberg2001multigrid, 11355 title = {{Multigrid}}, 11356 author = {Trottenberg, U. and Oosterlee, C.W. and Sch{\"u}ller, A.}, 11357 isbn = {012701070X}, 11358 year = {2001}, 11359 publisher = {Academic Press} 11360} 11361 11362@TechReport{ brandt1984, 11363 author = {Achi Brandt}, 11364 title = {Multigrid Techniques: 1984 Guide with Applications for Fluid Dynamics}, 11365 institution = {Gesellschaft fur Mathematik und Dataenverarbeitung}, 11366 number = {GMD-Studien Nr. 85}, 11367 year = {1984} 11368} 11369 11370@Article{ yavneh1998coarse, 11371 title = {Coarse-Grid Correction for Nonelliptic and Singular Perturbation Problems}, 11372 author = {Yavneh, I.}, 11373 journal = {SIAM Journal on Scientific Computing}, 11374 volume = {19}, 11375 number = {5}, 11376 pages = {1682--1699}, 11377 year = {1998}, 11378 publisher = {Society for Industrial and Applied Mathematics} 11379} 11380 11381@Article{ wan2003phase, 11382 title = {A Phase Error Analysis of Multigrid Methods for Hyperbolic Equations}, 11383 author = {Wan, WL and Chan, T.F.}, 11384 journal = {SIAM Journal on Scientific Computing}, 11385 volume = {25}, 11386 pages = {857}, 11387 year = {2003} 11388} 11389 11390@Article{ imex, 11391 author = {Uri M. Ascher and Steven J. Ruuth and Brian T. R. Wetton}, 11392 title = {Implicit-Explicit Methods for Time-Dependent Partial Differential Equations}, 11393 journal = {SIAM Journel on Numerical Analysis}, 11394 volume = {32}, 11395 number = {3}, 11396 pages = {797--823}, 11397 year = {1995} 11398} 11399 11400@Article{ ow1, 11401 author = {T. Washio and C. W. Oosterlee}, 11402 title = {Krylov Subspace Acceleration for Nonlinear Multigrid Schemes with Application to 11403 Recirculating Flow}, 11404 journal = {SIAM Journal on Scientific Computing}, 11405 volume = {21}, 11406 number = {5}, 11407 pages = {1670--1690}, 11408 year = {2000} 11409} 11410 11411@Article{ vm1, 11412 author = {V. A. Mousseau}, 11413 title = {Implicitly Balanced Solution of the Two-Phase Flow Equations Coupled to Nonlinear 11414 Heat Conduction}, 11415 journal = {Journal Of Computational Physics}, 11416 volume = {200}, 11417 pages = {104--132}, 11418 year = {2004} 11419} 11420 11421@Article{ vm2, 11422 author = {V. A. Mousseau}, 11423 title = {A Fully Implicit Hybrid Solution Method for a Two-Phase Thermal-Hydraulic Model}, 11424 journal = {Journal Of Heat Transfer}, 11425 volume = {127}, 11426 pages = {531--539}, 11427 year = {2005} 11428} 11429 11430@Misc{ salome1, 11431 author = {Laurent Dada and Daniel Caruge}, 11432 title = {The {SALOME} Open Source {CAE} Platform Application to Reactor Physics 11433 Simulation}, 11434 year = {2005}, 11435 url = {http://conferences.esa.int/05c26/Seminar-2005-09-28-SALOME.pdf}, 11436 note = {Presentation at an ESA/ESTEC conference} 11437} 11438 11439@InProceedings{ downar1, 11440 author = {D. A. Barber and W. Wang and R. M. Miller and T. J. Downar and H. G. Joe and V. 11441 A. Mousseau and D. E. Ebert}, 11442 title = {Application of a generalized interface module to the coupling of {PARCS} with 11443 both {RELAP5} and {TRAC-M}}, 11444 booktitle = {Proceedings of 1999 annual meeting of the American Nuclear Society}, 11445 year = {1999} 11446} 11447 11448@Article{ lopez1, 11449 author = {A. P. Lopez and J. B. Sandova}, 11450 title = {A methodology for the coupling of {RAMONA-3B} neutron kinetics and {TRAC-BF1} 11451 thermal-hydraulics}, 11452 journal = {Annals of Nuclear Energy}, 11453 volume = {32(6)}, 11454 pages = {621--634}, 11455 year = {2005} 11456} 11457 11458@InProceedings{ og-1996, 11459 author = {C. R. E. de Oliveira and A. J. H. Goddard}, 11460 title = {{EVENT}: A Multidimensional Finite Element-Spherical Harmonics Radiation 11461 Transport Code}, 11462 booktitle = {Proceedings of the OECD International Seminar on 3D Deterministic Radiation 11463 Transport Codes}, 11464 editor = {}, 11465 publisher = {}, 11466 pages = {}, 11467 note = {Paris, France}, 11468 month = dec, 11469 year = {1996} 11470} 11471 11472@Article{ wo-2000, 11473 author = {P. Warner and C. R. E. de Oliveira}, 11474 title = {Verification and Validation of the 3D Finite Element Transport Theory Code 11475 {EVENT} for Shielding Applications}, 11476 journal = {J. Nucl. Sci. and Tech.}, 11477 volume = {Supplement 1}, 11478 pages = {466--470}, 11479 year = {2000} 11480} 11481 11482@Unpublished{ gnep-web, 11483 author = {{U.S. Department of Energy}}, 11484 title = {Global Nuclear Energy Partnership ({GNEP})}, 11485 note = {\url{ http://www.gnep.energy.gov}}, 11486 year = {2007} 11487} 11488 11489@Book{ lewis-miller-1984, 11490 author = {E. E. Lewis and W. F. Miller, Jr.}, 11491 title = {Computational Methods of Neutron Transport}, 11492 address = {}, 11493 publisher = {Wiley}, 11494 year = {1984} 11495} 11496 11497@Article{ couple1, 11498 author = {J. M. Cook and D. Okrent and D. Satkus and R. B. Lazarus and M. B. Wells}, 11499 title = {{AX-1}, A COMPUTING PROGRAM FOR COUPLED NEUTRONICS-HYDRODYNAMICS CALCULATIONS ON 11500 THE {IBM-704}}, 11501 journal = {Nuclear Sci. and Eng.}, 11502 year = {1959}, 11503 pages = {113--115}, 11504 volume = {2(1)} 11505} 11506 11507@InProceedings{ weber1, 11508 author = {D. P. Weber and S. S. Chen and C. Y. Wang and T. Y. C. Wei and S. Jansson}, 11509 title = {Coupled {CFD/CSM} vibration design methodology for generation {IV} long-life fuel 11510 and component design}, 11511 booktitle = {4th International Conference on Supercomputing in Nuclear Applications}, 11512 year = {2000} 11513} 11514 11515@Misc{ gnep:report, 11516 author = {Phillip Finck and David Keyes and Rick Stevens}, 11517 title = {{Report on the {DOE} Joint {NE/SC} Workshop Simulation and Modeling for Advanced 11518 Nuclear Energy Systems}}, 11519 year = {2006} 11520} 11521 11522@Misc{ subsurface-workshop-ref, 11523 author = {D. {Zachman (Chair)}}, 11524 title = {{Computational Subsurface Sciences Workshop}}, 11525 note = {January 9--12, 2007, Bethesda, MD, see \url{http://subsurface2007.labworks.org/}} 11526} 11527 11528@Misc{ fusion:report, 11529 title = {{Report of the Fusion Energy Sciences Advisory Committee Burning Plasma Strategy 11530 Panel}}, 11531 author = {{Fusion Energy Sciences Advisory Committee}}, 11532 year = {2002}, 11533 note = {see \url{http://www.ofes.fusion.doe.gov/More_HTML/FESAC/Austinfinal.pdf}} 11534} 11535 11536@Misc{ hecrtf:report, 11537 title = {{Report of the High End Computing Revitalization Task Force (HECRTF)}}, 11538 key = {HECRTF}, 11539 year = {2004}, 11540 howpublished = {see \url{http://www.ostp.gov/nstc/html/HECRTF-FINAL_051004.pdf}} 11541} 11542 11543@Misc{ doesc20years, 11544 title = {{Facilities for the Future of Science: A Twenty-Year Outlook}}, 11545 key = {Office of Science, U.S. Department of Energy}, 11546 year = {2003}, 11547 howpublished = {Office of Science, U.S. Department of Energy, see 11548 \url{http://www.sc.doe.gov/Scientific_User_Facilities/History/20-Year-Outlook-screen.pdf}} 11549} 11550 11551@PhDThesis{ karpeev-thesis, 11552 author = {D. A. Karpeyev}, 11553 title = {Geometric Integrators for Hamiltonian PDEs}, 11554 school = {Old Dominion University}, 11555 year = {2002} 11556} 11557 11558@InCollection{ fjp:ima, 11559 author = {Lori Freitag and Mark Jones and Paul Plassmann}, 11560 title = {The Scalability of Mesh Improvement Algorithms}, 11561 booktitle = {Algorithms for Parallel Processing}, 11562 publisher = {Springer-Verlag}, 11563 volume = {105}, 11564 series = {The IMA Volumes in Mathematics and Its Applications}, 11565 editor = {Michael T.\ Heath and Abhiram Ranade and Robert S.\ Schreiber}, 11566 year = {1998}, 11567 pages = {185--212} 11568} 11569 11570@InProceedings{ poet, 11571 author = {Rob Armstrong and Alex Cheung}, 11572 title = {{POET} ({P}arallel {O}bject-Oriented {E}nvironment and {T}oolkit) and Frameworks 11573 for Scientific Distributed Computing}, 11574 booktitle = {Proceedings of {HICSS97}}, 11575 year = {1997} 11576} 11577 11578@Misc{ pseware-web-page, 11579 author = {}, 11580 title = {{PSEware} {Web} page}, 11581 note = {\url{http://www.extreme.indiana.edu/pseware}, Indiana University}, 11582 key = {{PSEware} {Web} page} 11583} 11584 11585@Article{ epperly2011high, 11586 title = {High-performance language interoperability for scientific computing through 11587 {B}abel}, 11588 author = {Epperly, Thomas GW and Kumfert, Gary and Dahlgren, Tamara and Ebner, Dietmar and 11589 Leek, Jim and Prantl, Adrian and Kohn, Scott}, 11590 journal = {International Journal of High Performance Computing Applications}, 11591 pages = {1094342011414036}, 11592 year = {2011}, 11593 publisher = {SAGE Publications} 11594} 11595 11596@Misc{ babel-web-page, 11597 author = {Tom Epperly and Tamara Dahlgren and Gary Kumfert}, 11598 title = {{Babel} {Web} page}, 11599 note = {\url{http://www.llnl.gov/CASC/components/babel.html}} 11600} 11601 11602@Misc{ infospheres-web-page, 11603 author = {K.~M. {Chandy et al.}}, 11604 title = {{Infospheres} {W}eb page}, 11605 note = {\url{http://www.infospheres.caltech.edu}}, 11606 key = {{Infospheres} {Web} page} 11607} 11608 11609@Misc{ hammond, 11610 author = {Glenn Hammond}, 11611 title = {{Sandia National Laboratory}, {C}omputations on {R}eactive {F}low, private 11612 communication} 11613} 11614 11615@Misc{ ornl, 11616 author = {Oak Ridge National Laboratory}, 11617 title = {Private communication via petsc-maint email support} 11618} 11619 11620@Unpublished{ cumulvs-web-page, 11621 author = {}, 11622 title = {{Cumulvs} {W}eb page}, 11623 note = {http://www.epm.ornl.gov/cs/cumulvs.html}, 11624 key = {{Cumulvs} {W}eb page} 11625} 11626 11627@Article{ nonlineargmres, 11628 author = {T. Washio and C. W. Oosterlee}, 11629 title = {Krylov Subspace Acceleration for Nonlinear Multigrid Schemes}, 11630 journal = {ETNA}, 11631 year = {1997}, 11632 pages = {271--290}, 11633 volume = {6} 11634} 11635 11636@Article{ pcice, 11637 author = {Richard C. Martineau and Ray A. Berry}, 11638 title = {The pressure-corrected ICE finite element method for compressible flows on 11639 unstructured meshes}, 11640 journal = {Journal of Computational Physics}, 11641 year = {2004}, 11642 pages = {659--685}, 11643 volume = {198(2)} 11644} 11645 11646@Article{ cumulvs97, 11647 author = {G. A. Geist and J. A. Kohl and P. M. Papadopoulos}, 11648 title = {{CUMULVS}: Providing Fault-Tolerance, Visualization, and Steering of Parallel 11649 Applications}, 11650 journal = {International Journal of Supercomputing Applications}, 11651 year = {1997} 11652} 11653 11654@TechReport{ daly2012interagency, 11655 author = {John Daly and Bill Harrod and Thuc Hoang and Lucy Nowell and Bob Adolf and 11656 Shekhar Borkar and Nathan DeBardeleben and Mootaz Elnozahy and Mike Heroux and 11657 David Rogers and Rob Ross and Vivek Sarkar and Martin Schulz and Marc Snir and 11658 Paul Woodward}, 11659 title = {Inter-Agency Workshop on HPC Resilience at Extreme Scale}, 11660 year = {2012}, 11661 publisher = {US Department of Defense} 11662} 11663 11664@Article{ karpeev1, 11665 author = {A. L. Islas and D. A. Karpeev and C. M. Schober}, 11666 title = {Geometric Integrators for the Nonlinear Schr\"odinger Equation}, 11667 journal = {J. Comp. Phys.}, 11668 year = {2001}, 11669 pages = {116--148}, 11670 volume = {173} 11671} 11672 11673@InProceedings{ scirun97, 11674 author = {S. G. Parker and D. W. Weinstein and C. R. Johnson}, 11675 title = {The {SCIRun} Computational Steering System}, 11676 booktitle = {Modern Software Tools in Scientific Computing}, 11677 editor = {E. Arge and A. M. Bruaset and H. P. Langtangen}, 11678 publisher = {Birkhauser Press}, 11679 year = {1997} 11680} 11681 11682@TechReport{ szyld, 11683 author = {Valeria Simoncini and Daniel B. Szyld}, 11684 title = { Theory of Inexact Krylov Subspace Methods and Applications to Scientific 11685 Computing}, 11686 year = {2002}, 11687 institution = {Department of Mathematics, Temple University}, 11688 number = {02-4-12} 11689} 11690 11691@TechReport{ pdelab, 11692 author = {S. Weerawarana and E. N. Houstis and J. R. Rice and A. C. Catlin and C. Crabill 11693 and C. C. Chui and S. Markus}, 11694 title = {{PDELab}: An Object-Oriented Framework for Building Problem Solving Environments 11695 for {PDE} Based Applications}, 11696 year = {1994}, 11697 institution = {Department of Computer Sciences, Purdue University}, 11698 number = {CSD-TR-94-021} 11699} 11700 11701@Unpublished{ ilu-web-page, 11702 author = {Bill Janssen and Mike Spreitzer and Dan Larner and Chris Jacobi}, 11703 title = {{I}nter-{L}anguage {U}nification Reference Manual}, 11704 note = {ftp://ftp.parc.xerox.com/ilu/ilu.html, Xerox Corporation} 11705} 11706 11707@Unpublished{ doe2k-web-page, 11708 title = {{DOE2000 Initiative} {W}eb page}, 11709 note = {http://www.mcs.anl.gov/DOE2000}, 11710 key = {DOE2000 Initiative} 11711} 11712 11713@Misc{ pvode-web-page, 11714 title = {{PVODE} {W}eb Page}, 11715 note = {\url{http://www.llnl.gov/CASC/PVODE}, Lawrence Livermore National Laboratory}, 11716 author = {A. {Hindmarsh et al.}} 11717} 11718 11719@Book{ szyperski97, 11720 author = {Clemens Szyperski}, 11721 title = {Component Software: Beyond Object-Oriented Programming}, 11722 publisher = {ACM Press}, 11723 address = {New York}, 11724 year = {1997} 11725} 11726 11727@Unpublished{ petsc:coloringuse, 11728 title = {Code for computing sparse {J}acobians}, 11729 note = {\url{http://www.mcs.anl.gov/petsc/miscellaneous/external.html}}, 11730 institution = {Argonne National Laboratory} 11731} 11732 11733@Unpublished{ petsc:external, 11734 author = {B. F. {Smith et al.}}, 11735 title = {{External Software Used by PETSc}}, 11736 note = {\url{http://www.mcs.anl.gov/petsc/miscellaneous/external.html}}, 11737 institution = {Argonne National Laboratory} 11738} 11739 11740@Unpublished{ petsc:use-by-external-packages, 11741 author = {B. F. {Smith et al.}}, 11742 title = {{Software Packages that Use or Interface to PETSc}}, 11743 note = {\url{http://www.mcs.anl.gov/petsc/publications/petscapps.html#packages}}, 11744 institution = {Argonne National Laboratory} 11745} 11746 11747@Unpublished{ petsc:prizes, 11748 author = {B. F. {Smith et al.}}, 11749 title = {{Prizes Won Using PETSc}}, 11750 note = {\url{http://www.mcs.anl.gov/petsc/publications/prizes.html}}, 11751 institution = {Argonne National Laboratory} 11752} 11753 11754@Unpublished{ petsc:csgf, 11755 author = {B. F. {Smith et al.}}, 11756 title = {{DOE Computational Science Graduate Fellowship (CSGF) Users of PETSc}}, 11757 note = {\url{http://www.mcs.anl.gov/petsc/publications/prizes.html}}, 11758 institution = {Argonne National Laboratory} 11759} 11760 11761@Unpublished{ flash-web-page, 11762 title = {{U}niversity of {C}hicago {C}enter on {A}strophysical {T}hermonuclear {F}lashes 11763 {W}eb Page}, 11764 note = {http://www.asci.uchicago.edu}, 11765 author = {R. {Rosner et al.}}, 11766 institution = {University of Chicago} 11767} 11768 11769@Unpublished{ esi-web-page, 11770 title = {{E}quation {S}olver {I}nterface {F}orum {W}eb Page}, 11771 note = {http://z.ca.sandia.gov/esi}, 11772 author = {R. {Clay et al.}} 11773} 11774 11775@Unpublished{ infobus-web-page, 11776 title = {{I}nfo{B}us {W}eb Page}, 11777 note = {http://www.java.sun.com/beans/infobus}, 11778 key = {infobus} 11779} 11780 11781@Unpublished{ xray-web-page, 11782 title = {{S}upercomputer {S}olution of {M}assive {C}rystallographic and {M}icrotomographic 11783 {S}tructural {P}roblems {W}eb Page ({DOE} Grand Challenge Project)}, 11784 note = {http://www.mcs.anl.gov/xray/}, 11785 institution = {Argonne National Laboratory} 11786} 11787 11788@InProceedings{ kohn98, 11789 author = {Andrew Cleary and Scott Kohn and Steven Smith and Brent Smolinski}, 11790 title = {Language Interoperability Mechanisms for High-Performance Scientific 11791 Applications}, 11792 publisher = {SIAM}, 11793 booktitle = {Proceedings of the SIAM Workshop on Object Oriented Methods for Inter-operable 11794 Scientific and Engineering Computing}, 11795 year = {1999}, 11796 pages = {30-39} 11797} 11798 11799@InProceedings{ kohn01, 11800 author = {Scott Kohn and Gary Kumfert and Jeff Painter and Cal Ribbens}, 11801 title = {Divorcing Language Dependencies from a Scientific Software Library}, 11802 publisher = {SIAM}, 11803 booktitle = {Proceedings of the Tenth SIAM Conference on Parallel Processing}, 11804 year = {2001} 11805} 11806 11807@InProceedings{ freitag_jones_plassmann98, 11808 author = {Lori Freitag and Mark Jones and Paul Plassmann}, 11809 title = {Component Integration for Unstructured Mesh Algorithms and Software}, 11810 publisher = {SIAM}, 11811 booktitle = {Proceedings of the SIAM Workshop on Object Oriented Methods for Inter-operable 11812 Scientific and Engineering Computing}, 11813 year = {1999}, 11814 pages = {215-224} 11815} 11816 11817@Book{ templates, 11818 author = {R. Barrett and M. Berry and T. F. Chan and J. Demmel and J. Donato and J. 11819 Dongarra and V. Eijkhout and R. Pozo and C. Romine and H. Van der Vorst }, 11820 title = {Templates for the Solution of Linear Systems: Building Blocks for Iterative 11821 Methods}, 11822 publisher = {SIAM}, 11823 year = {1994}, 11824 address = {Philadelphia, PA} 11825} 11826 11827@InProceedings{ parasha2, 11828 author = {M. Parashar and J. C. Browne and C. Edwards and K. Klimkowski}, 11829 title = { A Common Data Management Infrastructure for Parallel Adaptive Algorithms for 11830 {PDE} Solutions}, 11831 booktitle = {SC97 Proceedings}, 11832 publisher = {IEEE Computer Society Press}, 11833 year = {1997} 11834} 11835 11836@TechReport{ parasha, 11837 author = {M. Parashar and J. C. Browne}, 11838 title = {{DAGH}: A Data-Management Infrastructure for Parallel Adaptive Mesh Refinement 11839 Techniques}, 11840 institution = {Department of Computer Science, University of Texas at Austin}, 11841 year = {1995} 11842} 11843 11844@Article{ parti, 11845 author = {R. Das and M. Uysal and J. Saltz and Y. S. Hwang}, 11846 title = {Communication Optimizations for Irregular Scientific Computations on Distributed 11847 Memory Architectures}, 11848 journal = {Journal of Parallel and Distributed Computing}, 11849 year = {1994}, 11850 volume = {22}, 11851 pages = {462--478} 11852} 11853 11854@Article{ mparti, 11855 author = {G. Agrawal and A. Sussman and J. Saltz}, 11856 title = {An Integrated Runtime and Compile-time Approach for Parallelizing Structured and 11857 Block Structured Applications}, 11858 journal = {IEEE Trans. on Parallel and Distributed Systems}, 11859 volume = {6}, 11860 number = {7}, 11861 year = {1995} 11862} 11863 11864@Article{ gropp-lusk-doss-skjellum, 11865 author = { William Gropp and Ewing Lusk and Nathan Doss and Anthony Skjellum}, 11866 title = {A high-performance, portable implementation of the {MPI} Message Passing 11867 Interface standard}, 11868 journal = {Parallel Computing}, 11869 year = {1996}, 11870 volume = {22}, 11871 pages = {789--828} 11872} 11873 11874@InProceedings{ lam, 11875 author = {Greg Burns and Raja Daoud and James Vaigl}, 11876 title = {{LAM}: An Open Cluster Environment for {MPI}}, 11877 booktitle = {Proceedings of Supercomputing Symposium '94}, 11878 editor = {John W. Ross}, 11879 publisher = {University of Toronto}, 11880 pages = {379--386}, 11881 year = {1994} 11882} 11883 11884@Article{ cs99, 11885 author = {X.-C. Cai and M. Sarkis}, 11886 title = {A restricted additive {S}chwarz preconditioner for general sparse linear 11887 systems}, 11888 journal = {SIAM J. Scientific Computing}, 11889 year = {1999}, 11890 volume = {21}, 11891 pages = {792-797} 11892} 11893 11894@TechReport{ cs97a, 11895 author = {X.-C. Cai and M. Sarkis}, 11896 title = {A restricted additive {S}chwarz preconditioner for general sparse linear systems 11897 }, 11898 year = {1997}, 11899 institution = {Computer Science Department, University of Colorado-Boulder}, 11900 number = {CU-CS 843-97}, 11901 note = {(accepted by SIAM J. of Scientific Computing)} 11902} 11903 11904@Article{ cai2003restricted, 11905 title = {Restricted additive {S}chwarz preconditioners with harmonic overlap for symmetric 11906 positive definite linear systems}, 11907 author = {Cai, X.C. and Dryja, M. and Sarkis, M.}, 11908 journal = {SIAM Journal on Numerical Analysis}, 11909 volume = {41}, 11910 issue = {1}, 11911 pages = {1209--1231}, 11912 year = {2003}, 11913 doi = {10.1137/S0036142901389621} 11914} 11915 11916@TechReport{ caisaad, 11917 author = {Xiao-Chuan Cai and Youcef Saad}, 11918 title = {Overlapping domain decomposition algorithms for general sparse matrices}, 11919 institution = {Army High Performance Computing Research Center, University of Minnesota }, 11920 year = {1993}, 11921 number = {Preprint 93-027 }, 11922 note = {SIAM J. Sci. Comp. (submitted)} 11923} 11924 11925@Book{ ruminations, 11926 author = {Andrew Koenig and Barbara Moo}, 11927 title = {Ruminations on C++}, 11928 year = {1996}, 11929 publisher = {Addison-Wesley} 11930} 11931 11932@Book{ mpi-complete, 11933 author = {Marc Snir and Steve Otto and Steven Huss-Lederman and David Walker and Jack 11934 Dongarra}, 11935 title = {{MPI}: The Complete Reference}, 11936 year = {1995}, 11937 publisher = {MIT Press} 11938} 11939 11940@Unpublished{ tcl-tk-web-page, 11941 title = {{Tcl/Tk} {W}orld {W}ide {W}eb page}, 11942 note = {http://www.sunlabs.com/research/tcl/}, 11943 year = {1996}, 11944 month = aug 11945} 11946 11947@Misc{ mpich-web-page, 11948 author = {William Gropp and {et. al.}}, 11949 title = {{MPICH} {W}eb page}, 11950 key = {MPICH}, 11951 url = {http://www.mpich.org}, 11952 howpublished = {\url{http://www.mpich.org}} 11953} 11954 11955@Article{ mpi-final, 11956 author = {MPI Forum}, 11957 title = {{MPI}: A Message-Passing Interface Standard}, 11958 journal = {International J. Supercomputing Applications}, 11959 volume = {8}, 11960 number = {3/4}, 11961 year = {1994}, 11962 key = {MPI Standard - final} 11963} 11964 11965@Unpublished{ npb-web-page, 11966 key = {NAS Parallel Benchmarks}, 11967 title = {{NAS} {P}arallel {B}enchmarks {W}eb page}, 11968 note = {http://www.nas.nasa.\-gov/\-NAS/\-NPB/\-index.html}, 11969 year = {1996}, 11970 month = dec 11971} 11972 11973@Book{ george81, 11974 title = {Computer Solution of Large Sparse Positive Definite Systems}, 11975 author = {Alan George and Joseph W. Liu}, 11976 publisher = {Prentice-Hall}, 11977 year = {1981}, 11978 key = {SparseDirect} 11979} 11980 11981@Book{ p4-book, 11982 title = {Portable Programs for Parallel Processors}, 11983 publisher = {Holt, Rinehart, {and} Winston}, 11984 year = {1987}, 11985 author = {James Boyle and Ralph Butler and Terrence Disz and Barnett Glickfeld and Ewing 11986 Lusk and Ross Overbeek and James Patterson and Rick Stevens}, 11987 key = {P4Book} 11988} 11989 11990@Article{ stones, 11991 author = {H. L. Stone}, 11992 title = {Iterative solution of implicit approximations of multidimensional partial 11993 differential equations}, 11994 journal = {SIAM J. Numerical Analysis}, 11995 pages = {87--113}, 11996 volumne = {5}, 11997 year = {1968} 11998} 11999 12000@Article{ parallelstones, 12001 author = {J. S. Reeve and A. D. Scurr and J. H. Merlin}, 12002 title = {Parallel versions of {S}tones strongly implicit algorithm}, 12003 journal = {Concurrency and Computation: Practice and Experience}, 12004 pages = {1049--1062}, 12005 volumne = {13}, 12006 year = {2001} 12007} 12008 12009@Article{ p4-paper, 12010 author = {Ralph Butler and Ewing Lusk}, 12011 title = {Monitors, Messages, and Clusters: {T}he p4 Parallel Programming System}, 12012 journal = {Journal of Parallel Computing}, 12013 note = {To appear (Also Argonne National Laboratory Mathematics and Computer Science 12014 Division preprint P362-0493)}, 12015 year = {1993} 12016} 12017 12018@TechReport{ picl, 12019 author = {G.~A.~Geist and Michael~T.~Heath and B.~W.~Peyton and Patrick~H.~Worley}, 12020 title = {{PICL}: A portable instrumented communications library}, 12021 institution = {Oak Ridge National Laboratory}, 12022 number = {TM-11130}, 12023 year = {1990}, 12024 key = {PICL} 12025} 12026 12027@TechReport{ upshot, 12028 author = {Virginia Herrarte and Ewing Lusk}, 12029 title = {Studying Parallel Program Behavior with {U}pshot}, 12030 institution = {Argonne National Laboratory}, 12031 number = {ANL-91/15}, 12032 month = aug, 12033 year = {1991}, 12034 key = {Upshot} 12035} 12036 12037@TechReport{ p4-manual, 12038 author = {Ralph Butler and Ewing Lusk}, 12039 title = {User's Guide to the p4 Parallel Programming System}, 12040 institution = {Argonne National Laboratory}, 12041 number = {ANL-92/17}, 12042 month = oct, 12043 year = {1992}, 12044 key = {p4-Manual} 12045} 12046 12047@InProceedings{ oldparti, 12048 author = {Gagan Agrawal and Alan Sussman and Joel Saltz}, 12049 title = {Compiler and Runtime Support for Unstructured and Block Structured Problems}, 12050 booktitle = {Proceedings of Supercomputing '93}, 12051 pages = {578--587}, 12052 year = {1993} 12053} 12054 12055@Article{ parti2, 12056 author = {S. S. Mukherjee and S. D. Sharma and M. DF. Hill and J. R. Larus and A. Rogers 12057 and J. Saltz}, 12058 title = {Efficient Support for Irregular Applications on Distributed Memory Machines}, 12059 journal = {ACM SIGPLAN Notices}, 12060 year = {1995}, 12061 pages = {68-79}, 12062 volume = {30}, 12063 number = {8} 12064} 12065 12066@Article{ parti3, 12067 author = {J. Saltz and R. Mirchandaney and K. Crowley}, 12068 title = {Run-Time Parallelization and Scheduling of Loops}, 12069 journal = {IEEE Trans. Computers}, 12070 year = {1991}, 12071 pages = {604-612}, 12072 volume = {40}, 12073 number = {5} 12074} 12075 12076@InProceedings{ disz-lusk:wamtrace, 12077 author = {Terrence Disz and Ewing Lusk}, 12078 title = {A Graphical Tool for Observing the Behavior of Parallel Logic Programs}, 12079 booktitle = {Proceedings of the 1987 Symposium on Logic Programming}, 12080 year = {1987}, 12081 pages = {46--53} 12082} 12083 12084@InProceedings{ gorlick-kesselman:gauge, 12085 author = {Michael Gorlick and Carl Kesselman}, 12086 title = {Timing {Prolog} programs without Clocks}, 12087 booktitle = {Proceedings of the 1987 Symposium on Logic Programming}, 12088 year = {1996}, 12089 publisher = {Birkhauser} 12090} 12091 12092@TechReport{ aztec, 12093 author = {Scott A. Hutchinson and John N. Shadid and Ray S. Tuminaro}, 12094 title = {Aztec User's Guide Version 1.1}, 12095 institution = {Sandia National Laboratories}, 12096 month = oct, 12097 year = {1995}, 12098 number = {SAND95/1559} 12099} 12100 12101@TechReport{ aztec2, 12102 author = {Ray S. Tuminaro and Micheal Heroux and Scott A. Hutchinson and John N. Shadid}, 12103 title = {Official {Aztec} User's Guide Version 2.1}, 12104 institution = {Sandia National Laboratories}, 12105 year = {1999} 12106} 12107 12108@Book{ taylor-chandy:pcn, 12109 author = {Chandy, M. and Taylor, S.}, 12110 title = {An Introduction to Parallel Programming}, 12111 year = {1991}, 12112 publisher = {Jones and Bartlett} 12113} 12114 12115@Book{ foster-taylor:strand, 12116 title = {Strand: New Concepts in Parallel Programming}, 12117 author = {Ian Foster and Stephen Taylor}, 12118 publisher = {Prentice-Hall}, 12119 adress = { Englewood Cliffs, New Jersey}, 12120 year = {1990} 12121} 12122 12123@Article{ aurora, 12124 author = {E. Lusk and R. Butler and T. Disz and R. Olson and R. Overbeek and R. Stevens and 12125 D.H.D. Warren and A. Calderwood and P. Szeredi and S. Haridi and P. Brand and M. 12126 Carlsson and A. Ciepielewski and B. Hausman}, 12127 title = {The Aurora OR-Parallel Prolog System}, 12128 journal = {New Generation Computing}, 12129 volume = {7}, 12130 number = {3}, 12131 year = {1990}, 12132 pages = {243--271} 12133} 12134 12135@TechReport{ roo, 12136 author = {E. Lusk and W. McCune and J. Slaney}, 12137 title = {Roo---a Parallel Theorem Prover}, 12138 institution = {Argonne National Laboratory}, 12139 number = {MCS--TM--149}, 12140 year = {1991} 12141} 12142 12143@TechReport{ heath-etheridge:vppp, 12144 author = {M. T. Heath and J. A. Etheridge}, 12145 title = {Visualizing the Performance of Parallel Programs}, 12146 institution = {Oak Ridge National Laboratory}, 12147 number = {ORNL TM-11813}, 12148 year = {1991} 12149} 12150 12151@TechReport{ chem:vis, 12152 author = {Ewing L. Lusk}, 12153 title = {Performance Visualization for Parallel Programs}, 12154 institution = {Argonne National Laboratory}, 12155 number = {ANL/MCS--P287--0192}, 12156 year = {1991}, 12157 note = {(to appear in {\em Theoretica Chimica Acta})} 12158} 12159 12160@TechReport{ picltrace, 12161 author = {P.~H.~Worley}, 12162 title = {A new {PICL} trace file format}, 12163 institution = {Oak Ridge National Laboratory}, 12164 number = {ORNL TM-12125}, 12165 month = jun, 12166 year = {1992} 12167} 12168 12169@InProceedings{ hideo, 12170 author = {Gary Olsen and Carl Woese and Ray Hagstrom and Hideo Matsuda and Ross Overbeek}, 12171 title = {Inference of Phylogenetic trees using maximum likelihood}, 12172 booktitle = {Proceedings of the First Intel Delta Applications Workshop}, 12173 year = {1992}, 12174 pages = {247--262} 12175} 12176 12177@InProceedings{ dw90, 12178 author = {M. Dryja and O. Widlund}, 12179 title = {Towards a Unified Theory of Domain Decomposition Algorithms for Elliptic 12180 Problems}, 12181 booktitle = {Third International Symposium on Domain Decomposition Methods}, 12182 editor = {T. F. Chan and R. Glowinski and J. P\'eriaux and O. B. Widlund}, 12183 year = {1990}, 12184 pages = {3-21}, 12185 publisher = {SIAM}, 12186 address = {Philadelphia}, 12187 annote = {Additive {S}chwarz. Surveys recent (1989) results; some comments on 3-d and how 12188 many approaches may be cast in the form of additive {S}chwarz-subspace form. 58 12189 references, good introduction to the theory. No computations}, 12190 key = {DryjaWidlund90 !AS} 12191} 12192 12193@Unpublished{ rosing, 12194 author = {Matt Rosing and Joel Saltz}, 12195 title = {Low Latency Messages on Distributed Memory Multiprocessors}, 12196 key = {LowLatency}, 12197 note = {manuscript, 1992} 12198} 12199 12200@TechReport{ jp:incomplete, 12201 author = {Mark T. Jones and Paul E. Plassmann}, 12202 title = {An Improved Incomplete {C}holesky Factorization}, 12203 institution = {Argonne National Laboratory}, 12204 address = {Argonne, IL}, 12205 type = {Preprint}, 12206 note = {(to appear in {\em ACM Trans. on Mathematical Software, 1995})}, 12207 number = {MCS-P206-0191}, 12208 year = {1991}, 12209 key = {jones} 12210} 12211 12212@InCollection{ jp:ima, 12213 author = {Mark Jones and Paul Plassmann}, 12214 title = {The Efficient Parallel Iterative Solution of Large Sparse Linear Systems}, 12215 booktitle = {Graph Theory and Sparse Matrix Computation}, 12216 publisher = {Springer-Verlag}, 12217 series = {The IMA Volumes in Mathematics and Its Applications}, 12218 editor = {Alan George and John Gilbert and Joseph W.H.~Liu}, 12219 volume = {56}, 12220 year = {1993}, 12221 pages = {229--245} 12222} 12223 12224@Article{ pw98, 12225 author = {M. Pernice and H. F. Walker}, 12226 title = {{NITSOL}: A {Newton} Iterative Solver for Nonlinear Systems}, 12227 journal = {SIAM J. Sci. Stat. Comput.}, 12228 year = {1998}, 12229 volume = {19}, 12230 pages = {302--318} 12231} 12232 12233@TechReport{ ysmp83, 12234 key = {Eisenstat}, 12235 author = {S.~C.~Eisenstat and H.~C.~Elman and M.~H.~Schultz and A.~H.~Sherman}, 12236 title = {The (New) {Y}ale {S}parse {M}atrix {P}ackage}, 12237 institution = {Department of Computer Science, Yale University}, 12238 number = {YALE/DCS/RR-265}, 12239 month = apr, 12240 year = {1983} 12241} 12242 12243@InBook{ ysmp84, 12244 author = {S.~C.~Eisenstat and H.~C.~Elman and M.~H.~Schultz and A.~H.~Sherman}, 12245 chaptertitle = {The (New) {Y}ale {S}parse {M}atrix {P}ackage}, 12246 title = {Elliptic Problem Solvers II}, 12247 publisher = {Academic Press}, 12248 pages = {45--52}, 12249 editors = {G. Birkhoff and A. Schoenstadt}, 12250 year = {1984} 12251} 12252 12253@TechReport{ sparsekit, 12254 key = {Saad}, 12255 author = {Youcef Saad}, 12256 title = {{SPARSKIT}, a basic tool kit for sparse matrix computations}, 12257 institution = {Center for Supercomputing Research and Development, University of Illinois at 12258 Urbana-Champaign}, 12259 number = {1029}, 12260 year = {1990} 12261} 12262 12263@TechReport{ pde-user-ref, 12264 author = {Barry F. Smith}, 12265 title = {Extensible {PDE} Solvers Package Users Manual}, 12266 institution = {Argonne National Laboratory}, 12267 month = sep, 12268 year = {1994}, 12269 number = {ANL-93/40}, 12270 key = {Smith94 ! PDE} 12271} 12272 12273@TechReport{ bs-user-ref, 12274 author = {Mark T. Jones and Paul E. Plassmann}, 12275 title = {{BlockSolve95} Users Manual: Scalable Library Software for the Parallel Solution 12276 of Sparse Linear Systems}, 12277 institution = {Argonne National Laboratory}, 12278 month = dec, 12279 year = {1995}, 12280 number = {ANL-95/48} 12281} 12282 12283@TechReport{ snes-user-ref, 12284 author = {William D. Gropp and Lois Curfman McInnes and Barry F. Smith}, 12285 title = {Using the {S}calable {N}onlinear {E}quations {S}olvers Package}, 12286 institution = {Argonne National Laboratory}, 12287 month = feb, 12288 year = {1995}, 12289 number = {ANL/MCS-TM-193}, 12290 key = {GroppMcInnesSmith95 ! SNES} 12291} 12292 12293@TechReport{ sles-user-ref, 12294 author = {William D. Gropp and Barry F. Smith}, 12295 title = {{S}implified {L}inear {E}quation {S}olvers Users Manual}, 12296 institution = {Argonne National Laboratory}, 12297 month = mar, 12298 year = {1993}, 12299 number = {ANL-93/8}, 12300 key = {GroppSmith93 ! SLES} 12301} 12302 12303@TechReport{ chameleon-user-ref, 12304 author = {William D. Gropp and Barry F. Smith}, 12305 title = {Chameleon Parallel programming tools Users Manual}, 12306 institution = {Argonne National Laboratory}, 12307 month = mar, 12308 year = {1993}, 12309 number = {ANL-93/23}, 12310 key = {GroppSmith93 ! Chameleon} 12311} 12312 12313@Article{ euclid2, 12314 author = {D. Hysom and A. Pothen}, 12315 title = {A Scalable Parallel Algorithm For Incomplete Factor Preconditioning}, 12316 journal = {SIAM J. Sci. Comput.}, 12317 volume = {22}, 12318 number = {6}, 12319 pages = {2194--2215} 12320} 12321 12322@TechReport{ euclid1, 12323 author = {D. Hysom and A. Pothen}, 12324 title = {Euclid User Manual (A Scalable {ILU} Preconditioning Library for the Parallel 12325 Solution of Sparse Linear Systems)}, 12326 institution = {Old Dominion University}, 12327 year = {2001} 12328} 12329 12330@TechReport{ ksp-user-ref, 12331 author = {William D. Gropp and Barry F. Smith}, 12332 title = {Users Manual for {KSP}: Data-Structure-Neutral Codes Implementing {K}rylov Space 12333 Methods}, 12334 institution = {Argonne National Laboratory}, 12335 month = aug, 12336 year = {1993}, 12337 number = {ANL-93/30}, 12338 key = {GroppSmith93 ! KSP} 12339} 12340 12341@TechReport{ mpi-chameleon, 12342 author = {William D. Gropp and Ewing Lusk}, 12343 title = {A Test Implementation of the {MPI} Draft Message-Passing Standard}, 12344 institution = {Argonne National Laboratory}, 12345 month = dec, 12346 year = {1992}, 12347 number = {ANL-92/47}, 12348 key = {GroppLusk92 ! MPI} 12349} 12350 12351@TechReport{ blockcomm-fortran, 12352 author = {William D. Gropp}, 12353 title = {Block{C}omm for {F}ortran}, 12354 institution = {Argonne National Laboratory}, 12355 month = may, 12356 year = {1993}, 12357 number = {ANL-93/00 (to appear)}, 12358 key = {Gropp93 ! BlockComm} 12359} 12360 12361@TechReport{ autodocument, 12362 author = {William D. Gropp}, 12363 title = {Automatic documentation of {C} programs}, 12364 institution = {Argonne National Laboratory}, 12365 month = may, 12366 year = {1993}, 12367 number = {ANL-93/00}, 12368 key = {Gropp93 ! Autodoc} 12369} 12370 12371@TechReport{ zipcode, 12372 author = {Anthony Skjellum and Steven G. Smith and Charles H Still and Alvin P. Leung and 12373 Manfred Morari}, 12374 title = {The {Z}ipcode message-passing system}, 12375 institution = {Lawrence Livermore National Laboratory}, 12376 month = sep, 12377 year = {1992}, 12378 number = {Unpublished}, 12379 key = {Skjellum92 ! Zipcode} 12380} 12381 12382@Article{ paragraph, 12383 author = {Michael T. Heath and Jennifer Etheridge Finger}, 12384 title = {Visualizing performance of parallel programs}, 12385 journal = {IEEE Software}, 12386 volume = {8}, 12387 number = {5}, 12388 month = sep, 12389 year = {1991}, 12390 pages = {29--39}, 12391 key = {Heath91 ! Paragraph} 12392} 12393 12394@Article{ gropp90, 12395 author = {William Gropp and Edward Smith}, 12396 title = {Computational Fluid Dynamics on Parallel Processors}, 12397 journal = {Computers and Fluids}, 12398 volume = {18}, 12399 year = {1990}, 12400 pages = {289--304}, 12401 key = {Gropp90 ! performance} 12402} 12403 12404@Article{ foster92, 12405 author = {Ian Foster and William Gropp and Rick Stevens}, 12406 title = {The parallel scalability of the spectral transform method}, 12407 journal = {Monthly Weather Review}, 12408 volume = {120}, 12409 year = {1992}, 12410 pages = {835--850}, 12411 key = {Foster92 ! performance} 12412} 12413 12414@InBook{ fgn, 12415 author = {R. Freund and G. H. Golub and N. Nachtigal}, 12416 title = {Iterative Solution of Linear Systems}, 12417 series = {Acta Numerica}, 12418 year = {1992}, 12419 publisher = {Cambridge University Press}, 12420 pages = {57--100} 12421} 12422 12423@TechReport{ nachtigal90, 12424 author = {No{\"e}l M. Nachtigal and Satish C. Reddy and Lloyd N. Trefethen}, 12425 title = {How Fast are Nonsymmetric Matrix Iterations?}, 12426 institution = {Massachusetts Institute of Technology}, 12427 month = mar, 12428 year = {1990}, 12429 number = {90-2}, 12430 key = {Nachtigal | Krylov} 12431} 12432 12433@Article{ nachtigal1992fnm, 12434 title = {How Fast are Nonsymmetric Matrix Iterations?}, 12435 author = {Nachtigal, N.M. and Reddy, S.C. and Trefethen, L.N.}, 12436 journal = {SIAM Journal on Matrix Analysis and Applications}, 12437 volume = {13}, 12438 pages = {778}, 12439 year = {1992}, 12440 publisher = {SIAM} 12441} 12442 12443@TechReport{ embree1999descriptive, 12444 title = {How descriptive are {GMRES} convergence bounds}, 12445 author = {Embree, M.}, 12446 year = {1999}, 12447 number = {08}, 12448 institution = {Oxford University Computing Laboratory} 12449} 12450 12451@Article{ vorst92, 12452 author = {H. van der Vorst}, 12453 title = {Bi-{CGSTAB}: A fast and smoothly converging variant of {Bi-CG} for the solution 12454 of nonsymmetric linear systems}, 12455 journal = {SIAM J. Sci. Stat. Comput.}, 12456 year = {1992}, 12457 volume = {13}, 12458 pages = {631--644} 12459} 12460 12461@Article{ eisenstat81, 12462 author = {S. Eisenstat}, 12463 title = {Efficient Implementation of a Class of {CG} Methods}, 12464 journal = {SIAM J. Sci. Stat. Comput.}, 12465 year = {1981}, 12466 volume = {2}, 12467 pages = {1--4} 12468} 12469 12470@Manual{ ibm-essl, 12471 title = {{E}ngineering and {S}cientific {S}ubroutine {L}ibrary Version 2: Guide and 12472 Reference}, 12473 organization = {IBM}, 12474 year = {1992}, 12475 key = {IBM-ESSL} 12476} 12477 12478@Manual{ ibm-eui, 12479 title = {{IBM} {AIX} Parallel Environment Parallel Programming Subroutine Reference 12480 Release 2.0}, 12481 organization = {IBM}, 12482 month = jun, 12483 year = {1994}, 12484 key = {IBM-EUI} 12485} 12486 12487@Manual{ ibm-euih, 12488 title = {Using {EUIH}: An Experimental {EUI} Implementation}, 12489 organization = {IBM}, 12490 author = {Peter Hochschild}, 12491 year = {1993}, 12492 key = {IBM-EUIH} 12493} 12494 12495@TechReport{ mpi, 12496 title = {Document for a Standard Message-Passing Interface}, 12497 author = {Message Passing Interface Forum}, 12498 institution = {University of Tennessee}, 12499 number = {CS-93-214}, 12500 month = nov, 12501 year = {1993}, 12502 key = {MPI Standard} 12503} 12504 12505@Unpublished{ mpi-final-web, 12506 author = {Message Passing Interface Forum}, 12507 title = {{MPI}: A Message-Passing Interface Standard}, 12508 note = {http://www.mcs.anl.gov/mpi/mpi-report/mpi-report.html}, 12509 year = {1994}, 12510 month = may 12511} 12512 12513@Book{ hockney-jesshope, 12514 author = {R. W. Hockney and C. R. Jesshope}, 12515 title = {Parallel Computers 2}, 12516 publisher = {Adam Hilger}, 12517 year = {1988} 12518} 12519 12520@Book{ cm-fortran, 12521 author = {{Thinking Machines Corporation}}, 12522 title = {Users Manual for CM-Fortran}, 12523 publisher = {Thinking Machines Corporation}, 12524 year = {1993} 12525} 12526 12527@TechReport{ chang93, 12528 title = {Experiments and Bounds on Block Diagonal Preconditioning}, 12529 author = {Mark Yan-Ming Chang and Martin H. Schultz}, 12530 institution = {Yale Department of Computer Science}, 12531 number = {YALEU/DCS/RR-994}, 12532 month = nov, 12533 year = {1993}, 12534 key = {BDD|diag} 12535} 12536 12537@InProceedings{ gropplevine93, 12538 author = {N. Galbreath and W. Gropp and D. Levine}, 12539 title = {Applications-Driven Parallel {I/O}}, 12540 booktitle = {Proceedings of Supercomputing '93}, 12541 year = {1993}, 12542 pages = {462--471} 12543} 12544 12545@Book{ siegle85, 12546 author = {H. J. Siegel}, 12547 title = {Interconnection Networks for Large Scale Parallel Processing}, 12548 publisher = {Lexington Books}, 12549 year = {1985}, 12550 key = {Network Comparison} 12551} 12552 12553@Article{ lawrie75, 12554 author = {D. H. Lawrie}, 12555 title = {Access and alignment of data in an array processor}, 12556 journal = {IEEE Transactions on Computers}, 12557 volume = {C-24}, 12558 number = {12}, 12559 month = dec, 12560 year = {1975}, 12561 pages = {1145--1155}, 12562 key = {Omega Network} 12563} 12564 12565@Book{ knuth1986, 12566 title = {The {\TeX}{Book}}, 12567 author = {Donald Ervin Knuth and Duane Bibby}, 12568 volume = {1993}, 12569 year = {1986}, 12570 publisher = {Addison-Wesley Reading, Massachusetts} 12571} 12572 12573@Book{ lamport86, 12574 author = {Leslie Lamport}, 12575 title = {{LaTeX}: A document preparation system}, 12576 publisher = {Addison-Wesley}, 12577 year = {1986}, 12578 key = {Latex Manual} 12579} 12580 12581@InProceedings{ gropp-lusk:unix-tools, 12582 author = {William Gropp and Ewing Lusk}, 12583 title = {Scalable {U}nix Tools on Parallel Processors}, 12584 booktitle = {Proceedings of the 1994 Scalable High Performanc Computing Conference}, 12585 publisher = {IEEE}, 12586 pages = {56--62} 12587} 12588 12589@InProceedings{ jp:bell_prize, 12590 author = {Mark Jones and Paul Plassmann}, 12591 title = {Solution of Large, Sparse Systems of Linear Equations in Massively Parallel 12592 Applications}, 12593 booktitle = {Proceedings of Supercomputing '92}, 12594 publisher = {IEEE Computer Society Press}, 12595 year = {1992}, 12596 pages = {551--560} 12597} 12598 12599@COMMENT{WEB, CWEB references (for doctext)} 12600@TechReport{ web, 12601 author = {Donald E. Knuth}, 12602 title = {The {\tt WEB} system of structured documentation}, 12603 institution = {Computer Science Department, Stanford University}, 12604 year = {1983}, 12605 number = {980}, 12606 month = sep 12607} 12608 12609@Article{ literatepgm, 12610 author = {Donald E. Knuth}, 12611 title = {Literate Programming}, 12612 journal = {Computer Journal}, 12613 year = {1984}, 12614 volume = {27}, 12615 number = {2}, 12616 pages = {91--111} 12617} 12618 12619@Unpublished{ cweb-code, 12620 author = {Silvio Levy and Donald E. Knuth}, 12621 title = {CWEB}, 12622 note = {CWEB is available at ftp://pip.shsu.edu/tex-archive/web/c\_cpp/cweb} 12623} 12624 12625@Article{ jp:scalable, 12626 author = {Mark Jones and Paul Plassmann}, 12627 title = {Scalable Iterative Solution of Sparse Linear Systems}, 12628 journal = {Parallel Computing}, 12629 volume = {20}, 12630 number = {5}, 12631 month = may, 12632 year = {1994}, 12633 pages = {753--773} 12634} 12635 12636@Article{ jp:pcolor, 12637 author = {Mark T. Jones and Paul E. Plassmann}, 12638 title = {A Parallel Graph Coloring Heuristic}, 12639 journal = {SIAM J. Sci. Comput.}, 12640 volume = {14}, 12641 number = {3}, 12642 pages = {654-669}, 12643 year = {1993} 12644} 12645 12646@TechReport{ block_solve, 12647 author = {Mark T. Jones and Paul E. Plassmann}, 12648 title = {{B}lock{S}olve v1.1: Scalable Library Software for the Parallel Solution of 12649 Sparse Linear Systems}, 12650 institution = {Argonne National Laboratory}, 12651 year = {1992}, 12652 number = {ANL-92/46}, 12653 key = {JonesPlassmann92 ! block_solve} 12654} 12655 12656@InProceedings{ supercond, 12657 author = {Lois Curfman Mc{I}nnes and Mario Palumbo}, 12658 title = {Parallel Solution of the Anisotropic {G}inzburg-{L}andau Model}, 12659 booktitle = {Proceedings of the Toward Teraflop Computing and New Grand Challenge Applications 12660 Conference}, 12661 month = feb, 12662 year = {1994}, 12663 key = {McInnesPalumbo94 ! superconductivity } 12664} 12665 12666@Unpublished{ preosti:93, 12667 author = {Gianfranco Preosti}, 12668 title = { }, 12669 note = {Unpublished information, {P}hysics {D}epartment, {P}urdue {U}niversity}, 12670 year = {1993}, 12671 key = {preosti93 ! GL-tilt3d} 12672} 12673 12674@Unpublished{ more:93, 12675 author = {Jorge J. Mor\'{e}}, 12676 title = { }, 12677 note = {Unpublished information, {M}athematics and {C}omputer {S}cience {D}ivision, 12678 {A}rgonne {N}ational {L}aboratory}, 12679 year = {1993}, 12680 key = {more93 ! MINPACK-2} 12681} 12682 12683@Article{ brownsaad:90, 12684 author = {Peter N. Brown and Youcef Saad}, 12685 title = {Hybrid {K}rylov Methods for Nonlinear Systems of Equations}, 12686 journal = {SIAM J. Sci. Stat. Comput.}, 12687 year = {1990}, 12688 volume = {11}, 12689 pages = {450-481} 12690} 12691 12692@Book{ using-mpi, 12693 author = {William Gropp and Ewing Lusk and Anthony Skjellum}, 12694 title = {Using MPI: Portable Parallel Programming with the Message Passing Interface}, 12695 publisher = {MIT Press}, 12696 year = {1994} 12697} 12698 12699@Book{ using-mpi2, 12700 author = {William Gropp and Ewing Lusk and Rajeev Thakur}, 12701 title = {Using MPI 2: Advanced Features of the Message Passing Interface}, 12702 publisher = {MIT Press}, 12703 year = {1999} 12704} 12705 12706@Article{ hs:52, 12707 author = {Magnus R. Hestenes and Eduard Steifel}, 12708 title = {Methods of Conjugate Gradients for Solving Linear Systems}, 12709 journal = {J. Research of the National Bureau of Standards}, 12710 year = {1952}, 12711 volume = {49}, 12712 pages = {409-436} 12713} 12714 12715@Article{ ss:86, 12716 author = {Youcef Saad and Martin H. Schultz}, 12717 title = {{GMRES}: A Generalized Minimal Residual Algorithm for Solving Nonsymmetric Linear 12718 Systems}, 12719 journal = {SIAM J. Sci. Stat. Comput.}, 12720 year = {1986}, 12721 volume = {7}, 12722 pages = {856-869} 12723} 12724 12725@Article{ so:89, 12726 author = {Peter Sonneveld}, 12727 title = {{CGS}, A Fast {L}anczos-type Solver for Nonsymmetric Linear Systems}, 12728 journal = {SIAM J. Sci. Stat. Comput.}, 12729 year = {1989}, 12730 volume = {10}, 12731 pages = {36-52} 12732} 12733 12734@Article{ v:92, 12735 author = {{H. A.} {van der Vorst}}, 12736 title = {{B}i{CGSTAB}: A fast and smoothly converging variant of {B}i{CG} for the solution 12737 of nonsymmetric linear systems}, 12738 journal = {SIAM J. Sci. Stat. Comput.}, 12739 volume = {13}, 12740 year = {1992}, 12741 pages = {631-644} 12742} 12743 12744@Article{ f:93, 12745 author = {Roland W. Freund}, 12746 title = {A Transpose-Free Quasi-Minimal Residual Algorithm for Non-{H}ermitian Linear 12747 Systems}, 12748 journal = {SIAM J. Sci. Stat. Comput.}, 12749 volume = {14}, 12750 year = {1993}, 12751 pages = {470-482} 12752} 12753 12754@Article{ ish:89, 12755 author = {S. Ishizuka}, 12756 title = {An Experimental Study on Extinction and Stablity of Tubular Flames}, 12757 journal = {Combustion and Flame}, 12758 volume = {75}, 12759 year = {1989}, 12760 pages = {367-379} 12761} 12762 12763@Book{ williams89, 12764 title = {Combustion Theory, The Fundamental Theory of Chemically Reacting Flow Systems}, 12765 author = {F.A. Williams}, 12766 publisher = {Addison-Wesley}, 12767 year = {1989}, 12768 pages = {367-379} 12769} 12770 12771@Book{ ra75, 12772 author = {R. Aris}, 12773 title = {The Mathematical Theory of Diffusion and Reaction in Permeable Catalysts}, 12774 publisher = {Oxford}, 12775 year = {1975} 12776} 12777 12778@Book{ bebernes89, 12779 author = {J. Bebernes and D. Eberly}, 12780 title = {Mathematical Problems from Combustion Theory}, 12781 publisher = {Springer-Verlag}, 12782 series = {Applied Mathematical Sciences 83}, 12783 year = {1989} 12784} 12785 12786@InProceedings{ kikuchi89, 12787 author = {F. Kikuchi}, 12788 booktitle = { Computing Methods in Applied Sciences and Engineering}, 12789 editor = {R. Glowinski and J. L. Lions}, 12790 publisher = {Springer-Verlag}, 12791 series = {Lecture Notes in Mathematics}, 12792 title = {Finite element approximations to bifurcation problems of turning point type}, 12793 year = {1977} 12794} 12795 12796@Article{ rg85, 12797 author = {R. Glowinski and H.B. Keller and L. Reinhart}, 12798 title = {Continuation-conjugate Gradient Methods fo the Least Squares Solution of 12799 Nonlinear Boundary Problems}, 12800 journal = {SIAM J. Sci. Stat. Comput.}, 12801 volume = {6}, 12802 year = {1985}, 12803 pages = {793-832} 12804} 12805 12806@InProceedings{ whitfield91, 12807 author = {D. Whitfield and L. Taylor}, 12808 title = {Discretized {N}ewton-Relaxation Solution of High Resolution Flux-Difference Split 12809 Schemes}, 12810 booktitle = {Proceedings of the AIAA Tenth Computational Fluid Dynamics Conference}, 12811 misc = {AIAA-91-1539}, 12812 pages = {134-145}, 12813 year = {1991} 12814} 12815 12816@InProceedings{ quinlan1, 12817 author = {M. Lemke and D. Quinlan}, 12818 title = {P++, a {C}++ Virtual Shared Grids Based Programming Environment for 12819 Architecture-Independent Development of Structured Grid Applications}, 12820 booktitle = {CONPAR/VAPP V, Lecture Notes in Computer Science}, 12821 publisher = {Springer Verlag}, 12822 year = {1992} 12823} 12824 12825@InProceedings{ quinlan2, 12826 author = {R. Parsons and D. Quinlan}, 12827 title = {A++/{P}++ Array Classes for Architecture Independent Finite Difference 12828 Computations}, 12829 booktitle = {Proceedings of the Second Annual Object-Oriented Numerics Conference}, 12830 year = {1994} 12831} 12832 12833% ***** Overview of functionality in Diffpack 12834@InBook{ dpoverview, 12835 author = {Bruaset, A. M. and Langtangen, H. P.}, 12836 booktitle = {Mathematical Models and Software Tools in Industrial Mathematics}, 12837 title = {A Comprehensive Set of Tools for Solving Partial Differential Equations; 12838 {Diffpack}}, 12839 publisher = {Birkh{\"{a}}user}, 12840 pages = {61--90}, 12841 year = {1997} 12842} 12843 12844% ***** Short overview of Diffpack 12845@InCollection{ dpoverview2, 12846 author = {Bruaset, A. M. and Langtangen, H. P.}, 12847 editor = {A. Sydow}, 12848 booktitle = {Proceedings of the 15th IMACS World Congress on Scientific Computation, Modelling 12849 and Applied Mathematics}, 12850 title = {Diffpack: A Software Environment for Rapid Prototyping of {PDE} Solvers}, 12851 pages = {553--558}, 12852 volume = {4}, 12853 year = {1997} 12854} 12855 12856% ***** Comprehensive documentation of Diffpack and 12857% associated numerical methods: 12858@Book{ dpbook, 12859 author = {H. P. Langtangen}, 12860 title = {Numerical Solution of Partial Differential Equations; Models, Algorithms and 12861 Software. Part I}, 12862 series = {Lecture Notes in Computational Science and Engineering}, 12863 publisher = {Springer-Verlag}, 12864 year = {1998} 12865} 12866 12867% ***** Design issues of the linear solvers in Diffpack, serves also as a 12868% collection of examples on O-O in numerical computing 12869@Article{ ambhpl97a, 12870 author = {A. M. Bruaset and H. P. Langtangen }, 12871 title = {Object-Oriented Design of Preconditioned Iterative Methods in {Diffpack}}, 12872 journal = {Transactions on Mathematical Software}, 12873 volume = {23 }, 12874 pages = {50--80}, 12875 year = {1997} 12876} 12877 12878@Misc{ dpurl, 12879 author = {{Diffpack Web page}}, 12880 howpublished = {\url{http://www.diffpack.com}} 12881} 12882 12883% ***** General intro to object-oriented numerics for "FORTRAN programmers" 12884@InCollection{ oonintro, 12885 author = {Arge, E. and Bruaset, A. M. and H. P. Langtangen}, 12886 editor = {D{\ae}hlen, M. and Tveito, A.}, 12887 booktitle = {Mathematical Models and Software Tools in Industrial Mathematics}, 12888 title = {Object-Oriented Numerics}, 12889 publisher = {Birkh{\"{a}}user}, 12890 year = {1997} 12891} 12892 12893% ***** Efficiency comparison: BLAS 1, Diffpack, C, 12894% and finite element applications (F77 vs Diffpack) 12895@InCollection{ dpefficiency, 12896 author = {Arge, E. and Bruaset, A. M. and Calvin, P. B. and Kanney, J. F. and Langtangen, 12897 H. P. and Miller, C. T.}, 12898 editor = {D{\ae}hlen, M. and Tveito, A.}, 12899 booktitle = {Mathematical Models and Software Tools in Industrial Mathematics}, 12900 title = {On the Efficiency of {C++} in Scientific Computing}, 12901 publisher = {Birkh{\"{a}}user}, 12902 pages = {91--118}, 12903 year = {1997} 12904} 12905 12906% ***** Parallel concept in Diffpack: 12907@InCollection{ dpparallel, 12908 author = {A.~M.~Bruaset and X. Cai and H. P. Langtangen and A. Tveito}, 12909 editor = {Y. Ishikawa and R. R. Oldehoeft and J. V. W. Reynders and M. Tholburn}, 12910 booktitle = {Scientific Computing in Object-Oriented Parallel Environments}, 12911 title = {Numerical Solution of {PDE}s on Parallel Computers Utilizing Sequential 12912 Simulators}, 12913 publisher = {Springer--Verlag}, 12914 series = {Lecture Notes in Computer Science}, 12915 pages = {161--168}, 12916 year = {1997} 12917} 12918 12919% ***** DD and ML methods in Diffpack: 12920@InCollection{ dpddml, 12921 author = {A.~M.~Bruaset and H. P. Langtangen and G. W. Zumbusch}, 12922 editor = {P. Bj{\o}rstad and M. Espedal and D. Keyes}, 12923 booktitle = {Proceedings of the 9th Conference on Domain Decomposition}, 12924 title = {Domain decomposition and multilevel methods in Diffpack}, 12925 year = {1997} 12926} 12927 12928@InProceedings{ bsca98, 12929 author = {David L. Bruhwiler and Svetlana G. Shasharina and John R. Cary and David 12930 Alexander}, 12931 title = {Design and Implementation of an Object Oriented C++ Library for Nonlinear 12932 Optimization}, 12933 booktitle = {Proceedings of the SIAM Workshop on Object Oriented Methods for Inter-operable 12934 Scientific and Engineering Computing}, 12935 editor = {Mike Henderson et al.}, 12936 pages = {165-173}, 12937 year = {1998} 12938} 12939 12940@Book{ scalapack-user-guide, 12941 author = {L. S. Blackford and J. Choi and A. Cleary and E. D'Azevedo and J. Demmel and I. 12942 Dhillon and J. Dongarra and S. Hammarling and G. Henry and A. Petitet and K. 12943 Stanley and D. Walker and R. C. Whaley}, 12944 title = {Sca{LAPACK} Users' Guide}, 12945 publisher = {SIAM}, 12946 address = {Philadelphia, PA}, 12947 year = {1997} 12948} 12949 12950@InProceedings{ keyes99, 12951 author = {D. E. Keyes}, 12952 title = {How Scalable is Domain Decomposition in Practice?}, 12953 booktitle = {Proceedings of the 11th International Conference on Domain Decomposition 12954 Methods}, 12955 editor = {C.-H. Lai et al.}, 12956 publisher = {Domain Decomposition Press, Bergen}, 12957 note = {To appear}, 12958 year = {1999} 12959} 12960 12961@Article{ fun3d, 12962 author = {W. K. Anderson and D. L. Bonhaus}, 12963 title = {An implicit upwind algorithm for computing turbulent flows on unstructured 12964 grids}, 12965 journal = {Computers and Fluids}, 12966 year = {1994}, 12967 volume = {23}, 12968 pages = {1--21} 12969} 12970 12971% ------------------------------------------------------------------------- 12972% ------------------------------------------------------------------------- 12973@Article{ torczon, 12974 author = {Dennis, Jr., J. E. and V.~Torczon}, 12975 title = {Direct Search Methods on Parallel Machines}, 12976 journal = {SIAM J. Optimization}, 12977 volume = {1}, 12978 pages = {448--474}, 12979 year = {1991}, 12980 key = {Torczon !PDS} 12981} 12982 12983@InProceedings{ wt91, 12984 author = {D. L. Whitfield and L. K. Taylor}, 12985 title = {Discretized {N}ewton-Relaxation Solution of High Resolution Flux-Difference Split 12986 Schemes}, 12987 booktitle = {Proceedings of the AIAA Tenth Annual Computational Fluid Dynamics Conference}, 12988 misc = {AIAA-91-1539}, 12989 pages = {134-145}, 12990 year = {1991} 12991} 12992 12993@Article{ ew96, 12994 author = {S. C. Eisenstat and H. F. Walker}, 12995 title = {Choosing the forcing terms in an inexact {N}ewton method}, 12996 journal = {SIAM J. Scientific Computing}, 12997 volume = {17}, 12998 year = {1996}, 12999 pages = {16--32} 13000} 13001 13002@Book{ thi93, 13003 author = {{Thinking Machines Corporation}}, 13004 title = {Users Manual for CM-Fortran}, 13005 publisher = {Thinking Machines Corporation}, 13006 year = {1993} 13007} 13008 13009@Book{ mortonmayers94, 13010 author = {K. W. Morton and D. F. Mayers}, 13011 title = {Numerical Solution of Partial Differential Equations}, 13012 publisher = {Press Syndicate of the University of Cambridge}, 13013 year = {1994} 13014} 13015 13016@Book{ heath97, 13017 author = {Michael T. Heath}, 13018 title = {Scientific Computing: An Introductory Survey}, 13019 publisher = {McGraw Hill}, 13020 year = {1997} 13021} 13022 13023@Article{ captools96, 13024 author = {C. S. Ierotheou and S. P Johnson and M. Cross and P. F. Leggett}, 13025 title = {Computer Aided Parallelization Tools ({CAPTools}) - Conceptual Overview and 13026 Performance on the Parallelization of Structured Mesh Codes}, 13027 journal = {Parallel Computing}, 13028 volume = {22}, 13029 pages = {197-226}, 13030 year = {1996} 13031} 13032 13033@Unpublished{ nastran-web-page, 13034 author = {{MSC Software Corporation}}, 13035 title = {{NASTRAN} {W}eb page}, 13036 note = {See {\tt http://www.mechsolutions.com\-/products\-/nastran/}} 13037} 13038 13039@Book{ hpf, 13040 author = {C. H. Koelbel and D. B. Loveman and R. S. Schreiber and G. L. Steele and M. E. 13041 Zosel}, 13042 title = {The High Performance Fotran Handbook}, 13043 publisher = {MIT Press}, 13044 year = {1994} 13045} 13046 13047@InProceedings{ keyes98, 13048 author = {D. E. Keyes}, 13049 title = {Trends in Algorithms for Nonuniform Applications on Hierarchical Distributed 13050 Architectures}, 13051 booktitle = {Proceedings of the Workshop on Computational Aerosciences for the 21st Century}, 13052 editors = {M. D. Salas and W. K. Anderson}, 13053 ppublisher = {Elsevier}, 13054 year = {1998} 13055} 13056 13057@InProceedings{ pooma-atlas, 13058 author = {S. Atlas and S. Banerjee and J. C. Cummings and P. J. Hinker and M. Srikant and 13059 J. V. W. Reynders and M. Tholburn}, 13060 title = {{POOMA}: A High-Performance Distributed Simulation Environment for Scientific 13061 Applications}, 13062 year = {1995}, 13063 month = dec, 13064 booktitle = {Supercomputing '95 Proceedings} 13065} 13066 13067% --------------------------------------------------------------------------------- 13068% New bib entries for CRPC paper 13069@Misc{ mgnet-web-page, 13070 author = {Craig C. Douglas}, 13071 title = {{MGNet Web page}}, 13072 note = {See {\tt http://\-www.mgnet.org}} 13073} 13074 13075@Misc{ dagh-web-page, 13076 author = {M. Parashar and J. C. Browne}, 13077 title = {{DAGH Web page}}, 13078 note = {\url{http://www.caip.rutgers.edu/~parashar/DAGH}} 13079} 13080 13081@Misc{ parasol-web-page, 13082 key = {PARASOL}, 13083 title = {{PARASOL Web page}}, 13084 note = {See {\tt http://\-www.genias.de/\-projects/\-parasol}} 13085} 13086 13087@Misc{ pooma-web-page, 13088 author = {{POOMA Web page}}, 13089 note = {See {\tt http://\-www.acl.lanl.gov/pooma}} 13090} 13091 13092@Misc{ mudpack-web-page, 13093 author = {John C. Adams}, 13094 title = {{MUDPACK Web page}}, 13095 note = {See {\tt http://\-www.scd.ucar.edu/\-css/\-software/\-mudpack}} 13096} 13097 13098@Misc{ pellpack-web-page, 13099 author = {Elias Houstis and John Rice and Apostolos Hadjidimos}, 13100 title = {{Parallel ELLPACK Web page}}, 13101 note = {See {\tt http://\-www.cs.purdue.edu/\-research/\-cse/\-pellpack/}} 13102} 13103 13104@InProceedings{ pellpack95, 13105 author = {E. N. Houstis and S. B. Kim and S. Markus and P. Wu and N. E. Houstis and A.C. 13106 Catlin and S. Weerawarana and T.S. Papatheodorou}, 13107 title = {Parallel {ELLPACK} Elliptic {PDE} Solvers}, 13108 booktitle = {Proceedings of INTEL Supercomputer User's Group Conference}, 13109 address = {Albuquerque, NM}, 13110 year = {1995} 13111} 13112 13113@Misc{ nhse-web-page, 13114 author = {{National High-Performance Software Exchange Web page}}, 13115 note = {See {\tt http://\-www.nhse.org}} 13116} 13117 13118@Misc{ doug-web-page, 13119 author = {Mark J. Hagger and Linda Stals}, 13120 title = {{DOUG Web Page}}, 13121 note = {See {\tt http://\-www.maths.bath.ac.uk/\~{ }parsoft/\-doug/}} 13122} 13123 13124@TechReport{ doug97, 13125 author = {Mark J. Hagger}, 13126 title = {Automatic Domain Decomposition on Unstructured Grids {(DOUG)}}, 13127 institution = {Mathematical Sciences, University of Bath}, 13128 year = {1997}, 13129 number = {9706}, 13130 note = {Advances in Computational Mathematics (to appear)} 13131} 13132 13133@Misc{ ug-web-page, 13134 author = {{UG Web Page}}, 13135 note = {See {\tt http://\-cox.iwr.uni-heidelberg.de/\~{ }ug/}} 13136} 13137 13138@Article{ ug97, 13139 author = {P. Bastian and K. Birken and K. Johannsen and S. Lang and N. Neuss and H. 13140 Rentz-Reichert and C. Wieners}, 13141 title = {{UG} -- A Flexible Software Toolbox for Solving Partial Differential Equations}, 13142 journal = {Computing and Visualization in Science}, 13143 year = {1997}, 13144 volume = {}, 13145 pages = {} 13146} 13147 13148@Misc{ vecfem-web-page, 13149 author = {Lutz Grosz}, 13150 title = {{VECFEM Web Page}}, 13151 note = {See {\tt http://\-wwwmaths.anu.edu.au/\-\~{ }vecfem/}} 13152} 13153 13154@Misc{ atlas-web-page, 13155 author = {R. Clint {Whaley et al.}}, 13156 title = {{ATLAS Web Page}}, 13157 howpublished = {\url{http://math-atlas.sourceforge.net}} 13158} 13159 13160@Misc{ fenics-web-page, 13161 author = {Todd Dupont and Johan Hoffman and Johan Jansson and Claes Johnson and Robert C. 13162 Kirby and Matthew Knepley and Mats Larson and Anders Logg and Ridgway Scott}, 13163 title = {{FEniCS Web Page}}, 13164 note = {\url{http://www.fenicsproject.org}}, 13165 year = {2005} 13166} 13167 13168@Misc{ matlab-web-page, 13169 author = {{The} {MathWorks}}, 13170 title = {{Matlab} {Web} page}, 13171 url = {http://www.mathworks.com} 13172} 13173 13174@Misc{ phipac-web-page, 13175 author = {J. A. Bilmes and K. Asanovic and R. Vudoc and S. Iyer and J. Demmel and C. Chin 13176 and D. Lam}, 13177 title = {{PHiPAC Web Page}}, 13178 note = {See {\tt http://\-www.icsi.berkeley.edu/\-\~{ }bilmes/\-phipac/}} 13179} 13180 13181@InProceedings{ kelp, 13182 author = {Stephan J. Fink and Scott B. Baden and Scott R. Kohn}, 13183 title = {Flexible Communication Mechanisms for Dynamic Structured Applications}, 13184 booktitle = {Irregular '96}, 13185 year = {1996} 13186} 13187 13188@Unpublished{ kelp-web-page, 13189 author = {Scott Baden}, 13190 title = {{KeLP} {W}eb page}, 13191 note = {See {\tt http://\-www-cse.ucsd.edu/\-groups/\-hpcl/\-scg/\-kelp/}} 13192} 13193 13194@InProceedings{ hk99, 13195 author = {R. Hornung and S. Kohn}, 13196 title = {The Use of Object-Oriented Design Patterns in the {SAMRAI} Structured {AMR} 13197 Framework}, 13198 booktitle = {Proceedings of the SIAM Workshop on Object-Oriented Methods for Inter-Operable 13199 Scientific and Engineering Computing}, 13200 pages = {235-244}, 13201 year = {1999}, 13202 note = {See \url{http://www.llnl.gov/CASC/samrai}} 13203} 13204 13205@Unpublished{ samrai-web-page, 13206 title = {{SAMRAI} {W}eb Page}, 13207 author = {Scott Kohn and Xabier Garaiza and Rich Hornung and Steve Smith}, 13208 note = {See {\tt http://www.llnl.gov/\-CASC/SAMRAI}} 13209} 13210 13211@Misc{ overture-web-page, 13212 author = {William Henshaw and Kyle Chand}, 13213 title = {{Overture} {W}eb page}, 13214 howpublished = {\url{http://www.llnl.gov/CASC/Overture}} 13215} 13216 13217@InProceedings{ overture99, 13218 author = {D.L. Brown and W.D. Henshaw and D.J. Quinlan}, 13219 title = {Overture: An Object-Oriented Framework for Solving Partial Differential Equations 13220 on Overlapping Grids}, 13221 publisher = {SIAM}, 13222 booktitle = {Proceedings of the SIAM Workshop on Object Oriented Methods for Inter-operable 13223 Scientific and Engineering Computing}, 13224 year = {1999}, 13225 pages = {215-224}, 13226 note = {See \url{http://www.llnl.gov/CASC/Overture}} 13227} 13228 13229@InProceedings{ diffpack, 13230 author = {A.M. Bruaset and H.P. Langtangen}, 13231 title = {A Comprehensive Set of Tools for Solving Partial Differential Equations: 13232 {D}iffpack}, 13233 booktitle = {Numerical Methods and Software Tools in Industrial Mathematics}, 13234 year = {1997}, 13235 pages = {61--90}, 13236 publisher = {Birkhauser Press} 13237} 13238 13239@Article{ dongarra:1984:ila, 13240 author = {J. J. Dongarra and F. G. Gustavson and A. Karp}, 13241 title = {Implementing Linear Algebra Algorithms for Dense Matrices on a Vector Pipeline 13242 Machine}, 13243 journal = {SIAM Review}, 13244 volume = {26}, 13245 number = {1}, 13246 pages = {91--112}, 13247 month = jan, 13248 year = {1984}, 13249 coden = {SIREAD}, 13250 issn = {0036-1445 (print), 1095-7200 (electronic)}, 13251 mrclass = {65F10 (65F30)}, 13252 mrnumber = {85c:65032}, 13253 bibdate = {Mon Jan 20 1997}, 13254 abstract = {The authors examine common implementations of linear algebra algorithms, such as 13255 matrix-vector multiplication, matrix-matrix multiplication and the solution of 13256 linear equations. The different versions are examined for efficiency on a computer 13257 architecture which uses vector processing and has pipelined instruction execution. 13258 By using the advanced architectural features of such machines, one can usually 13259 achieve maximum performance, and tremendous improvements in terms of execution 13260 speed can be seen over conventional computers.}, 13261 classification= {723; 921}, 13262 journalabr = {SIAM Rev}, 13263 keywords = {computer programming --- Algorithms; dense matrices; linear algebra algorithms; 13264 mathematical programming; vector pipeline machine} 13265} 13266 13267@Book{ qv99, 13268 author = {Alfio Quarteroni and Alberto Valli}, 13269 title = {Domain Decomposition Methods for Partial Differential Equations}, 13270 publisher = {Oxford Science Publications}, 13271 address = {Oxford}, 13272 year = {1999} 13273} 13274 13275@Book{ ksv97, 13276 editor = {David E. Keyes and Ahmed Sameh and V. Venkatakrishnan}, 13277 title = {Parallel Numerical Algorithms}, 13278 publisher = {Kluwer Academic Publishers}, 13279 address = {the Netherlands}, 13280 year = {1997} 13281} 13282 13283@Book{ hackbusch94, 13284 author = {Wolfgang Hackbusch}, 13285 title = {Iterative Solution of Large Sparse Systems of Equations}, 13286 publisher = {Springer-Verlag}, 13287 address = {New York}, 13288 year = {1994} 13289} 13290 13291@Article{ hackbusch1980fast, 13292 title = {Fast solution of elliptic control problems}, 13293 author = {Hackbusch, W.}, 13294 journal = {Journal of Optimization Theory and Applications}, 13295 volume = {31}, 13296 number = {4}, 13297 pages = {565--581}, 13298 year = {1980}, 13299 publisher = {Springer} 13300} 13301 13302@Book{ hackbusch1985multi, 13303 title = {{Multi-grid methods and applications}}, 13304 author = {Hackbusch, W.}, 13305 isbn = {3540127615}, 13306 issn = {0179-3632}, 13307 year = {1985}, 13308 publisher = {Springer Verlag} 13309} 13310 13311@Book{ axelsson94, 13312 author = {Owe Axelsson}, 13313 title = {Iterative Solution Methods}, 13314 publisher = {Cambridge University Press}, 13315 address = {Cambridge}, 13316 year = {1994} 13317} 13318 13319@Book{ saad96, 13320 author = {Yousef Saad}, 13321 title = {Iterative Methods for Sparse Linear Systems}, 13322 publisher = {PWS Publishing Company}, 13323 address = {Boston}, 13324 year = {1996} 13325} 13326 13327@Book{ saad2003, 13328 title = {Iterative Methods for Sparse Linear Systems}, 13329 author = {Saad, Yousef}, 13330 doi = {10.1016/S1570-579X(01)80025-2}, 13331 edition = {2nd}, 13332 publisher = {SIAM}, 13333 year = {2003} 13334} 13335 13336@Book{ vandervorst03, 13337 author = {Henk A. {van der Vorst}}, 13338 title = {Iterative Krylov Methods for Large Linear Systems}, 13339 publisher = {Cambridge Monographs on Applied ahd Computational Mathematics}, 13340 year = {2003} 13341} 13342 13343@Book{ koniges00, 13344 editor = {Alice E. Koniges}, 13345 title = {Industrial Strength Parallel Computing}, 13346 publisher = {Morgan Kaufmann Publishers}, 13347 address = {San Francisco}, 13348 year = {2000} 13349} 13350 13351@Misc{ fftw-web-page, 13352 key = {Fftw}, 13353 title = {{FFTW} {Web} page}, 13354 note = {\texttt{http://www.fftw.org/}}, 13355 annote = {fast FFT. Parallel versions with MPI and Cilk} 13356} 13357 13358@InProceedings{ frigojohnson93, 13359 author = {Matteo Frigo and Steven G. Johnson}, 13360 title = {The Design and Implementation of {FFTW3}}, 13361 booktitle = {Proceedings of the IEEE}, 13362 volume = {93}, 13363 number = {2}, 13364 pages = {216--231}, 13365 year = {2005} 13366} 13367 13368@Book{ kelley95, 13369 author = {C. T. Kelley}, 13370 title = {Iterative Methods for Linear and Nonlinear Equations}, 13371 year = {1995}, 13372 publisher = {SIAM}, 13373 address = {Philadelphia} 13374} 13375 13376@Unpublished{ spai-web-page, 13377 title = {{SPAI} {W}eb {P}age}, 13378 note = {http://www.sam.math.ethz.ch/\~{ }grote/spai/}, 13379 author = {Steven Bernard and Marcus Grote}, 13380 institution = {NASA Ames Research Center and ETH Zurich} 13381} 13382 13383@Article{ gh97, 13384 author = {M. J. Grote and T. Huckle}, 13385 title = {Parallel Preconditioning with Sparse Approximate Inverses}, 13386 year = {1997}, 13387 journal = {SIAM J. of Scient. Comput.}, 13388 volume = {18}, 13389 pages = {838-853} 13390} 13391 13392@Article{ zhang96, 13393 author = {Wen Zhang}, 13394 title = {Using {MOL} to Solve a high order nonlinear {PDE} with a moving boundary in the 13395 simulation of a sintering process}, 13396 year = {1996}, 13397 journal = {Appl. Numer. Math.}, 13398 volume = {20}, 13399 pages = {235-244} 13400} 13401 13402@Article{ zhang98, 13403 author = {Wen Zhang and Ian Gladwell}, 13404 title = {The sintering of two particles by surface and grain boundary diffusion - a 13405 three-dimensional numerical study}, 13406 journal = {Comp. Mater. Sci.}, 13407 year = {1998}, 13408 volume = {12} 13409} 13410 13411@InProceedings{ mollerschwartzbach01, 13412 author = {Anders M\o{}ller and Michael I. Schwartzbach}, 13413 title = {The Pointer Assertion Logic Engine}, 13414 booktitle = {ACM Proceedings of PLDI'01}, 13415 year = {2001} 13416} 13417 13418@InProceedings{ klarlandschwartzbach97, 13419 author = {Nils Klarland and Michael I. Schwartzbach}, 13420 title = {A Domain-Specific Languages for Regular Sets of Strings and Trees}, 13421 booktitle = {Proceedings of the Conference on Domain-Specific Languages}, 13422 publisher = {USENIX}, 13423 month = oct, 13424 year = {1997}, 13425 address = {Santa Barbara, CA} 13426} 13427 13428@InProceedings{ conselmarlet98, 13429 author = {C. Consel and R. Marlet}, 13430 title = {Architecturing software using a methodology for language development}, 13431 booktitle = {Proceedings of the 10th International Symposium on Programming Languages, 13432 Implementations, Logics and Programs}, 13433 year = {1998}, 13434 pages = {170-174}, 13435 month = sep, 13436 address = {Pisa, Italy} 13437} 13438 13439@Misc{ sundials:homepage, 13440 author = {C. {Woodward et al.}}, 13441 title = {{SUNDIALS {W}eb page}}, 13442 howpublished = {\url{https://computation.llnl.gov/casc/sundials/main.html}} 13443} 13444 13445@article{gardner2022sundials, 13446 title = {Enabling new flexibility in the {SUNDIALS} suite of nonlinear and differential/algebraic equation solvers}, 13447 author = {Gardner, David J and Reynolds, Daniel R and Woodward, Carol S and Balos, Cody J}, 13448 journal = {ACM Transactions on Mathematical Software (TOMS)}, 13449 publisher = {ACM}, 13450 year = {2022}, 13451 doi = {10.1145/3539801} 13452} 13453 13454@Misc{ sundials-user-ref, 13455 title = {{SUNDIALS}: Suite of Nonlinear and Differential/Algebraic Equation Solvers}, 13456 note = {See \url{http://www.llnl.gov/CASC/sundials}}, 13457 author = {Allan Hindmarsh and Peter Brown and Keith Grant and Steven Lee and Radu Serban 13458 and Dan Shumaker and Carol Woodward}, 13459 institution = {Center for Applied Scientific Computing, Lawrence Livermore National Laboratory}, 13460 number = {UCRL-JP-200037}, 13461 year = {2003} 13462} 13463 13464@Article{ sundials05, 13465 author = {A. Hindmarsh and P. Brown and K. Grant and S. Lee and R. Serban and D. Shumaker 13466 and C. Woodward}, 13467 title = {{SUNDIALS:} Suite of Nonlinear and Differential/Algebraic Equation Solvers}, 13468 journal = {ACM Transactions on Mathematical Software}, 13469 volume = {31}, 13470 number = {3}, 13471 pages = {363--396}, 13472 year = {2005} 13473} 13474 13475@InProceedings{ serban2005cvodes, 13476 title = {{CVODES}, the sensitivity-enabled {ODE} solver in {SUNDIALS}}, 13477 author = {Serban, Radu and Hindmarsh, Alan C}, 13478 booktitle = {Proceedings of the 5th International Conference on Multibody Systems, Nonlinear 13479 Dynamics and Control, Long Beach, CA}, 13480 year = {2005} 13481} 13482 13483@Article{ pvode99, 13484 author = {G. Byrne and A. Hindmarsh}, 13485 title = {{PVODE}, An {ODE} Solver for Parallel Computers}, 13486 journal = {Int. J. High Perf. Comput. Apps.}, 13487 volume = {13}, 13488 number = {4}, 13489 year = {1999}, 13490 pages = {354 -- 365} 13491} 13492 13493@Article{ cvode95, 13494 author = {S. Cohen and A. Hindmarsh}, 13495 title = {{CVODE}, A Stiff/Nonstiff {ODE} Solver in {C}}, 13496 journal = {Computers in Physics}, 13497 volume = {10}, 13498 number = {2}, 13499 year = {1996}, 13500 pages = {138 -- 143} 13501} 13502 13503@TechReport{ ifpack, 13504 title = {Robust Algebraic Preconditioners using {IFPACK} 3.0}, 13505 author = {Marzio Sala and Michael Heroux}, 13506 institution = {Sandia National Laboratories}, 13507 number = {SAND2005-0662}, 13508 year = {2005} 13509} 13510 13511@TechReport{ kinsol-user-ref, 13512 title = {User Documentation for {KINSOL}, A Nonlinear Solver for Sequential and Parallel 13513 Computers}, 13514 author = {Allan Taylor and Alan Hindmarsh}, 13515 institution = {Center for Applied Scientific Computing, Lawrence Livermore National Laboratory}, 13516 number = {UCRL-ID-131185}, 13517 year = {1998} 13518} 13519 13520@Article{ fiardmanteuffelmccormick98, 13521 author = {J.-M. Fiard and T. Manteuffel and S. McCormick}, 13522 title = {First-order system least squares {(FOSLS)} for convection-diffusion problems: 13523 numerical results}, 13524 journal = {SIAM J. Sci. Comp.}, 13525 year = {1998}, 13526 volume = {19}, 13527 pages = {1958--1979} 13528} 13529 13530@InProceedings{ vuduc02, 13531 author = {Richard Vuduc and James W. Demmel and Katherine A. Yelick and Shoaib Kamil and 13532 Rajesh Nishtala and Benjamin Lee}, 13533 title = {Performance Optimizations and Bounds for Sparse Matrix-Vector Multiply}, 13534 booktitle = {Proceedings of Supercomputing}, 13535 year = {2002}, 13536 month = nov, 13537 address = {Baltimore} 13538} 13539 13540@Article{ beckerbraackrannacher1999, 13541 title = {Numerical simulation of laminar flames at low Mach number by adaptive finite 13542 elements}, 13543 author = {Roland Becker and Malte Braack and Rolf Rannacher}, 13544 journal = {Combustion Theory and Modelling}, 13545 volume = {3}, 13546 pages = {503--534}, 13547 year = {1999} 13548} 13549 13550@Article{ beckerrannacher01, 13551 author = {R. Becker and R. Rannacher}, 13552 title = {An optimal control approach to a posteriori error estimation in finite element 13553 methods}, 13554 journal = {Acta Numerica}, 13555 year = {2001}, 13556 volume = {10}, 13557 pages = {1--102} 13558} 13559 13560@Article{ babuskamiller84a, 13561 author = {I. Babu$\check{s}$ka and A.D. Miller}, 13562 title = {The post-processing approach in the finite element method, {I}: Calculations of 13563 displacements, stresses, and other higher derivatives of the displacements}, 13564 journal = {Int. J. Numer. Meth. Eng.}, 13565 year = {1984}, 13566 volume = {20}, 13567 pages = {1085--1109} 13568} 13569 13570@Article{ babuskamiller84b, 13571 author = {I. Babu$\check{s}$ka and A.D. Miller}, 13572 title = {The post-processing approach in the finite element method, {II}: The calculation 13573 of stress intensity factors}, 13574 journal = {Int. J. Numer. Meth. Eng.}, 13575 year = {1984}, 13576 volume = {20}, 13577 pages = {1111--1129} 13578} 13579 13580@Article{ babuskamiller84c, 13581 author = {I. Babu$\check{s}$ka and A.D. Miller}, 13582 title = {The post-processing approach in the finite element method, {III}: A posteriori 13583 error estimation and adaptive mesh refinement}, 13584 journal = {Int. J. Numer. Meth. Eng.}, 13585 year = {1984}, 13586 volume = {20}, 13587 pages = {2311--2324} 13588} 13589 13590@Unpublished{ jtb-web-page, 13591 title = {{The Java Tree Builder}}, 13592 note = {See \url{http://www.cs.purdue.edu/jtb}}, 13593 author = {Jens Palsberg}, 13594 institution = {Purdue University} 13595} 13596 13597@Unpublished{ palsberg98, 13598 title = {Why Visitors?}, 13599 note = {See \url{http://www.cs.purdue.edu/jtb/whyvisitors}}, 13600 author = {Jens Palsberg}, 13601 institution = {Purdue University}, 13602 year = {1998} 13603} 13604 13605@Unpublished{ ply-web-page, 13606 title = {{PLY (Python Lex-Yacc)}}, 13607 note = {\url{http://systems.cs.chicago.edu/ply}}, 13608 author = {David Beazley}, 13609 institution = {University of Chicago} 13610} 13611 13612@Misc{ adic-web-page, 13613 title = {{ADIC Web page}}, 13614 note = {\url{http://www.mcs.anl.gov/autodiff}}, 13615 author = {Paul Hovland and Uwe Naumann and Boyana Norris}, 13616 institution = {Argonne National Laboratory} 13617} 13618 13619@Article{ naumann02, 13620 author = {Uwe Naumann}, 13621 title = {Optimal accumulation of {J}acobian matrices by elimination methods on the dual 13622 computational graph}, 13623 journal = {Mathematical Programming (to appear)}, 13624 note = {Preprint ANL/MCS-P944-0402, Argonne National Laboratory, April 2002}, 13625 year = {2003} 13626} 13627 13628@Article{ kaper1, 13629 author = {H. G. Kaper and T. J. Kaper}, 13630 title = {Asymptotic Analysis of Two Reduction Methods for Systems of Chemical Reactions}, 13631 journal = {Physica D}, 13632 year = {2002}, 13633 pages = {66--93}, 13634 volume = {165} 13635} 13636 13637@Misc{ veltisto-web-page, 13638 author = {George Biros}, 13639 title = {{Veltisto Web page}}, 13640 note = {\url{http://www.cs.nyu.edu/~biros/veltisto}} 13641} 13642 13643@Article{ karypiskumar98, 13644 author = {George Karypis and Vipin Kumar}, 13645 title = {A Parallel Algorithm for Multilevel Graph Partitioning and Sparse Matrix 13646 Ordering}, 13647 journal = {Journal of Parallel and Distributed Computing}, 13648 volume = {48}, 13649 pages = {71--85}, 13650 year = {1998} 13651} 13652 13653@TechReport{ karypiskumar97, 13654 author = {Karypis, George and Kumar, V.}, 13655 institution = {Department of Computer Science, University of Minnesota}, 13656 keywords = {graph partitioning; ParMetis}, 13657 note = {http://www.cs.umn.edu/~metis}, 13658 number = {97-060}, 13659 title = {{ParMETIS}: Parallel graph partitioning and sparse matrix ordering library}, 13660 year = {1997} 13661} 13662 13663@Misc{ parmetis-web-page, 13664 author = {George {Karypis et al.}}, 13665 title = {{ParMETIS Web page}}, 13666 note = {\url{http://www.cs.umn.edu/~karypis/metis/parmetis}}, 13667 year = {2005} 13668} 13669 13670@Misc{ sparskit-web-page, 13671 author = {Yousef {Saad et al.}}, 13672 title = {{SPARSKIT Web page}}, 13673 note = {\url{http://www.cs.umn.edu/~saad/software/SPARSKIT/sparskit.html}} 13674} 13675 13676@Misc{ dscpack-web-page, 13677 author = {Padma Raghavan}, 13678 title = {{DSCPACK Web page}}, 13679 note = {\url{http://www.cse.psu.edu/~raghavan/Dscpack}} 13680} 13681 13682@Misc{ gaussian-web-page, 13683 author = {}, 13684 title = {{Gaussian Web page}}, 13685 note = {\url{http://gaussian.com}}, 13686 key = {{Gaussian} {Web} page} 13687} 13688 13689@Book{ lapack-user-guide, 13690 author = {E. Anderson and Z. Bai and C. Bischof and S. Blackford and J. Demmel and J. 13691 Dongarra and J. Du Cris and A. Greenbaum and S. Hammarling and A. McKenney and D. 13692 Sorensen}, 13693 title = {LAPACK Users' Guide, Third Edition}, 13694 publisher = {SIAM}, 13695 year = {1999} 13696} 13697 13698@Manual{ nwchem4.1, 13699 author = {High Performance Computational Chemistry Group}, 13700 title = {{NWChem}, A Computational Chemistry Package for Parallel Computers, Version 4.1}, 13701 year = {2002}, 13702 organization = {Pacific Northwest National Laboratory}, 13703 address = {Richland, Washington 99325-0999 USA}, 13704 note = {See \url{http://www.emsl.pnl.gov/pub/docs/nwchem/}} 13705} 13706 13707@TechReport{ tchem, 13708 title = {{TC}hem: {A} Software Toolkit for the Analysis of Complex Kinetic Models}, 13709 author = {Cosmin Safta and Habib Najm and Omar Knio}, 13710 institution = {Sandia National Laboratories}, 13711 number = {SAND2011-3282}, 13712 year = {2011} 13713} 13714 13715@Misc{ scidac-web-page, 13716 author = {}, 13717 title = {{{SciDAC Initiative Web page}}}, 13718 note = {\url{http://www.osti.gov/scidac}}, 13719 key = {{SciDAC Initiative Web page}} 13720} 13721 13722@Misc{ cmrs:homepage, 13723 author = {Amitava {Bhattacharjee (PI)}}, 13724 title = {{Center for Magnetic Reconnection Studies}}, 13725 howpublished = {\url{http://www.physics.uiowa.edu/cmrs}} 13726} 13727 13728@Misc{ tops:homepage, 13729 author = {David {Keyes (PI)}}, 13730 title = {{Towards Optimal Petascale Simulations (TOPS) Center}}, 13731 howpublished = {\url{http://scalablesolvers.org}} 13732} 13733 13734@Misc{ tstt:homepage, 13735 author = {David Brown and Jim Glimm and Lori Freitag}, 13736 title = {{Terascale Simulation Tools and Technology (TSTT) Center}}, 13737 howpublished = {\url{http://www.tstt-scidac.org}}, 13738 year = {2005} 13739} 13740 13741@Misc{ petsc:applications, 13742 author = {B. F. {Smith et al.}}, 13743 title = {{Scientific Applications Using {PETSc}}}, 13744 howpublished = {\url{http://www.mcs.anl.gov/petsc/publications}} 13745} 13746 13747@Misc{ petsc:users, 13748 author = {B. F. {Smith et al.}}, 13749 title = {{PETSc User Statistics}}, 13750 howpublished = {\url{http://www.mcs.anl.gov/petsc/miscellaneous/usage.html}} 13751} 13752 13753@Misc{ cemm:homepage, 13754 author = {Steve {Jardin (PI)}}, 13755 title = {{Center for Extended MHD Modeling}}, 13756 howpublished = {\url{http://w3.pppl.gov/CEMM}} 13757} 13758 13759@Misc{ m3d:homepage, 13760 author = {Steve {Jardin et al.}}, 13761 title = {{M3D Web page}}, 13762 howpublished = {\url{http://w3.pppl.gov/m3d}} 13763} 13764 13765@Misc{ nimrod:homepage, 13766 author = {Carl R. {Sovinec et al.}}, 13767 title = {{NIMROD Web page}}, 13768 howpublished = {http://nimrodteam.org} 13769} 13770 13771@Misc{ grace-web-page, 13772 author = {Manish {Parashar et al.}}, 13773 title = {{GrACE Web Page}}, 13774 howpublished = {\url{http://www.caip.rutgers.edu/~parashar/TASSL/Projects/GrACE}} 13775} 13776 13777@Misc{ accel1, 13778 title = {Advanced Computing for 21st Century Accelerator Science and Technology Web page}, 13779 howpublished = {\url{http://scidac.nersc.gov/accelerator/}}, 13780 author = {K. Ko and R. Ryne (PIs)} 13781} 13782 13783@Unpublished{ katzspiegelman03, 13784 author = {Richard F. Katz and Marc Spiegelman}, 13785 title = {A semi-{L}agrangian {C}rank-{N}icholson algorithm for the numerical solution of 13786 advection-diffusion problems}, 13787 note = {Columbia University, in preparation} 13788} 13789 13790@Misc{ acts:homepage, 13791 author = {}, 13792 title = {{Advanced CompuTational Software (ACTS) Web page}}, 13793 howpublished = {\url{http://acts.nersc.gov}}, 13794 key = {{Advanced CompuTational Software (ACTS) Web page}} 13795} 13796 13797@Article{ superlu99, 13798 author = {James W. Demmel and Stanley C. Eisenstat and John R. Gilbert and Xiaoye S. Li and 13799 Joseph W. H. Liu}, 13800 title = {A supernodal approach to sparse partial pivoting}, 13801 journal = {SIAM J. Matrix Analysis and Applications}, 13802 year = {1999}, 13803 volume = {20}, 13804 number = {3}, 13805 pages = {720-755} 13806} 13807 13808@Misc{ superlu:homepage, 13809 author = {J. Demmel and J. Gilbert and X. Li}, 13810 title = {{SuperLU Web page}}, 13811 howpublished = {http://crd.lbl.gov/\~xiaoye/SuperLU} 13812} 13813 13814@InProceedings{ ccf98, 13815 author = {E. Chow and A. Cleary and R. Falgout}, 13816 title = {Design of the hypre Preconditioner Library}, 13817 booktitle = {Proceedings of the SIAM Workshop on Object Oriented Methods for Inter-operable 13818 Scientific and Engineering Computing}, 13819 publisher = {SIAM}, 13820 year = {1999} 13821} 13822 13823@TechReport{ hypre-users-manual, 13824 author = {R. Falgout}, 13825 title = {{hypre} Users Manual}, 13826 number = {Revision 2.28}, 13827 institution = {Lawrence Livermore National Laboratory}, 13828 year = {2023}, 13829 url = {https://hypre.readthedocs.io/} 13830} 13831 13832@Misc{ hypre:homepage, 13833 author = {R. Falgout}, 13834 title = {{hypre Web page}}, 13835 howpublished = {\url{https://www.llnl.gov/casc/hypre}} 13836} 13837 13838@InProceedings{ trilinos:gpu, 13839 author = {C.G. Baker and M.A. Heroux. and H.C. Edwards and A.B. Williams}, 13840 title = {A Light-weight API for Portable Multicore Programming}, 13841 booktitle = {18th Euromicro International Conference on Parallel, Distributed and 13842 Network-Based Processing (PDP)}, 13843 pages = {601--606}, 13844 publisher = {IEEE}, 13845 year = {2010} 13846} 13847 13848@InProceedings{ heroux2004design, 13849 title = {The design of {T}rilinos}, 13850 author = {Heroux, Michael A and Sala, Marzio}, 13851 booktitle = {International Workshop on Applied Parallel Computing}, 13852 pages = {620--628}, 13853 year = {2004}, 13854 organization = {Springer} 13855} 13856 13857@Misc{ trilinos:homepage, 13858 author = {M. {Heroux et al.}}, 13859 title = {{Trilinos Web page}}, 13860 howpublished = {{\tt http://trilinos.sandia.gov/}} 13861} 13862 13863@Article{ trilinos:overview, 13864 author = {Michael A. Heroux and Roscoe A. Bartlett and Vicki E. Howle and Robert J. 13865 Hoekstra and Jonathan J. Hu and Tamara G. Kolda and Richard B. Lehoucq and Kevin 13866 R. Long and Roger P. Pawlowski and Eric T. Phipps and Andrew G. Salinger and Heidi 13867 K. Thornquist and Ray S. Tuminaro and James M. Willenbring and Alan Williams and 13868 Kendall S. Stanley}, 13869 title = {An overview of the {T}rilinos project}, 13870 journal = {ACM Transactions on Mathematical Software}, 13871 volume = {31}, 13872 number = {3}, 13873 year = {2005}, 13874 issn = {0098-3500}, 13875 pages = {397--423}, 13876 publisher = {ACM Press}, 13877 doi = {10.1145/1089014.1089021} 13878} 13879 13880@Misc{ rythmos:homepage, 13881 author = {T. Coffey and R. Bartlett}, 13882 title = {Rythmos: Transient Integration of Differential Equations}, 13883 howpublished = {\url{http://trilinos.sandia.gov/packages/rythmos}} 13884} 13885 13886@Misc{ triangle:homepage, 13887 author = {J. {Shewchuk}}, 13888 title = {{Triangle: A Two-Dimensional Quality Mesh Generator and Delaunay Triangulator}}, 13889 howpublished = {\url{http://www-2.cs.cmu.edu/~quake/triangle.html}}, 13890 year = {2005} 13891} 13892 13893@Misc{ tetgen:homepage, 13894 author = {Hang {Si}}, 13895 title = {{TetGen: A Quality Tetrahedral Mesh Generator and Three-Dimensional Delaunay 13896 Triangulator}}, 13897 howpublished = {\url{http://tetgen.berlios.de}}, 13898 year = {2005} 13899} 13900 13901@Misc{ eigen:homepage, 13902 author = {Benoit Jacob and Ga\"el Guennebaud}, 13903 title = {{Eigen} {W}eb page}, 13904 key = {Jacob}, 13905 url = {http://eigen.tuxfamily.org/}, 13906 howpublished = {\url{http://eigen.tuxfamily.org/}}, 13907 year = {2015} 13908} 13909 13910@Misc{ dune:homepage, 13911 author = {Peter Bastian and Markus Blatt and Andreas Dedner and Christian Engwer and Jorrit 13912 Fahlke and Christoph Gersbacher and Carsten Gr\"aser and Christoph Gr\"uninger 13913 Robert Kl\"ofkorn and Steffen M\"uthing and Martin Nolte and Mario Ohlberger and 13914 Oliver Sander}, 13915 title = {{DUNE} {W}eb page}, 13916 key = {Bastian}, 13917 url = {http://www.dune-project.org/}, 13918 howpublished = {\url{http://www.dune-project.org/}}, 13919 year = {2015} 13920} 13921 13922@Misc{ thrust, 13923 author = {N. Bell and J. Hoberock}, 13924 title = {The {T}hrust Library}, 13925 howpublished = {{\tt http://code.google.com/p/thrust/}}, 13926 year = {2010} 13927} 13928 13929@Misc{ cusp, 13930 author = {N. Bell and M. Garland}, 13931 title = {The {C}usp Library}, 13932 howpublished = {{\tt http://code.google.com/p/cusp-library/}}, 13933 year = {2010} 13934} 13935 13936@Misc{ cig:homepage, 13937 author = {M. {Gurnis et al.}}, 13938 title = {{Computational Infrastructure for Geodynamics}}, 13939 howpublished = {\url{http://www.geodynamics.org}} 13940} 13941 13942@Article{ maltsevselkov00, 13943 author = {R. Overbeek and N. Larsen and G. Pusch and M. D'Souza and E. Selkov Jr. and N. 13944 Kyrpides and M. Fonstein and N. Maltsev and E. Selkov}, 13945 title = {{WIT}: {I}ntegrated system for high-throughput genome sequence analysis and 13946 metabolic reconstruction}, 13947 journal = {Nucleic Acids Res.}, 13948 year = {2000}, 13949 month = jan, 13950 pages = {123-125}, 13951 volume = {28}, 13952 number = {1} 13953} 13954 13955@Article{ more:coloring, 13956 author = {Thomas F. Coleman and Jorge J. Mor\'{e}}, 13957 title = {Estimation of sparse {J}acobian matrices and graph coloring problems}, 13958 journal = {SIAM Journal on Numerical Analysis}, 13959 year = {1983}, 13960 month = feb, 13961 pages = {187--209}, 13962 volume = {20}, 13963 number = {1} 13964} 13965 13966@Article{ selkovmaltsev97, 13967 author = {E. Selkov and N. Maltsev and G.J. Olsen and R. Overbeek and W. B. Whitman}, 13968 title = {A reconstruction of the metabolism of Methanococcus jannaschii from sequence 13969 data}, 13970 journal = {Gene}, 13971 year = {1997}, 13972 pages = {GC11-GC26}, 13973 volume = {197}, 13974 number = {1-2} 13975} 13976 13977@Unpublished{ rocketcenter, 13978 title = {Center for Simulation of Advanced Rockets}, 13979 note = {http://www.csar.uiuc.edu}, 13980 institution = {University of Illinois at Urbana-Champaign} 13981} 13982 13983@Article{ kirby03, 13984 title = {A posteriori error estimates for the mixed hybrid finite element method}, 13985 author = {Robert C Kirby}, 13986 journal = {Computational Geosciences}, 13987 volume = {7}, 13988 pages = {197--214}, 13989 note = {\url{http://www.ices.utexas.edu/~clint/nsf/apostmfem.ps}}, 13990 year = {2003} 13991} 13992 13993@Article{ kirby2003b, 13994 title = {On the convergence of high resolution methods with multiple time scales for 13995 hyperbolic conservation laws}, 13996 author = {Robert C Kirby}, 13997 journal = {Mathematics of computation}, 13998 volume = {72}, 13999 number = {243}, 14000 pages = {1239--1250}, 14001 year = {2003} 14002} 14003 14004@Article{ dawsonkirby2001, 14005 title = {High resolution schemes for conservation laws with locally varying time steps}, 14006 author = {Clint Dawson and Robert C Kirby}, 14007 journal = {SIAM Journal on Scientific Computing}, 14008 volume = {22}, 14009 number = {6}, 14010 pages = {2256--2281}, 14011 year = {2001}, 14012 publisher = {SIAM} 14013} 14014 14015@Article{ dawsonkirby1999, 14016 title = {Solution of parabolic equations by backward Euler-mixed finite element methods on 14017 a dynamically changing mesh}, 14018 author = {Clint Dawson and Robert C Kirby}, 14019 journal = {SIAM Journal on Numerical Analysis}, 14020 volume = {37}, 14021 number = {2}, 14022 pages = {423--442}, 14023 year = {1999}, 14024 publisher = {SIAM} 14025} 14026 14027@Article{ barthlarson00, 14028 author = {T. J. Barth and M. G. Larson}, 14029 title = {{\em A posteriori} Error Estimation for Discontiuous {G}alerkin Approximations of 14030 Hyperbolic Systems}, 14031 journal = {LNCS}, 14032 year = {2000}, 14033 volume = {11}, 14034 publisher = {Spinger-Verlag} 14035} 14036 14037@Article{ xu1, 14038 author = {J. Xu}, 14039 title = {Iterative Methods by Space Decomposition and Subspace Correction}, 14040 journal = {SIAM Review}, 14041 volume = {34}, 14042 pages = {581--613}, 14043 year = {1992} 14044} 14045 14046@Article{ brandt77, 14047 author = {Achi Brandt}, 14048 title = {Multi-Level Adaptive Solutions to Boundary-Value Problems}, 14049 journal = {Mathematics of Computation}, 14050 month = apr, 14051 year = {1977}, 14052 pages = {333--390}, 14053 volume = {31}, 14054 number = {138}, 14055 doi = {10.2307/2006422} 14056} 14057 14058@Article{ brandt1979multigrid, 14059 title = {{Multigrid solutions to elliptic flow problems}}, 14060 author = {Brandt, A. and Dinar, N.}, 14061 journal = {Numerical Methods for Partial Differential Equations}, 14062 pages = {53--147}, 14063 year = {1979} 14064} 14065 14066@InCollection{ brandt1979singular, 14067 title = {Multi-Level Adaptive Techniques(MLAT) for singular-perturbation problems}, 14068 author = {Achi Brandt}, 14069 booktitle = {Numerical Analysis of Singular Perturbation Problems}, 14070 editor = {Hemker, Pieter W. and Miller, John J.H.}, 14071 pages = {53--142}, 14072 year = {1979}, 14073 publisher = {Academic Press} 14074} 14075 14076@Article{ amge1, 14077 author = {M. Brezina and A. J. Cleary and R. D. Falgout and V. E. Henson and J. E. Jones 14078 and T. A. Manteuffel and S. F. McCormick and J. W. Ruge}, 14079 title = {Algebraic Multigrid Based on Element Interpolation (AMGe)}, 14080 journal = {SIAM J. Scientific Computing}, 14081 volume = {22}, 14082 pages = {1570--1592}, 14083 year = {2000} 14084} 14085 14086@Book{ bramble1, 14087 author = {J. H. Bramble}, 14088 title = {Multigrid Methods}, 14089 publisher = {Longman Scientific and Technical}, 14090 address = {Essex, England}, 14091 year = {1993} 14092} 14093 14094@Book{ arpack98, 14095 author = {R. B. Lehoucq and D. C. Sorensen and C. Yang}, 14096 title = {ARPACK, Users' Guide}, 14097 publisher = {SIAM}, 14098 year = {1998} 14099} 14100 14101@Article{ bbder96, 14102 author = {R. Barrett and M. Berry and J. Dongarra and V. Eijkhout and C. Romine}, 14103 title = {Algorithmic bombardment for the iterative solution of linear systems: A 14104 polyIterative approach}, 14105 journal = {J. of Computational and Applied Mathematics}, 14106 year = {1996}, 14107 volume = {74}, 14108 pages = {91--110} 14109} 14110 14111@Article{ egks94, 14112 author = {A. Ern and V. Giovangigli and D. E. Keyes and M. D. Smooke}, 14113 title = {Towards polyalgorithmic linear system solvers for nonlinear elliptic problems,}, 14114 journal = {SIAM J. Scientific Computing}, 14115 year = {1994}, 14116 volume = {15}, 14117 number = {3}, 14118 pages = {681--703} 14119} 14120 14121@Article{ dftb02, 14122 author = {P. Zapol and M. Sternberg and L.A. Curtiss and Th. Frauenheim and D.M. Gruen}, 14123 title = {Tight-binding molecular-dynamics simulation of impurities in ultrananocrystalline 14124 diamond grain boundaries,}, 14125 journal = {Phys. Rev}, 14126 year = {2002}, 14127 volume = {B65}, 14128 pages = {045403} 14129} 14130 14131@InBook{ lsa, 14132 author = {R. Bramley and D. Gannon and T. Stuckey and J. Villacis and J. Balasubramanian 14133 and E. Akman and F. Berg and S. Diwan and M. Govindaraju}, 14134 title = {The linear system analyzer}, 14135 series = {enabling technologies for computational science}, 14136 year = {2002}, 14137 publisher = {Kluwer}, 14138 location = {Dordrecht} 14139} 14140 14141@Article{ kk97, 14142 author = {Carl T. Kelley and David E. Keyes}, 14143 title = {Convergence analysis of pseudo-transient continuation}, 14144 journal = {SIAM J. Numerical Analysis}, 14145 year = {1998}, 14146 volume = {35}, 14147 pages = {508--523} 14148} 14149 14150@Article{ swtm01, 14151 author = {R. Shepard and A. F. Wagner and J. L. Tilson and M. Minkoff}, 14152 journal = {Journal of Computational Physics}, 14153 year = {2001}, 14154 volume = {172}, 14155 number = {2}, 14156 pages = {472--514}, 14157 title = {The Subspace Projected Approximate Matrix {(SPAM)} Modification of the {D}avidson 14158 Method} 14159} 14160 14161@TechReport{ zhou03, 14162 author = {Y. Zhou}, 14163 title = {Eigenvalue Computation from the Optimization Perspective: On {Jacobi-Davidson, 14164 IIGD, RQI and Newton} Updates}, 14165 institution = {Argonne National Laboratory}, 14166 number = {ANL/MCS-P1074-0803}, 14167 note = {Submitted to Numerical Linear Algebra with Applications}, 14168 year = {2003} 14169} 14170 14171@Unpublished{ mtwm03, 14172 author = {G. G. Maisuradze and D. L. Thompson and A. F. Wagner and M. Minkoff}, 14173 title = {Interpolating moving least squares methods for fitting potential energy surfaces: 14174 Detailed analysis of one-dimensional applications}, 14175 note = {to appear in the Journal of Chemical Physics}, 14176 year = {2003} 14177} 14178 14179@Article{ singhjosephheslaglowinskipan00, 14180 author = {P. Singh and D. D. Joseph and T. Hesla and R. Glowinski and T.-W. Pan}, 14181 title = {A distributed {L}agrange multiplier/fictitious domain model for viscoelastic 14182 particulate flows}, 14183 journal = {J. Non-Newtonian Fluid Mech.}, 14184 volume = {91}, 14185 pages = {165--188}, 14186 year = {2000} 14187} 14188 14189@Book{ joseph02, 14190 author = {Daniel D. Joseph}, 14191 title = {Interrogations of Direct Numerical Simulations of Sloid-Liquid Flows}, 14192 publisher = {Springer-Verlag}, 14193 month = mar, 14194 year = {2002}, 14195 note = {\url{http://www.efluids.com/efluids/books/joseph.htm}} 14196} 14197 14198@Misc{ triangle-web-page, 14199 author = {Jonathan R. Shewchuk}, 14200 title = {{Triangle Web} page}, 14201 note = {\url{http://www-2.cs.cmu.edu/~quake/triangle.html}} 14202} 14203 14204@InCollection{ shewchuk96, 14205 author = {Jonathan R. Shewchuk}, 14206 title = {Triangle: {E}ngineering a {2D} Quality Mesh Generator and {D}elaunay 14207 Triangulator}, 14208 booktitle = {Applied Computational Geometry: Towards Geometric Engineering}, 14209 editor = {Ming C. Lin and Dinesh Manocha}, 14210 series = {Lecture Notes in Computer Science}, 14211 volume = {1148}, 14212 publisher = {Springer-Verlag}, 14213 pages = {203--222}, 14214 month = may, 14215 year = {1996}, 14216 note = {From the First ACM Workshop on Applied Computational Geometry} 14217} 14218 14219@Article{ leaf1, 14220 author = {Transient Dynamics of Pinning of Domain Walls}, 14221 title = {G. K. Leaf and S. Obukhov and S. Scheidl and V. M. Vinokur}, 14222 journal = {J. Magnetism and Magnetic Materials}, 14223 volume = {241}, 14224 pages = {118--123}, 14225 year = {2002} 14226} 14227 14228@Article{ leaf2, 14229 author = {D. O. Gunter and H. G. Kaper and G. K. Leaf}, 14230 title = {Implicit Integration of the Time-Dependent {Ginzburg-Landau} Equations of 14231 Superconductivity}, 14232 journal = {SIAM J. Sci. Comp.}, 14233 volume = {23}, 14234 pages = {1944--1959}, 14235 year = {2002} 14236} 14237 14238@Article{ leaf3, 14239 author = { J. S. Jiang and H. G. Kaper and G. K. Leaf}, 14240 title = {Hysteresis in Layered Spring Magnets}, 14241 journal = { Discreet and Continuous Dynamical Systems, Series B}, 14242 volume = {1}, 14243 pages = {219--232}, 14244 year = {2001} 14245} 14246 14247@Article{ leaf4, 14248 author = {J. S. Jiang and S. D. Bader and H. G. Kaper and G. K. Leaf}, 14249 title = {Rotational Hysteresis of Exchange-Spring Magnets}, 14250 journal = {J. Phys. D Appl. Phys.}, 14251 volume = {35}, 14252 pages = {2339--2343}, 14253 year = {2002} 14254} 14255 14256@Article{ leaf5, 14257 author = {M. Grimsditch and G. K. Leaf and H. G. Kaper and D. A. Karpeev and R. E. Camley}, 14258 title = {Normal Modes of Spin Excitation in Magnetic Nanoparticles}, 14259 journal = {Submitted to Phys. Rev. B.}, 14260 note = {Submitted}, 14261 year = {2003} 14262} 14263 14264@Article{ graysumpternoidbarnes01, 14265 author = {S. K. Gray and B. G. Sumpter and D. W. Noid and M. d. Barnes}, 14266 title = {Quantum Mechanical Model of Localized Electrons on the Surface of Polymer 14267 Nanospheres}, 14268 journal = {Chem. Phys. Lett.}, 14269 volume = {333}, 14270 pages = {308--313}, 14271 year = {2001} 14272} 14273 14274@InProceedings{ petsc-efficient, 14275 author = {Satish Balay and William~D. Gropp and Lois Curfman McInnes and Barry~F. Smith}, 14276 title = {Efficient Management of Parallelism in Object Oriented Numerical Software 14277 Libraries}, 14278 booktitle = {Modern Software Tools in Scientific Computing}, 14279 editor = {E. Arge and A.~M. Bruaset and H.~P. Langtangen}, 14280 publisher = {Birkh{\"{a}}user Press}, 14281 pages = {163--202}, 14282 year = {1997} 14283} 14284 14285@Article{ mumps01, 14286 author = {Patrick R. Amestoy and Ian S. Duff and Jean-Yves L'Excellent and Jacko Koster}, 14287 title = {A fully asynchronous multifrontal solver using distributed dynamic scheduling}, 14288 journal = {SIAM Journal on Matrix Analysis and Applications}, 14289 volume = {23}, 14290 number = {1}, 14291 pages = {15--41}, 14292 year = {2001} 14293} 14294 14295@Article{ mumps19, 14296 title = {{Performance and Scalability of the Block Low-Rank Multifrontal Factorization on 14297 Multicore Architectures}}, 14298 author = {P.R. Amestoy and A. Buttari and J.-Y. L'Excellent and T. Mary}, 14299 journal = {ACM Transactions on Mathematical Software}, 14300 volume = {45}, 14301 issue = {1}, 14302 pages = {2:1--2:26}, 14303 year = {2019} 14304} 14305 14306@Article{ zoltan06, 14307 author = {Karen D. Devine and Erik G. Boman and Robert T. Heaphy and \"Umit V. 14308 \c{C}ataly\"urek and Robert H. Bisseling}, 14309 title = {Parallel Hypergraph Partitioning for Irregular Problems}, 14310 journal = {SIAM Parallel Processing for Scientific Computing}, 14311 month = feb, 14312 year = {2006} 14313} 14314 14315@Article{ lidemmel03, 14316 author = {Xiaoye S. Li and James W. Demmel}, 14317 title = {{SuperLU\_DIST}: a scalable distributed-memory sparse direct solver for 14318 unsymmetric linear systems}, 14319 journal = {ACM Transactions on Mathematical Software}, 14320 year = {2003}, 14321 month = jun, 14322 volume = {29}, 14323 number = {2}, 14324 pages = {110--140} 14325} 14326 14327@TechReport{ superlu, 14328 author = {James W. Demmel and John R. Gilbert and Xiaoye S. Li}, 14329 title = {{SuperLU} Users' Guide}, 14330 number = {LBNL-44289}, 14331 institution = {Lawrence Berkeley National Laboratory}, 14332 year = {2003}, 14333 url = {http://crd.lbl.gov/\~xiaoye/SuperLU/} 14334} 14335 14336@TechReport{ trilinos-overview03, 14337 title = {{An Overview of {T}rilinos}}, 14338 author = {Michael Heroux and Roscoe Bartlett and Vicki Howle Robert Hoekstra and Jonathan 14339 Hu and Tamara Kolda and Richard Lehoucq and Kevin Long and Roger Pawlowski and 14340 Eric Phipps and Andrew Salinger and Heidi Thornquist and Ray Tuminaro and James 14341 Willenbring and Alan Williams}, 14342 institution = {Sandia National Laboratories}, 14343 number = {SAND2003-2927}, 14344 year = {2003} 14345} 14346 14347@TechReport{ trilinos-users-guide, 14348 title = {{Trilinos} Users Guide}, 14349 author = {Michael A. Heroux and James M. Willenbring}, 14350 institution = {Sandia National Laboratories}, 14351 number = {SAND2003-2952}, 14352 url = {http://trilinos.sandia.gov/}, 14353 year = {2003} 14354} 14355 14356@Article{ pilut01, 14357 author = {David Hysom and Alex Pothen}, 14358 title = {A scalable parallel algorithm for incomplete factor preconditioning}, 14359 journal = {SIAM Journal on Scientific Computing}, 14360 volume = {22}, 14361 pages = {2194--2215}, 14362 year = {2001} 14363} 14364 14365@TechReport{ boomeramg00, 14366 author = {V.~E. Henson and U.~M. Yang}, 14367 title = {{BoomerAMG}: A parallel algebraic multigrid solver and preconditioner}, 14368 institution = {Lawrence Livermore National Laboratory}, 14369 number = {UCRL-JC-133948}, 14370 year = {2000} 14371} 14372 14373@InCollection{ baker2012scaling, 14374 title = {Scaling algebraic multigrid solvers: {O}n the road to exascale}, 14375 author = {Baker, Allison H. and Falgout, Robert D. and Gamblin, Todd and Kolev, Tzanio V. 14376 and Schulz, Martin and Yang, Ulrike Meier}, 14377 booktitle = {Competence in High Performance Computing 2010}, 14378 pages = {215--226}, 14379 year = {2012}, 14380 publisher = {Springer} 14381} 14382 14383@Article{ knollkeyes:04, 14384 author = {D. A. Knoll and D. E. Keyes}, 14385 year = {2004}, 14386 title = {Jacobian-free {Newton-Krylov} Methods: A Survey of Approaches and Applications}, 14387 journal = {J. Comp. Phys.}, 14388 volume = {193}, 14389 pages = {357-397} 14390} 14391 14392@Article{ chacon02, 14393 author = {Luis Chacon and Dana A. Knoll and John M. Finn}, 14394 title = {An implicit nonlinear reduced resistive {MHD} solver}, 14395 journal = {J. Comput. Phys}, 14396 volume = {188}, 14397 year = {2002}, 14398 pages = {15--36} 14399} 14400 14401@Article{ mousseau03, 14402 author = {V. A. Mousseau and D. A. Knoll}, 14403 title = {New Physics-based Preconditioning of Implicit Methods for Non-Equilibrium 14404 Radiation Diffusion}, 14405 journal = {J. Comput. Physics}, 14406 year = {2003} 14407} 14408 14409@Article{ mousseau00, 14410 author = {V. A. Mousseau and D. A. Knoll and W. J. Rider}, 14411 title = {Physics-based Preconditioning and the {Newton-Krylov} Method for Non-Equilibrium 14412 Radiation Diffusion}, 14413 journal = {J. Comput. Physics}, 14414 year = {2000}, 14415 pages = {743--765}, 14416 volume = {160} 14417} 14418 14419@Unpublished{ facets:homepage, 14420 author = {John {Cary (PI)}}, 14421 title = {{Framework Application for Core-Edge Transport Simulations (FACETS)}}, 14422 note = {Proto-FSP project, see \url{http://www.facetsproject.org}} 14423} 14424 14425@Unpublished{ cpes:homepage, 14426 author = {{C.S.} {Chang (PI)}}, 14427 title = {{Center for Plasma Edge Simulation (CPES)}}, 14428 note = {Proto-FSP project, see \url{http://www.cims.nyu.edu/cpes}} 14429} 14430 14431@Misc{ epsi:homepage, 14432 author = {{C.S.} {Chang (PI)}}, 14433 title = {{Center for Edge Physics Simulation (EPSI)}}, 14434 note = {\url{http://epsi.pppl.gov}} 14435} 14436 14437@Unpublished{ groundwater-scidac2:web, 14438 author = {Peter {Lichtner (PI)}}, 14439 title = {Modeling Multiscale-Multiphase-Multicomponent Subsurface Reactive Flows Using 14440 Advanced Computing}, 14441 howpublished = {http://www.scidac.gov/groundwater/gwflow.html} 14442} 14443 14444@Misc{ pflotran:web, 14445 author = {Peter {Lichtner (PI)}}, 14446 title = {{Modeling Multiscale-Multiphase-Multicomponent Subsurface Reactive Flows Using 14447 Advanced Computing}}, 14448 note = {\url{http://ees.lanl.gov/pflotran/}} 14449} 14450 14451@Misc{ accel-scidac2-solicitation, 14452 author = {{DOE Office of Science}}, 14453 title = {{Program Announcement LAB 07-09, SciDAC: Accelerator Science and Simulation}}, 14454 year = {2006}, 14455 note = {\url{http://www.science.doe.gov/grants/LAB07_09.html}} 14456} 14457 14458@Article{ nieter04, 14459 author = {C. Nieter and J. R. Cary}, 14460 title = {{VORPAL}: A Versatile Plasma Simulation Code}, 14461 journal = {J. Comp. Phys.}, 14462 year = {2004}, 14463 volume = {196}, 14464 pages = {448} 14465} 14466 14467@Article{ synergia06, 14468 author = {J. Amundson and P. Spentzouris and J. Qiang and R. Ryne}, 14469 title = {Synergia: An accelerator modeling tool with {3-D} space charge}, 14470 journal = {J. Comp. Phys.}, 14471 year = {2006}, 14472 volume = {211}, 14473 pages = {229-248} 14474} 14475 14476@Unpublished{ stoltz07, 14477 author = {P. H. Stoltz}, 14478 title = {Maps of {RF} cavities generated from electromagnetic simulations}, 14479 year = {2007}, 14480 note = {to appear in Proceedings of the 2007 Particle Accelerator Conference (PAC07), 14481 Albuquerque, NM, 2007} 14482} 14483 14484@Misc{ iter:homepage, 14485 key = {{International Thermonuclear Experimental Reactor (ITER) homepage}}, 14486 year = {2007}, 14487 title = {{International Thermonuclear Experimental Reactor (ITER) homepage}}, 14488 howpublished = {\url{http://www.iter.org}} 14489} 14490 14491@Misc{ epp2010, 14492 author = {{Committee on Elementary Particle Physics in the 21st Century, National Research 14493 Council}}, 14494 title = {Revealing the Hidden Nature of Space and Time: Charting the Course for Elementary 14495 Particle Physics}, 14496 year = {2006}, 14497 howpublished = {The National Academies Press, ISBN: 0309101948} 14498} 14499 14500@Misc{ post-fsp-report, 14501 author = {D.~E.~Post and D.~B.~Batchelor and R.~B.~Bramley and J.~R.~Cary and R.~H.~Cohen 14502 and P.~Colella and S.~C.~Jardin}, 14503 title = {{Report of Fusion Simulation Project Steering Committee}}, 14504 month = aug, 14505 year = {2004}, 14506 note = {Available via \url{http://w3.pppl.gov/usjapanim/FSPReport.pdf}} 14507} 14508 14509@Misc{ fsp:workshop2011, 14510 key = {{Fusion Simulation Project (FSP) Planning Workshop}}, 14511 title = {{Fusion Simulation Project (FSP) Planning Workshop}}, 14512 month = feb, 14513 year = {2011}, 14514 note = {\url{https://ice.txcorp.com/trac/2011_FspDefinitionWorkshop}} 14515} 14516 14517@Book{ hazeltine-meiss-book, 14518 author = {R.~D.~Hazeltine and J.~D.~Meiss}, 14519 title = {Plasma Confinement}, 14520 year = {1991}, 14521 publisher = {Addison-Wesley, Redwood City, CA} 14522} 14523 14524@Article{ falgout05a, 14525 author = {R. D. Falgout and J. E. Jones and U. M. Yang}, 14526 title = {Conceptual Interfaces in hypre}, 14527 journal = {Future Generation Computer Systems}, 14528 note = {Special issue on PDE software}, 14529 volume = {22}, 14530 year = {2005}, 14531 pages = {239--251} 14532} 14533 14534@Article{ falgout05b, 14535 author = {R. D. Falgout and J. E. Jones and U. M. Yang}, 14536 title = {Pursuing Scalability for hypre's Conceptual Interfaces}, 14537 journal = {ACM Trans. Math. Softw.}, 14538 volume = {31}, 14539 year = {2005}, 14540 pages = {326--350} 14541} 14542 14543@Unpublished{ compass:homepage, 14544 author = {Panagiotis {Spentzouris (PI)}}, 14545 title = {Community Petascale Project for Accelerator Science and Simulation (ComPASS)}, 14546 note = {SciDAC2 project, see \url{https://compass.fnal.gov/}} 14547} 14548 14549@Unpublished{ cmsnf:homepage, 14550 author = {{Todd Allen, Director}}, 14551 title = {{Center for Materials Science of Nuclear Fuel}}, 14552 note = {Energy Frontier Research Center, see 14553 \url{https://inlportal.inl.gov/portal/server.pt/community/center_for_materials_science_of_nuclear_fuel}} 14554} 14555 14556@Unpublished{ dvi-materials:project, 14557 author = {{L.~C.} {McInnes (PI)}}, 14558 title = {Large-Scale Differential Variational Inequalities for Heterogeneous Materials}, 14559 note = {{SciDAC}-e project}, 14560 year = {2011} 14561} 14562 14563@Misc{ scidac:homepage, 14564 author = {{DOE Office of Science}}, 14565 title = {{Scientific Discovery through Advanced Computing}}, 14566 year = {2007}, 14567 howpublished = {\url{http://www.scidac.gov}} 14568} 14569 14570@Misc{ corba, 14571 author = {{Object Management Group}}, 14572 year = {2007}, 14573 title = {{Common Object Request Broker Architecture (CORBA)}}, 14574 howpublished = {\url{http://www.corba.org}} 14575} 14576 14577@Article{ uedge, 14578 author = {T.~D. Rognlien and D.~D. Ryutov and N. Mattor and G.~D. Porter}, 14579 title = {Two-Dimensional Electric Fields and Drifts near the Magnetic Separatrix in 14580 Divertor Tokamak}, 14581 journal = {J. Plasma Physics}, 14582 year = {1999}, 14583 volume = {6}, 14584 pages = {1851}, 14585 note = {also see user manual at http://www.mfescience.org, then UEDGE link} 14586} 14587 14588@Article{ bout, 14589 author = {X.~Q. Xu and R.~H. Cohen and T.~D. Rognlien and J.~R. Myra}, 14590 title = {Low-to-High Confinement Transition Simulations in Divertor Geometry}, 14591 journal = {J. Plasma Physics}, 14592 year = {2000}, 14593 volume = {7}, 14594 pages = {1951}, 14595 note = {} 14596} 14597 14598@Article{ bout++, 14599 author = {B. Dudson and M. Umansky and X.~Q. Xu and P. B. Snyder and H. R. Wilson}, 14600 title = {{BOUT++}: A Framework for Parallel Plasma Fluid Simulations}, 14601 journal = {Computer Physics Communications}, 14602 year = {2009}, 14603 volume = {180}, 14604 issue = {9}, 14605 pages = {1467 -- 1480}, 14606 note = {} 14607} 14608 14609@Article{ tempest, 14610 author = {Z. Xiong and X.Q. Xu and B.I. Cohen and R. Cohen and M.R. Dorr and J.A. Hittinger 14611 and G. Kerbel and W.M. Nevins and T. Rognlien}, 14612 title = {Simulation of Plasma Transport in a Toroidal Annulus with TEMPEST}, 14613 journal = {Bull. Am. Phys. Soc. }, 14614 year = {2005}, 14615 volume = {50}, 14616 number = {86}, 14617 pages = {CP1}, 14618 note = {} 14619} 14620 14621@Article{ ccahpc, 14622 author = {David E. Bernholdt and Benjamin A. Allan and Robert Armstrong and Felipe Bertrand 14623 and Kenneth Chiu and Tamara L. Dahlgren and Kostadin Damevski and Wael R. Elwasif 14624 and Thomas G. W. Epperly and Madhusudhan Govindaraju and Daniel S. Katz and James 14625 A. Kohl and Manoj Krishnan and Gary Kumfert and J. Walter Larson and Sophia 14626 Lefantzi and Michael J. Lewis and Allen D. Malony and Lois C. McInnes and Jarek 14627 Nieplocha and Boyana Norris and Steven G. Parker and Jaideep Ray and Sameer Shende 14628 and Theresa L. Windus and Shujia Zhou}, 14629 title = {A Component Architecture for High-Performance Scientific Computing}, 14630 journal = {Intl. J. High-Perf. Computing Appl.}, 14631 volume = {20}, 14632 pages = {163--202}, 14633 year = {2006}, 14634 note = {ACTS Collection special issue} 14635} 14636 14637@Misc{ cca-forum:homepage, 14638 author = {{Common Component Architecture Forum}}, 14639 note = {\url{http://www.cca-forum.org}}, 14640 year = {2010} 14641} 14642 14643@Misc{ petsc:driven-cavity-example, 14644 title = {{PETSc Driven Cavity Example Code}}, 14645 author = {B. F. {Smith et al.}}, 14646 howpublished = {\url{https://petsc.org/release/src/snes/tutorials/ex19.c.html}} 14647} 14648 14649@Misc{ petsc-dm:webpage, 14650 author = {B. F. {Smith et al.}}, 14651 title = {{PETSc DM Webpage}}, 14652 howpublished = {\url{https://petsc.org/release/manualpages/DM/}}, 14653 year = {2018} 14654} 14655 14656@Misc{ unic-ref, 14657 author = {Giuseppe Palmiotti}, 14658 title = {{UNIC} Neutronics Software}, 14659 note = {Nuclear Engineering Division, Argonne National Laboratory} 14660} 14661 14662% ----------------------------------------------------------------------- 14663% Model coupling refs 14664@Book{ greve-blatter, 14665 author = {Ralf Greve and Heinz Blatter}, 14666 title = {Dynamics of Ice Sheets and Glaciers}, 14667 series = {Advances in Geophysical and Environmental Mechanics and Mathematics}, 14668 publisher = {Springer}, 14669 year = {2009} 14670} 14671 14672@Misc{ doe-isicles, 14673 key = {ISICLES}, 14674 title = {Ice {S}heet {I}nitiative for {CL}-imate {E}xtreme{S}}, 14675 howpublished = {\url{http://www.csm.ornl.gov/ISICLES/index.html}} 14676} 14677 14678@Article{ safta2011tchem, 14679 title = {TChem-a software toolkit for the analysis of complex kinetic models}, 14680 author = {Safta, Cosmin and Najm, Habib N and Knio, Omar}, 14681 journal = {Sandia Report, SAND2011-3282}, 14682 year = {2011} 14683} 14684 14685@Misc{ chemkin-website, 14686 key = {chemkin}, 14687 title = {ANSYS Chemkin-Pro Website}, 14688 howpublished = {\url{http://www.ansys.com/products/fluids/ansys-chemkin-pro}}, 14689 year = {2017} 14690} 14691 14692@Misc{ mct-website, 14693 key = {MCT}, 14694 title = {{M}odel {C}oupling {T}oolkit ({MCT}) {W}eb {S}ite}, 14695 howpublished = {\url{http://www.mcs.anl.gov/mct}} 14696} 14697 14698@Article{ larson:05, 14699 author = {Jay Larson and Robert Jacob and Everest Ong}, 14700 title = {{The Model Coupling Toolkit}: A New {Fortran90} Toolkit for Building 14701 Multi-Physics Parallel Coupled Models}, 14702 journal = {Int. J. High Perf. Comp. App.}, 14703 year = {2005}, 14704 pages = {277--292} 14705} 14706 14707@Article{ dennis2012computational, 14708 title = {Computational performance of ultra-high-resolution capability in the Community 14709 Earth System Model}, 14710 author = {Dennis, John M and Vertenstein, Mariana and Worley, Patrick H and Mirin, Arthur A 14711 and Craig, Anthony P and Jacob, Robert and Mickelson, Sheri}, 14712 journal = {International Journal of High Performance Computing Applications}, 14713 volume = {26}, 14714 number = {1}, 14715 pages = {5--16}, 14716 year = {2012}, 14717 publisher = {SAGE Publications} 14718} 14719 14720@InProceedings{ bettge01, 14721 author = {T. Bettge and A. Craig and R. James and V. Wayland and G. Strand}, 14722 year = {2001}, 14723 title = {The {DOE} Parallel Climate Model {(PCM)}: The Computational Highway and 14724 Backroads}, 14725 booktitle = {Proc. International Conference on Computational Science (ICCS) 2001}, 14726 editors = {V. N. Alexandrow and J. J. Dongarra and C. J. K. Tan}, 14727 pages = {148 -- 156}, 14728 series = {Lecture Notes in Computer Science}, 14729 volume = {2073}, 14730 publisher = {Springer-Verlag} 14731} 14732 14733@InProceedings{ jacob01, 14734 author = {R. Jacob and C. Schafer and I. Foster and M. Tobis and J. Anderson}, 14735 year = {2001}, 14736 title = {Computational Design and Performance of the {Gast} Ocean Atmosphere Model}, 14737 booktitle = {Proc. International Conference on Computational Science (ICCS) 2001}, 14738 editors = {V. N. Alexandrow and J. J. Dongarra and C. J. K. Tan}, 14739 series = {Lecture Notes in Computer Science}, 14740 volume = {2073}, 14741 publisher = {Springer-Verlag} 14742} 14743 14744@Article{ chen2008new, 14745 title = {New generation of multi-scale {NWP} system {(GRAPES)}: General scientific 14746 design}, 14747 author = {Chen, DeHui and Xue, JiShan and Yang, XueSheng and Zhang, HongLiang and Shen, 14748 XueShun and Hu, JiangLin and Wang, Yu and Ji, LiRen and Chen, JiaBin}, 14749 journal = {Chinese Science Bulletin}, 14750 volume = {53}, 14751 number = {22}, 14752 pages = {3433--3445}, 14753 year = {2008}, 14754 publisher = {Springer} 14755} 14756 14757@InProceedings{ baum01, 14758 author = {J. Baum and H. Luo and E. Mestreau and D. Sharov and R. Loehner and D. Pelessone 14759 and C. Charman}, 14760 year = {2001}, 14761 title = {Recent Developments of a Coupled {CFD/CSD} Methodology}, 14762 booktitle = {Proc. International Conference on Computational Science (ICCS) 2001}, 14763 editors = {V. N. Alexandrow and J. J. Dongarra and C. J. K. Tan}, 14764 series = {Lecture Notes in Computer Science}, 14765 volume = {2073}, 14766 publisher = {Springer-Verlag} 14767} 14768 14769@InProceedings{ lefantzi03, 14770 author = {S. Lefantzi and J. Ray}, 14771 year = {2003}, 14772 title = {A Component-based Scientific Toolkit for Reacting Flows}, 14773 booktitle = {Proc. Second MIT Conference on Computational Fluid and Solid Mechanics}, 14774 volume = {2}, 14775 publisher = {Elsevier} 14776} 14777 14778@Article{ boville98, 14779 author = {B. A. Boville and P. R. Gent}, 14780 title = {The {NCAR} Climate System Model, Version One}, 14781 journal = {Journal of Climate}, 14782 volume = {11}, 14783 year = {1998}, 14784 pages = {1115--1130} 14785} 14786 14787@Misc{ paraschivoiu99, 14788 author = {M. Paraschivoiu and X.-C. Cai and M. Sarkis and D. P. Young and D. Keyes}, 14789 title = {Multi-domain multi-model formulation for compressible flows: Conservative 14790 interface coupling and parallel implicit solvers for {3D} unstructured meshes}, 14791 note = {AIAA Paper 99-0784}, 14792 year = {1999} 14793} 14794 14795@Article{ peszynska, 14796 author = {M. Peszynska and M. F. Wheeler and I. Yotov}, 14797 title = {Mortar upscaling for multiphysics flow in porous media}, 14798 journal = {Computational Geosciences} 14799} 14800 14801@TechReport{ wheeler00, 14802 author = {M. F. Wheeler and J. Wheeler and M. Peszynska}, 14803 title = {A distributed computing portal for coupling multi-physics and multiple domains in 14804 porous media}, 14805 institution = {University of Texas at Austin}, 14806 number = {TICAM 00-03}, 14807 year = {2000} 14808} 14809 14810@TechReport{ peszynska00, 14811 author = {M. Peszynska and Q. Lu and M. F. Wheeler}, 14812 title = {Multiphysics Coupling of Codes}, 14813 institution = {University of Texas at Austin}, 14814 number = {TICAM 00-02}, 14815 year = {2000} 14816} 14817 14818@Article{ joshaghanijoodatnakshatrala2019, 14819 title = {A stabilized mixed discontinuous Galerkin formulation for double 14820 porosity/permeability model}, 14821 author = {MS Joshaghani and SHS Joodat and KB Nakshatrala}, 14822 journal = {Computer Methods in Applied Mechanics and Engineering}, 14823 volume = {352}, 14824 pages = {508--560}, 14825 year = {2019} 14826} 14827 14828@InProceedings{ cai99, 14829 author = {X.-C. Cai and M. Paraschivoiu and M. Sarkis}, 14830 title = {An explicit multi-model compressible flow formulation based on the full potential 14831 equation and the {Euler} equations on {3D} unstructured meshes}, 14832 booktitle = {Proceedings of the 11th International Conference on Domain Decomposition 14833 Methods}, 14834 editor = {C-H. Lai and P. Bjorstad and M. Cross and O. Widlund}, 14835 year = {1999} 14836} 14837 14838@Article{ he05, 14839 author = {Yun He and Chris H. Q. Ding}, 14840 title = {Coupling Multi-Component Models with {MPH} on Distributed Memory Computer 14841 Architectures}, 14842 year = {2005}, 14843 volume = {19}, 14844 pages = {329--240}, 14845 number = {3}, 14846 journal = {Int. Journal of High Performance Computing Applications} 14847} 14848 14849@InProceedings{ uiuc-rocket-center02, 14850 author = {W. A. Dick and M. T. Heath}, 14851 title = {Whole System Simulation of Solid Propellant Rockets}, 14852 booktitle = {Proceedings of the AIAA Joint Propulsion Conference, AIAA2002-4345}, 14853 month = jul, 14854 year = {2002} 14855} 14856 14857@InProceedings{ toth04, 14858 author = {G. Toth and O. Volberg and A. J. Ridley and T. I Gombosi and D. DeZeeuw and K. W. 14859 Hansen and D. R. Chesney and Q. F. Stout and K. G. Powell and K. Kane and R. 14860 Oehmke}, 14861 title = {A Physics-Based Software Framework for Sun-Earth Connection Modeling}, 14862 editor = {A. T. Y. Lui and Y. Kamide and G. Consolini}, 14863 booktitle = {Multiscale Coupling of Sun-Earth Processes, Proceedings of the Conference on the 14864 Sun-Earth Connection}, 14865 year = {2004}, 14866 publisher = {Elsevier}, 14867 pages = {383--397} 14868} 14869 14870@Misc{ csdrm:web, 14871 author = {M. Aivazis and B. Goddard and D. Meiron and M. Ortiz and J. Pool and J. 14872 Shepherd}, 14873 title = {{Center for Simulation of Dynamic Response of Materials}}, 14874 note = {California Institute of Technology, see \url{http://csdrm.caltech.edu}} 14875} 14876 14877@Misc{ csar:web, 14878 author = {M. {Heath (Director)}}, 14879 title = {{Center for Simulation of Advanced Rockets}}, 14880 note = {University of Illinois at Urbana-Champaign, see \url{http://www.csar.uiuc.edu}} 14881} 14882 14883@Misc{ csafe:web, 14884 author = {D. {Pershing (Director)}}, 14885 title = {{Center for Simulation of Accidental Fires and Explosions}}, 14886 note = {University of Utah, see \url{http://www.csafe.utah.edu}} 14887} 14888 14889@Misc{ cits:web, 14890 author = {P. {Moin (Director)}}, 14891 title = {{Center for Integrated Turbulence Simulations}}, 14892 note = {Stanford University, see \url{http://www.stanford.edu/group/cits}} 14893} 14894 14895@Misc{ flash:web, 14896 author = {D. {Lamb (Director)}}, 14897 title = {{Center for Integrated Turbulence Simulations}}, 14898 note = {University of Chicago, see \url{http://flash.uchicago.edu}} 14899} 14900 14901@TechReport{ utah-csafe03, 14902 author = {J. Guilkey and T. Harman and A. Xia and B. Kashiwa and P. McMurtry}, 14903 title = {An Eulerian-Lagrangian Approach for Large Deformation Fluid Structure Interaction 14904 Problems, Part 1: Algorithm Development}, 14905 institution = {University of Utah, Center for the Simulation of Accidental Fires and 14906 Explosions}, 14907 year = {2003} 14908} 14909 14910@InBook{ shepherd07, 14911 author = {M. Shepherd and E. Seol and B. FrantzDale}, 14912 title = {Toward a Multi-Model Hierarchy to Support Multiscale Simulations}, 14913 year = {2007}, 14914 booktitle = {CRC Handbook of Dynamic System Modeling}, 14915 publisher = {Wiley}, 14916 pages = {1--41}, 14917 note = {also available as SCOREC Report 2007-2, Rensselaer Polytechnic Institute} 14918} 14919 14920@InProceedings{ cactus02, 14921 author = {Tom Goodale and Gabrielle Allen and Gerd Lanfermann and Joan Masso and Thomas 14922 Radke and Edward Seidel and John Shalf}, 14923 title = {The {Cactus} Framework and Toolkit: Design and Applications}, 14924 booktitle = {VECPAR'2002, 5th International Conference, Lecture Notes in Computer Science}, 14925 year = {2002}, 14926 url = {http://www.cactuscode.org/Papers/VecPar_2002.pdf} 14927} 14928 14929@Misc{ cactus:homepage, 14930 author = {G. {Allen et al.}}, 14931 title = {{Cactus Web page}}, 14932 howpublished = {\url{http://cactuscode.org}} 14933} 14934 14935@Misc{ open-grid-forum:web, 14936 key = {{Open Grid Forum}}, 14937 title = {{Open Grid Forum}}, 14938 note = {See \url{http://www.ogf.org}} 14939} 14940 14941@Misc{ nox:web, 14942 author = {Tamara Kolda and Roger {Pawlowski et al.}}, 14943 title = {Nonlinear Object-Oriented Solutions {(NOX)}}, 14944 note = {See \url{http://software.sandia.gov/nox}} 14945} 14946 14947@Misc{ chombo:web, 14948 author = {P. {Colella (PI)}}, 14949 title = {{Chombo}}, 14950 note = {See \url{http://seesar.lbl.gov/anag/chombo}} 14951} 14952 14953@Article{ lanzkron96, 14954 author = {P. J. Lanzkron and D. J. Rose and J. T. Wilkes}, 14955 title = {An Analysis of Approximate Nonlinear Elimination}, 14956 journal = {SIAM J. Sci. Comput.}, 14957 volume = {17}, 14958 year = {1996}, 14959 pages = {538--559} 14960} 14961 14962@Article{ jiang95, 14963 author = {J. Jiang and P. Forsyth}, 14964 title = {Robust Linear and Nonlinear Strategies for Solution of the Transonic {Euler} 14965 Equations}, 14966 journal = {Computers and Fluids}, 14967 volume = {24}, 14968 pages = {753--770}, 14969 year = {1995} 14970} 14971 14972@Article{ young90, 14973 author = {D. Young and R. Melbin and M. Bieterman and F. Johnson and S. Samant}, 14974 title = {Global Convergence of Inexact {Newton} Methods for Transonic Flow}, 14975 journal = {Int. J. Numer. Methods Fluids}, 14976 volume = {11}, 14977 pages = {1075--1095}, 14978 year = {1990} 14979} 14980 14981@Article{ fishwick04, 14982 author = {Paul A. Fishwick}, 14983 title = {Toward an Integrated Multimodeling Interface: A Human-Computer Interface Approach 14984 to Interrelating Model Structures}, 14985 journal = {SCS Trans. on Simulation}, 14986 note = {Special Issue in Grand Challenges in Computer Simulation}, 14987 year = {2004} 14988} 14989 14990@Article{ fishwick03, 14991 author = {Paul Fishwick and Jinho Lee and Minho Park and Jyunju Shim}, 14992 title = {{RUBE}: A Customized {2D} and {3D} Modeling Framework for Simulation}, 14993 booktitle = {Proceedings of the 2003 Winter Simulation Conference}, 14994 editor = {S. Chick and P. J. Sanchez and D. Ferrin and D. J. Morrice}, 14995 year = {2003} 14996} 14997 14998@InProceedings{ kirner00, 14999 author = {T. G. Kirner and V. F. Martins}, 15000 title = {Development of an Information Visualization Tool Using Virtual Reality}, 15001 booktitle = {Proceedings of the 2000 ACM Symposium on Applied Computing}, 15002 year = {2000}, 15003 pages = {604--606} 15004} 15005 15006@InProceedings{ orso03, 15007 author = {A. Orso and J. Jones and M. J. Harrold}, 15008 title = {Visualization of Program-Execution Data for Deployed Software}, 15009 booktitle = {Proceedings of the 2003 ACM Symposium on Software Visualization}, 15010 year = {2003}, 15011 pages = {67--76} 15012} 15013 15014@Book{ tiller01, 15015 author = {M. Tiller}, 15016 title = {Introduction to Physical System Modeling with Modelica}, 15017 series = {Kluwer International Series inEngineering and Computer Science}, 15018 volume = {615}, 15019 publisher = {Kluwer}, 15020 year = {2001} 15021} 15022 15023@Article{ buck94, 15024 author = {J. Buck and S. Ha and E. Lee and D. Messerschmitt}, 15025 title = {Ptolemy: A Framework for Simulating and Prototyping Heterogeneous Systems}, 15026 journal = {Int. Journal of Computer Simulation}, 15027 volume = {4}, 15028 pages = {155--182}, 15029 year = {1994} 15030} 15031 15032@Article{ mu95, 15033 author = {M. Mu and J.R. Rice}, 15034 title = {Modeling with collaborating {PDE} solvers - Theory and practice}, 15035 journal = {Comp. Syst. Engr.}, 15036 volume = {6}, 15037 year = {1995}, 15038 pages = {87--95} 15039} 15040 15041@TechReport{ drashansky96, 15042 title = {Multidisciplinary Problem Solving using Agents in a Cluster Environment}, 15043 author = {R. Drashansky and A. Joshi and J. R. Rice}, 15044 institution = {Emory Universtity, Department of Mathematics and Computer Science}, 15045 year = {1996} 15046} 15047 15048@Article{ michopoulos05, 15049 title = {Survey on Modeling and Simulation of Multiphysics Systems}, 15050 author = {John G. Michopoulos and Charbel Farhat and Jacob Fish}, 15051 journal = {Journal of Computing and Information Science in Engineering}, 15052 volume = {5}, 15053 issue = {3}, 15054 pages = {198--213}, 15055 year = {2005} 15056} 15057 15058@Article{ dubey09, 15059 title = {Extensibe Component-Based Architecture for {FLASH}, a Massively Parallel 15060 Multiphysics Simulation Code}, 15061 author = {A. Dubey and K. Antypass and M. Ganapathy and L. Reid and D. Sheeler and A. 15062 Siegel and K. Weide}, 15063 journal = {Parallel Computing}, 15064 volume = {35}, 15065 issue = {10 -- 11}, 15066 pages = {512 -- 522}, 15067 year = {2009} 15068} 15069 15070@Book{ bottloring95, 15071 author = {Raoul Bott and Loring W. Tu}, 15072 title = {Differential Forms in Algebraic Topology}, 15073 publisher = {Springer}, 15074 year = {1995} 15075} 15076 15077@Book{ kobayashinomizu96, 15078 author = {Shoshichi Kobayashi and Katsumi Nomizu}, 15079 title = {Foundations of Differential Geometry}, 15080 publisher = {Wiley-Interscience}, 15081 year = {1996} 15082} 15083 15084@Article{ hornungkohn02, 15085 author = {Richard D. Hornung and Scott R. Kohn}, 15086 title = {Managing Application Complexity in the SAMRAI Object-Oriented Framework}, 15087 journal = {Concurrency and Computation: Practice and Experience}, 15088 volume = {14}, 15089 pages = {347--368}, 15090 year = {2002} 15091} 15092 15093@InProceedings{ concepts06, 15094 author = {Douglas Gregor and Jaakko J{\"a}rvi and Jeremy Siek and Bjarne Stroustrup and 15095 Gabriel Dos Reis and Andrew Lumsdaine}, 15096 title = {Concepts: Linguistic Support for Generic Programming in C++}, 15097 booktitle = {Proceedings of OOPSLA 2006}, 15098 year = {2006}, 15099 pages = {???--???} 15100} 15101 15102@Book{ hatcher02, 15103 author = {Hatcher, Allen}, 15104 title = {Algebraic Topology}, 15105 publisher = {Cambridge University Press}, 15106 year = {2002} 15107} 15108 15109@Book{ gammahelmjohnsonvlissides95, 15110 abstract = {{Design Patterns is a modern classic in the literature of object-oriented 15111 development, offering timeless and elegant solutions to common problems in 15112 software design. It describes patterns for managing object creation, composing 15113 objects into larger structures, and coordinating control flow between objects. The 15114 book provides numerous examples where using composition rather than inheritance 15115 can improve the reusability and flexibility of code. Note, though, that it's not a 15116 tutorial but a catalog that you can use to find an object-oriented design pattern 15117 that's appropriate for the needs of your particular application--a selection for 15118 virtuoso programmers who appreciate (or require) consistent, well-engineered 15119 object-oriented designs.} {Now on CD, this internationally acclaimed bestseller is 15120 more valuable than ever! 15121 15122 Use the contents of the CD to create your own design documents and reusable 15123 components. The CD contains: 23 patterns you can cut and paste into your own 15124 design documents; sample code demonstrating pattern implementation; complete 15125 Design Patterns content in standard HTML format, with numerous hyperlinked 15126 cross-references; accessed through a standard web browser; Java-based dynamic 15127 search mechanism, enhancing online seach capabilities; graphical user environment, 15128 allowing ease of navigation. 15129 15130 First published in 1995, this landmark work on object-oriented software design 15131 presents a catalog of simple and succinct solutions to common design problems. 15132 Created by four experienced designers, the 23 patterns contained herein have 15133 become an essential resource for anyone developing reusable object-oriented 15134 software. In response to reader demand, the complete text and pattern catalog are 15135 now available on CD-ROM. This electronic version of Design Patterns enables 15136 programmers to install the book directly onto a computer or network for use as an 15137 online reference for creating reusable object-oriented software. 15138 15139 The authors first describe what patterns are and how they can help you in the 15140 design process. They then systematically name, explain, evaluate, and catalog 15141 recurring designs in object-oriented systems. All patterns are compiled from 15142 real-world examples and include code that demonstrates how they may be implemented 15143 in object-oriented programming languages such as C++ and Smalltalk. Readers who 15144 already own the book will want the CD to take advantage of its dynamic search 15145 mechanism and ready-to-install patterns.}}, 15146 author = {Gamma, Erich and Helm, Richard and Johnson, Ralph and Vlissides, John}, 15147 citeulike-article-id={115158}, 15148 howpublished = {Hardcover}, 15149 isbn = {0201633612}, 15150 keywords = {1995 algorithms architecture book books computer computing design design-pattern 15151 design-patterns design_patterns designpatterns development diplom entwurfsmuster 15152 four gang gof java mathgamespatterns no-tag object object-orientation 15153 object-oriented of oo-patterns oop oriented pattern patterns programming se 15154 software software-development software-engineering software_design 15155 softwareengineering standard}, 15156 month = jan, 15157 publisher = {{Addison-Wesley Professional}}, 15158 title = {Design Patterns}, 15159 url = {http://www.amazon.ca/exec/obidos/redirect?tag=citeulike04-20{\&}path=ASIN/0201633612}, 15160 year = {1995} 15161} 15162 15163@InProceedings{ chaco95, 15164 author = {Bruce Hendrickson and Robert Leland}, 15165 title = {A multilevel algorithm for partitioning graphs}, 15166 booktitle = {Supercomputing '95: Proceedings of the 1995 ACM/IEEE Conference on Supercomputing 15167 (CDROM)}, 15168 year = {1995}, 15169 isbn = {0-89791-816-9}, 15170 pages = {28}, 15171 location = {San Diego, California, United States}, 15172 doi = {10.1145/224170.224228}, 15173 publisher = {ACM Press}, 15174 address = {New York} 15175} 15176 15177@Book{ aleksandrov98, 15178 author = {Aleksandrov, Pavel S.}, 15179 title = {Combinatorial Topology}, 15180 publisher = {Dover}, 15181 volume = {3}, 15182 year = {1998} 15183} 15184 15185@Book{ steenrod99, 15186 abstract = {{ Fibre bundles, now an integral part of differential geometry, are also of great 15187 importance in modern physics--such as in gauge theory. This book, a succinct 15188 introduction to the subject by renown mathematician Norman Steenrod, was the first 15189 to present the subject systematically. 15190 15191 It begins with a general introduction to bundles, including such topics as 15192 differentiable manifolds and covering spaces. The author then provides brief 15193 surveys of advanced topics, such as homotopy theory and cohomology theory, before 15194 using them to study further properties of fibre bundles. The result is a classic 15195 and timeless work of great utility that will appeal to serious mathematicians and 15196 theoretical physicists alike. }}, 15197 author = {Steenrod, Norman}, 15198 citeulike-article-id={712999}, 15199 howpublished = {Paperback}, 15200 isbn = {0691005486}, 15201 keywords = {fibre_bundles topology}, 15202 month = apr, 15203 publisher = {{Princeton University Press}}, 15204 title = {The Topology of Fibre Bundles. (PMS-14)}, 15205 url = {http://www.amazon.ca/exec/obidos/redirect?tag=citeulike04-20{\&}path=ASIN/0691005486}, 15206 year = {1999} 15207} 15208 15209@Book{ bredon97, 15210 author = {Bredon, Glen E.}, 15211 title = {Sheaf Theory}, 15212 publisher = {Springer}, 15213 pages = {524}, 15214 series = {Graduate Texts in Mathematics}, 15215 year = {1997} 15216} 15217 15218@TechReport{ tautgesmeyers04, 15219 title = {{MOAB}: A Mesh-Oriented Database}, 15220 author = {Timothy J. Tautges and Ray Meyers and Karl Merkley and Clint Stimpson and Corey 15221 Ernst}, 15222 institution = {Sandia National Laboratories}, 15223 number = {SAND2004-1592}, 15224 month = apr, 15225 year = {2004} 15226} 15227 15228@Article{ tautges04, 15229 author = {Timothy J. Tautges}, 15230 title = {{MOAB}-{SD}: Integrated Structured and Unstructured Mesh Representation}, 15231 journal = {Engineering With Computers}, 15232 volume = {20}, 15233 pages = {286--293}, 15234 year = {2004} 15235} 15236 15237@InProceedings{ meyers02, 15238 author = {Ray Meyers et. al}, 15239 title = {{SNL} Implementation of the {TSTT} Mesh Interface}, 15240 booktitle = {8th International conference on numerical grid generation in computational field 15241 simulations}, 15242 month = jun, 15243 year = {2002} 15244} 15245 15246@InProceedings{ seolshepard05, 15247 author = {E. S. Seol and Mark S. Shephard}, 15248 title = {A Flexible Distributed Mesh Data Structure to Support Parallel Adaptive 15249 Analysis}, 15250 booktitle = {Proceedings of the 8th US National Congress on Computational Mechanics}, 15251 year = {2005} 15252} 15253 15254@Article{ beallwalshshephard04, 15255 author = {Mark W. Beall and Joe Walsh and Mark S. Shephard}, 15256 title = {A comparison of techniques for geometry access related to mesh generation}, 15257 journal = {Engineering With Computers}, 15258 volume = {20}, 15259 number = {3}, 15260 pages = {210--221}, 15261 year = {2004} 15262} 15263 15264@Article{ careyandersoncarneskirk04, 15265 author = {Graham F. Carey and Michael L. Anderson and Brian R. Carnes and Benjamin S. 15266 Kirk}, 15267 title = {Some aspects of adaptive grid technology related to boundary and interior 15268 layers}, 15269 journal = {Journal of Computational Applied Mathematics}, 15270 volume = {166}, 15271 number = {1}, 15272 pages = {55--86}, 15273 year = {2004} 15274} 15275 15276@PhDThesis{ gralthesis, 15277 author = {Guntram Berti}, 15278 title = {Generic Software Components for Scientific Computing}, 15279 school = {TU Cottbus}, 15280 year = {2000}, 15281 note = {\url{http://www.math.tu-cottbus.de/~berti/diss}} 15282} 15283 15284@Article{ whitehead1949, 15285 title = {Combinatorial homotopy. I}, 15286 author = {John HC Whitehead}, 15287 journal = {Bulletin of the American Mathematical Society}, 15288 volume = {55}, 15289 number = {3. P1}, 15290 pages = {213--245}, 15291 year = {1949}, 15292 publisher = {American Mathematical Society} 15293} 15294 15295@Article{ beylkincoifmanrokhlin91, 15296 author = {Gregory Beylkin and Ronald Coifman and Vladimir Rokhlin}, 15297 title = {Fast Wavelet Transforms and Numerical Algorithms {I}}, 15298 journal = {Communications on Pure and Applied Mathematics}, 15299 volume = {44}, 15300 pages = {141--183}, 15301 year = {1991} 15302} 15303 15304@Book{ wesseling92, 15305 author = {Pieter Wesseling}, 15306 title = {An Introduction to Multigrid Methods}, 15307 publisher = {John Wiley and Sons}, 15308 year = {1992} 15309} 15310 15311@Book{ grakakos04, 15312 author = {Loukas Grakakos}, 15313 title = {Classical and Modern Fourier Analysis}, 15314 publisher = {Pearson Education}, 15315 address = {New Jersey}, 15316 year = {2004} 15317} 15318 15319@Misc{ hlib-web-page, 15320 key = {HLib}, 15321 title = {{HLib} {Web} page}, 15322 note = {{\texttt{http://www.hlib.org/}}}, 15323 annote = {Hierarchical matrices for fast integral transform} 15324} 15325 15326@Article{ hackbusch99, 15327 author = {Wolfgang Hackbusch}, 15328 title = {A sparse matrix arithmetic based on {$\mathcal H$}-matrices. Part {I}: 15329 Introduction to {$\mathcal H$}-matrices}, 15330 journal = {Computing}, 15331 volume = {62}, 15332 pages = {89--108}, 15333 year = {1999} 15334} 15335 15336@TechReport{ kay1999green, 15337 title = {A {G}reen's function preconditioner for the steady-state {N}avier-{S}tokes 15338 equations}, 15339 author = {Kay, D. and Loghin, D.}, 15340 year = {1999}, 15341 institution = {Oxford University Computing Laboratory}, 15342 number = {99/06} 15343} 15344 15345@Article{ bebendorf2003existence, 15346 title = {Existence of {$\mathcal H$}-matrix approximants to the inverse {FE}-matrix of 15347 elliptic operators with {$L^\infty$}-coefficients}, 15348 author = {Bebendorf, M. and Hackbusch, W.}, 15349 journal = {Numerische Mathematik}, 15350 volume = {95}, 15351 number = {1}, 15352 pages = {1--28}, 15353 year = {2003}, 15354 publisher = {Springer} 15355} 15356 15357@Article{ hackbusch2005direct, 15358 title = {Direct {S}chur complement method by domain decomposition based on {$\mathcal 15359 H$}-matrix approximation}, 15360 author = {Hackbusch, W. and Khoromskij, B.N. and Kriemann, R.}, 15361 journal = {Computing and Visualization in Science}, 15362 volume = {8}, 15363 number = {3}, 15364 pages = {179--188}, 15365 year = {2005}, 15366 publisher = {Springer} 15367} 15368 15369@TechReport{ duphof2003, 15370 author = {T. Dupont and J. Hoffman and C. Johnson and R. C. Kirby and M. G. Larson and A. 15371 Logg and L. R. Scott}, 15372 title = {The {FE}ni{CS} project}, 15373 institution = {Chalmers Finite Element Center Preprint Series}, 15374 number = {2003--21}, 15375 year = {2003} 15376} 15377 15378@Article{ flame01, 15379 author = {John A. Gunnels and Fred G. Gustavson and Greg M. Henry and Robert A. van de 15380 Geijn}, 15381 title = {{FLAME}: Formal Linear Algebra Methods Environment}, 15382 journal = {Transactions on Mathematical Software}, 15383 volume = {27}, 15384 number = {4}, 15385 year = {2001}, 15386 pages = {422--455} 15387} 15388 15389@Article{ puschel05, 15390 author = {Markus P{\"u}schel and Jos{\'e} M. F. Moura and Jeremy Johnson and David Padua 15391 and Manuela Veloso and Bryan W. Singer and Jianxin Xiong and Franz Franchetti and 15392 Aca Ga\v{c}i\'{c} and Yevgen Voronenko and Kang Chen and Robert W. Johnson and 15393 Nick Rizzolo}, 15394 title = {{SPIRAL}: Code Generation for {DSP} Transforms}, 15395 journal = {Proceedings of the IEEE}, 15396 volume = {93}, 15397 number = {2}, 15398 year = {2005}, 15399 note = {special issue on "Program Generation, Optimization, and Adaptation"} 15400} 15401 15402@Article{ kirbylogg06, 15403 author = {Robert C. Kirby and Anders Logg}, 15404 title = {A compiler for variational forms}, 15405 journal = {ACM Transactions on Mathematical Software}, 15406 volume = {32}, 15407 number = {3}, 15408 year = {2006}, 15409 issn = {0098-3500}, 15410 pages = {417--444}, 15411 doi = {10.1145/1163641.1163644}, 15412 publisher = {ACM Press}, 15413 address = {New York, NY} 15414} 15415 15416@Article{ kirbylogg07, 15417 author = {Robert C. Kirby and Anders Logg}, 15418 title = {Efficient compilation of a class of variational forms}, 15419 journal = {ACM Transactions on Mathematical Software}, 15420 volume = {33}, 15421 number = {3}, 15422 year = {2007}, 15423 issn = {0098-3500}, 15424 pages = {17}, 15425 doi = {10.1145/1268769.1268771}, 15426 publisher = {ACM Press}, 15427 address = {New York, NY} 15428} 15429 15430@Article{ bankdupont81, 15431 author = {Randolph Bank and Todd Dupont}, 15432 title = {An optimal order process for solving finite element equations}, 15433 journal = {Mathematics of Computation}, 15434 volume = {36}, 15435 pages = {35--51}, 15436 year = {1981} 15437} 15438 15439@TechReport{ adams00, 15440 author = {Mark F. Adams}, 15441 title = {Evaluation of three unstructured multigrid methods on 3D finite element problems 15442 in solid mechanics}, 15443 institution = {UC Berkeley}, 15444 number = {CSD-00-1103}, 15445 year = {2000}, 15446 url = {citeseer.ist.psu.edu/article/adams00evaluation.html} 15447} 15448 15449@Article{ bergengradlhuelsemannruede06, 15450 author = {Benjamin Bergen and Tobias Gradl and Frank H\"ulsemann and Ulrich R\"ude}, 15451 title = {A Massively Parallel Multigrid Method for Finite Elements}, 15452 journal = {Computing in Science \& Engineering}, 15453 volume = {8}, 15454 number = {6}, 15455 pages = {56--62}, 15456 year = {2006} 15457} 15458 15459@MastersThesis{ brunethesis08, 15460 author = {Peter R. Brune}, 15461 title = {Enabling Unstructured Multigrid Under the Sieve Framework}, 15462 school = {University of Chicago}, 15463 address = {Chicago, IL}, 15464 year = {2008}, 15465 month = feb 15466} 15467 15468@Article{ arnoldwinther02, 15469 author = {Douglas N. Arnold and Ragnar Winther}, 15470 title = {Mixed finite elements for elasticity}, 15471 journal = {Numerische Mathematik}, 15472 volume = {92}, 15473 number = {3}, 15474 month = sep, 15475 year = {2002}, 15476 pages = {401--419}, 15477 doi = {10.1007/s002110100348} 15478} 15479 15480@Article{ arnoldfalkwinther06, 15481 author = {Douglas N. Arnold and Richard S. Falk and Ragnar Winther}, 15482 title = {Finite element exterior calculus, homological techniques, and applications}, 15483 journal = {Acta Numerica}, 15484 year = {2006}, 15485 volume = {15}, 15486 pages = {1--155}, 15487 publisher = {Cambridge University Press}, 15488 doi = {10.1017/S0962492906210018} 15489} 15490 15491@Article{ kirby04, 15492 author = {Robert C. Kirby}, 15493 title = {Algorithm 839: {FIAT}, a new paradigm for computing finite element basis 15494 functions}, 15495 journal = {ACM Transactions on Mathematical Software}, 15496 volume = {30}, 15497 number = {4}, 15498 year = {2004}, 15499 issn = {0098-3500}, 15500 pages = {502--516}, 15501 doi = {10.1145/1039813.1039820}, 15502 publisher = {ACM Press}, 15503 address = {New York, NY} 15504} 15505 15506@Article{ kirby06, 15507 author = {Robert C. Kirby}, 15508 title = {Optimizing {FIAT} with level 3 {BLAS}}, 15509 journal = {ACM Transactions on Mathematical Software}, 15510 volume = {32}, 15511 number = {2}, 15512 year = {2006}, 15513 issn = {0098-3500}, 15514 pages = {223--235}, 15515 doi = {10.1145/1141885.1141889}, 15516 publisher = {ACM Press}, 15517 address = {New York, NY} 15518} 15519 15520@Misc{ bluecrystal08, 15521 author = {{B}lue {C}rystal Cluster}, 15522 title = {Advanced {C}omputing {R}esearch {C}entre{,} {University of Bristol}}, 15523 year = {2008}, 15524 note = {\url{http://www.acrc.bris.ac.uk/acrc/hpc.htm}} 15525} 15526 15527@Article{ beylkin95, 15528 author = {Gregory Beylkin}, 15529 title = {On the Fast Fourier Transform of Functions With Singularities}, 15530 journal = {Applied and Computational Harmonic Analysis}, 15531 volume = {2}, 15532 pages = {363--381}, 15533 year = {1995} 15534} 15535 15536@InProceedings{ riehl08, 15537 author = {Jonathan Riehl}, 15538 title = {Implementing the MyFEM Embedded Domain-specific Language}, 15539 booktitle = {Proceedings of the Second International Workshop on Domain-specific Program 15540 Development (DSPD'08)}, 15541 address = {Nashville, TN}, 15542 year = {2008} 15543} 15544 15545@Article{ appel85, 15546 author = {Andrew W. Appel}, 15547 date-added = {2008-02-27 12:23:39 +0000}, 15548 date-modified = {2008-02-27 12:24:02 +0000}, 15549 doi = {10.1137/0906008}, 15550 journal = {SIAM Journal on Scientific and Statistical Computing}, 15551 keywords = {treecodes}, 15552 number = {1}, 15553 pages = {85-103}, 15554 publisher = {SIAM}, 15555 title = {An Efficient Program for Many-Body Simulation}, 15556 volume = {6}, 15557 year = {1985} 15558} 15559 15560@Article{ ewald21, 15561 author = {{Ewald}, P.~P.}, 15562 title = {{Die Berechnung optischer und elektrostatischer Gitterpotentiale}}, 15563 journal = {Annalen der Physik}, 15564 year = {1921}, 15565 volume = {369}, 15566 pages = {253-287}, 15567 doi = {10.1002/andp.19213690304}, 15568 adsurl = {http://adsabs.harvard.edu/abs/1921AnP...369..253E}, 15569 adsnote = {Provided by the SAO/NASA Astrophysics Data System} 15570} 15571 15572@Article{ greengardrokhlin87, 15573 author = {L. Greengard and V. Rokhlin}, 15574 date-added = {2008-02-15 18:43:55 +0000}, 15575 date-modified = {2008-02-26 20:09:11 +0000}, 15576 doi = {10.1016/0021-9991(87)90140-9}, 15577 journal = {J. Comput.\ Phys.}, 15578 keywords = {FMM}, 15579 number = {2}, 15580 pages = {325--348}, 15581 title = {A Fast Algorithm for Particle Simulations}, 15582 url = {citeseer.ist.psu.edu/greengard87fast.html}, 15583 volume = {73}, 15584 year = {1987}, 15585 bdsk-url-1 = {citeseer.ist.psu.edu/greengard87fast.html} 15586} 15587 15588@Article{ greengardrokhlin97, 15589 author = {L. Greengard and V. Rokhlin}, 15590 title = {A New Version of the Fast Multipole Method for the Laplace Equation in Three 15591 Dimensions}, 15592 journal = {Acta Numerica}, 15593 volume = {6}, 15594 year = {1997}, 15595 pages = {229--269} 15596} 15597 15598@Article{ luchenghuangmccammon06, 15599 author = {Benzhuo Lu and Xiaolin Cheng and Jingfang Huang and J. Andrew McCammon}, 15600 title = {Order {N} algorithm for computation of electrostatic interactions in biomolecular 15601 systems}, 15602 journal = {PNAS}, 15603 doi = {10.1073/pnas.0605166103}, 15604 volume = {102}, 15605 number = {51}, 15606 year = {2006}, 15607 pages = {19314--19319} 15608} 15609 15610@Article{ schussnadlereisenberg01, 15611 author = {Zev Schuss and Boaz Nadler and Robert S. Eisenberg}, 15612 title = {Derivation of {P}oisson and {N}ernst-{P}lanck equations in a bath and channel 15613 from a molecular model}, 15614 journal = {Physical Review E}, 15615 volume = {64}, 15616 number = {3}, 15617 year = {2001} 15618} 15619 15620@Book{ hairerlubichwanner02, 15621 author = {E. Hairer and Ch. Lubich and G. Wanner}, 15622 title = {Geometric Numerical Integration}, 15623 publisher = {Springer-Verlag}, 15624 address = {Berlin Heidelberg}, 15625 year = {2002} 15626} 15627 15628@Article{ holstbakerwang00, 15629 author = {M. Holst and N. Baker and F. Wang}, 15630 title = {The adaptive multilevel finite element solution of the {P}oisson-{B}oltzmann 15631 equation on massively parallel computers}, 15632 journal = {Journal of Computational Chemistry}, 15633 volume = {21}, 15634 year = {2000} 15635} 15636 15637@Book{ hockneyeastwood81, 15638 author = {R. Hockney and J. Eastwood}, 15639 title = {Computer simulation using particles}, 15640 publisher = {McGraw-Hill}, 15641 address = {New York}, 15642 year = {1981} 15643} 15644 15645@Article{ lutydavistironigunsteren94, 15646 author = {Brock A. Luty and Malcolm E. Davis and Ilario G. Tironi and Wilfred F. Van 15647 Gunsteren}, 15648 title = {A Comparison of {P}article-{P}article, {P}article-{M}esh and {E}wald Methods for 15649 Calculating Electrostatic Interactions in Periodic Molecular Systems}, 15650 journal = {Molecular Simulation}, 15651 volume = {14}, 15652 number = {1}, 15653 year = {1994}, 15654 pages = {11--20} 15655} 15656 15657@Book{ briggshensonmccormick00, 15658 author = {Briggs,, William L. and Henson,, Van Emden and McCormick,, Steve F.}, 15659 title = {A Multigrid Tutorial (2nd ed.)}, 15660 year = {2000}, 15661 isbn = {0-89871-462-1}, 15662 publisher = {Society for Industrial and Applied Mathematics}, 15663 address = {Philadelphia, PA} 15664} 15665 15666@Article{ chartier2003spectral, 15667 title = {Spectral AMGe ($\rho$ AMGe)}, 15668 author = {Chartier, Tim and Falgout, RD and Henson, VE and Jones, J and Manteuffel, T and 15669 McCormick, S and Ruge, J and Vassilevski, PS}, 15670 journal = {SIAM Journal on Scientific Computing}, 15671 volume = {25}, 15672 number = {1}, 15673 pages = {1--26}, 15674 year = {2003}, 15675 publisher = {SIAM} 15676} 15677 15678@Article{ galvis2010domain, 15679 title = {Domain decomposition preconditioners for multiscale flows in high-contrast 15680 media}, 15681 author = {Galvis, Juan and Efendiev, Yalchin}, 15682 journal = {Multiscale Modeling \& Simulation}, 15683 volume = {8}, 15684 number = {4}, 15685 pages = {1461--1483}, 15686 year = {2010}, 15687 publisher = {SIAM} 15688} 15689 15690@Book{ brennerscott02, 15691 author = {Susanne~C. Brenner and L.~Ridgway Scott}, 15692 title = {The mathematical theory of finite element methods}, 15693 year = {2002}, 15694 isbn = {0-38795-451-1}, 15695 publisher = {Springer}, 15696 pages = {361} 15697} 15698 15699@Book{ trefethenbau97, 15700 author = {Lloyd N. Trefethen and David {Bau, III}}, 15701 title = {Numerical Linear Algebra}, 15702 publisher = {Society for Industrial and Applied Mathematics}, 15703 address = {Philadelphia, PA}, 15704 pages = {xii + 361}, 15705 year = {1997}, 15706 isbn = {0-89871-361-7}, 15707 isbn-13 = {978-0-89871-361-9}, 15708 lccn = {QA184 .T74 1997}, 15709 mrclass = {65-01 (65-02 65Fxx)}, 15710 mrnumber = {MR1444820 (98k:65002)}, 15711 mrreviewer = {Moody T. Chu}, 15712 bibdate = {Wed Jan 07 15:23:19 1998}, 15713 bibsource = {ftp://ftp.math.utah.edu/pub/bibnet/authors/t/trefethen-lloyd-n.bib} 15714} 15715 15716@Article{ liptonreagan2014, 15717 title = {Quantum Algorithms via Linear Algebra: A Primer}, 15718 author = {Richard J Lipton and Kenneth W Regan}, 15719 pages = {206}, 15720 isbn = {978-0-26202-839-4}, 15721 year = {2014} 15722} 15723 15724@InProceedings{ rhea08, 15725 author = {Carsten Burstedde and Omar Ghattas and Michael Gurnis and Georg Stadler and Eh 15726 Tan and T.~Tu and Lucas~C. Wilcox and Shijie Zhong}, 15727 title = {Scalable adaptive mantle convection simulation on petascale supercomputers}, 15728 booktitle = {Proceedings of IEEE/ACM SC '08}, 15729 year = {2008} 15730} 15731 15732@Misc{ bursteddewilcox09, 15733 author = {Carsten Burstedde and Lucas~C. Wilcox}, 15734 title = {The p4est library: A parallel scalable forest of adaptive octrees}, 15735 note = {in preparation} 15736} 15737 15738@Article{ skeeltezcanhardy02, 15739 author = {R. D. Skeel and I. Tezcan and D. J. Hardy}, 15740 title = {Multiple Grid Methods for Classical Molecular Dynamics}, 15741 journal = {J. Comp. Chem.}, 15742 volume = {23}, 15743 pages = {673--684}, 15744 year = {2002} 15745} 15746 15747@Article{ verschelde99, 15748 author = {Jan Verschelde}, 15749 title = {Algorithm 795: PHCpack: a general-purpose solver for polynomial systems by 15750 homotopy continuation}, 15751 journal = {ACM Trans. Math. Softw.}, 15752 volume = {25}, 15753 number = {2}, 15754 issn = {0098-3500}, 15755 pages = {251--276}, 15756 doi = {10.1145/317275.317286}, 15757 publisher = {ACM}, 15758 address = {New York, NY}, 15759 year = {1999} 15760} 15761 15762@InProceedings{ sommeseverscheldewampler08, 15763 author = {Andrew J. Sommese and Jan Verschelde and Charles W. Wampler}, 15764 title = {Solving Polynomial Systems Equation by Equation}, 15765 booktitle = {IMA Volume 146: Algorithms in Algebraic Geometry}, 15766 editor = {Alicia Dickenstein and Frank-Olaf Schreyer and Andrew J. Sommese}, 15767 pages = {133--152}, 15768 publisher = {Springer-Verlag}, 15769 year = {2008} 15770} 15771 15772@Article{ phanthientanner77, 15773 author = {N. Phan-Thien and R.~I. Tanner}, 15774 title = {A new constitutive equation derived from network theory}, 15775 journal = {J. Non-Newt. Fluid Mech.}, 15776 volume = {2}, 15777 pages = {353}, 15778 year = {1977} 15779} 15780 15781@Manual{ sage, 15782 key = {SAGE}, 15783 author = {W.\thinspace{}A. Stein and others}, 15784 organization = {The Sage~Development Team}, 15785 title = {{S}age {M}athematics {S}oftware ({V}ersion 3.3)}, 15786 note = {{\tt http://www.sagemath.org}}, 15787 year = {2009} 15788} 15789 15790@Misc{ bateshauensteinsommesewampler06, 15791 author = {Daniel J. Bates and Jonathan D. Hauenstein and Andrew J. Sommese and Charles W. 15792 Wampler}, 15793 title = {{B}ertini: {S}oftware for {N}umerical {A}lgebraic {G}eometry}, 15794 howpublished = {Available at http://www.nd.edu/$\sim$sommese/bertini} 15795} 15796 15797@Article{ archer09, 15798 author = {A. J. Archer}, 15799 collaboration = {}, 15800 title = {Dynamical density functional theory for molecular and colloidal fluids: A 15801 microscopic approach to fluid mechanics}, 15802 publisher = {AIP}, 15803 year = {2009}, 15804 journal = {The Journal of Chemical Physics}, 15805 volume = {130}, 15806 number = {1}, 15807 eid = {014509}, 15808 numpages = {8}, 15809 pages = {014509}, 15810 keywords = {colloids; continuum mechanics; density functional theory; free energy; glass 15811 transition; statistical distributions; stochastic processes}, 15812 doi = {10.1063/1.3054633} 15813} 15814 15815@Article{ giesekus1966, 15816 author = {Hanswalter Giesekus}, 15817 title = {Die Elastizit\"at von Fl\"ussigkeiten}, 15818 journal = {Rheologica Acta}, 15819 publisher = {Springer Berlin / Heidelberg}, 15820 volume = {5}, 15821 number = {1}, 15822 month = mar, 15823 year = {1966}, 15824 doi = {10.1007/BF01973575}, 15825 pages = {29-35} 15826} 15827 15828@Article{ baaijens98, 15829 author = {F.P. Baaijens}, 15830 title = {Mixed finite element methods for viscoelastic flow analysis: a review}, 15831 journal = {Journal of Non-Newtonian Fluid Mechanics}, 15832 volume = {79}, 15833 year = {1998}, 15834 pages = {361--385} 15835} 15836 15837@Book{ joseph90, 15838 author = {D.~D. Joseph}, 15839 title = {Fluid Dynamics of Viscoelastic Liquids}, 15840 publisher = {Springer}, 15841 address = {New York, NY}, 15842 year = {1990} 15843} 15844 15845@Article{ oldroyd50, 15846 author = {J.~G. Oldroyd}, 15847 title = {On the Formulation of Rheological Equations of State}, 15848 journal = {Proceedings of the Royal Society of London. Series A, Mathematical and Physical 15849 Sciences}, 15850 volume = {200}, 15851 year = {1950}, 15852 pages = {523--541} 15853} 15854 15855@InProceedings{ bynasungroppthakur04, 15856 author = {S. Byna and X.-H. Sun and W. Gropp and R. Thakur}, 15857 title = {Predicting Memory-Access Cost Based on Data-Access Patterns}, 15858 booktitle = {Proceedings of IEEE International Conference on Cluster Computing, San Diego}, 15859 year = {2004} 15860} 15861 15862@Book{ pozrikidis07, 15863 author = {C. Pozrikidis}, 15864 title = {Fluid Dynamics: Theory, Computation, and Numerical Simulation}, 15865 publisher = {Kluwer (Springer)}, 15866 pages = {675}, 15867 year = {2001}, 15868 isbn = {0792373510} 15869} 15870 15871@Misc{ kritzkeyesfsp07, 15872 author = {A. Kritz and D. Keyes}, 15873 title = {{Fusion Simulation Project Workshop Report}}, 15874 month = jul, 15875 year = {2007}, 15876 note = {Available via 15877 \url{http://www.sc.doe.gov/ofes/More_HTML/FESAC/FESAC07/FSP_report_070702d.pdf}} 15878} 15879 15880@Misc{ dahlburg02, 15881 author = {J. {Dahlburg (Chair)}}, 15882 title = {{Final Report of the FESAC ISOFS SubCommittee}}, 15883 year = {2002}, 15884 note = {Available via 15885 \url{http://www.ofes.fusion.doe.gov/More_HTML/FESAC/FESAC11-02/Dahlburg.pdf}} 15886} 15887 15888@Misc{ brown08, 15889 author = {D. {Brown (Chair)}}, 15890 title = {{Applied Mathematics at the U.S. Department of Energy: Past, Present, and a View 15891 to the Future}}, 15892 year = {2008}, 15893 howpublished = {Office of Science, U.S. Department of Energy}, 15894 url = {http://science.energy.gov/~/media/ascr/pdf/program-documents/docs/Brown_report_may_08.pdf} 15895} 15896 15897@Misc{ crosscutting10, 15898 author = {D. Brown and P. {Messina (Chairs)}}, 15899 title = {{Scientific Grand Challenges: Crosscutting Technologies for Computing at the 15900 Exascale}}, 15901 year = {2010}, 15902 howpublished = {Office of Science, U.S. Department of Energy}, 15903 url = {http://extremecomputing.labworks.org/SumReps/Crosscutting-SumRep-PNNL_20168.pdf} 15904} 15905 15906@Misc{ extreme-scale-solvers-workshop12, 15907 author = {J. Ang and K. Evans and A. Geist and M. Heroux and P. Hovland and O. Marques and 15908 L.C. McInnes and E. Ng and S. Wild}, 15909 title = {Report on the Workshop on Extreme-Scale Solvers: Transitions to Future 15910 Architectures}, 15911 howpublished = {Office of Advanced Scientific Computing Research, U.S. Department of Energy}, 15912 note = {{Washington, DC}, March 8-9, 2012}, 15913 url = {http://science.energy.gov/~/media/ascr/pdf/program-documents/docs/reportExtremeScaleSolvers2012.pdf}, 15914 year = {2012} 15915} 15916 15917@Misc{ monizrosner09, 15918 author = {{E. Moniz and R. Rosner}}, 15919 title = {{Workshop on Science Based Nuclear Energy Systems Enabled by Advanced Modeling 15920 and Simulation at the Extreme Scale}}, 15921 month = may, 15922 year = {2009}, 15923 note = {See 15924 \url{http://extremecomputing.labworks.org/crosscut/references/nuclearenergy10exascael.pdf}} 15925} 15926 15927@Misc{ blanford08, 15928 author = {{R. Blandord (Chair)}}, 15929 title = {{Workshop on Challenges for Understanding the Quantum Universe and the Role of 15930 Computing at the Extreme Scale}}, 15931 month = dec, 15932 year = {2008}, 15933 note = {See 15934 \url{http://extremecomputing.labworks.org/crosscut/references/HEPreport10exascale.pdf}} 15935} 15936 15937@Misc{ exascale07, 15938 author = {H. Simon and T. Zacharia and R. Stevens}, 15939 title = {{Modeling and Simulation at the Exascale for Energy and the Environment}}, 15940 year = {2007}, 15941 note = {See \url{http://www.sc.doe.gov/ascr/ProgramDocuments/Docs/TownHall.pdf}} 15942} 15943 15944@Misc{ ascrbreakthroughs08, 15945 author = {{Panel on Recent Significant Advancements in Computational Science}}, 15946 title = {Breakthroughs}, 15947 year = {2008}, 15948 note = {See 15949 \url{http://www.er.doe.gov/ASCR/ProgramDocuments/Docs/Breakthroughs_2008.pdf}} 15950} 15951 15952@Misc{ petsc-rd100-2009, 15953 author = {{R\&D Magazine}}, 15954 title = {{PETSc} {R}\&{D} 100 Award}, 15955 year = {2009}, 15956 note = {See 15957 \url{http://www.rdmag.com/Awards/RD-100-Awards/2009/07/PETSc-Release-3-0-Expands-Capabilities}} 15958} 15959 15960@Article{ compass-scidac08, 15961 author = {P. Spentzouris and J. Cary and L. C. McInnes and W. Mori and C. Ng and E. Ng and 15962 R. Ryne}, 15963 title = {Community Petascale Project for Accelerator Science and Simulation: Advancing 15964 Computational Science for Future Accelerators and Accelerator Technologies}, 15965 journal = {J. Phys.: Conf. Ser.}, 15966 volume = {125}, 15967 year = {2008}, 15968 pages = {012001}, 15969 url = {http://iopscience.iop.org/1742-6596/125/1/012001} 15970} 15971 15972@Article{ compass-amundson-scidac08, 15973 title = {Multiscale, Multiphysics Beam Dynamics Framework Design and Applications}, 15974 author = {J. Amundson and D. Dechow and L. McInnes and B. Norris and P. Spentzouris and P. 15975 Stoltz}, 15976 journal = {J. Phys.: Conf. Ser.}, 15977 volume = {125}, 15978 year = {2008} 15979} 15980 15981@InProceedings{ muszala09, 15982 title = {Two-tiered Component Design and Performance Analysis of {Synergia2} Accelerator 15983 Simulations}, 15984 author = {S. Muszala and J. Amundson and L. C. McInnes and B. Norris}, 15985 booktitle = {Proceedings of the 2009 Workshop on Component-Based High Performance Computing 15986 {(CBHPC 2009)}}, 15987 year = {2009} 15988} 15989 15990@Article{ gaston09, 15991 title = {{MOOSE}: A Parallel Computational Framework for Coupled Systems of Nonlinear 15992 Equations}, 15993 author = {Derek Gaston and Chris Newman and Glen Hansen and Damien Lebrun-Grandie}, 15994 journal = {Nuclear Engineering and Design}, 15995 volume = {239}, 15996 number = {10}, 15997 year = {2009}, 15998 pages = {1768 -- 1778} 15999} 16000 16001@Article{ gaston09b, 16002 title = {Parallel Multiphysics Algorithms and Software for Computational Nuclear 16003 Engineering}, 16004 author = {D. Gaston and G. Hansen and S. Kadioglu and D. Knoll and C. Newman and H. Park 16005 and C. Permann and W. Taitano}, 16006 journal = {J. Phys.: Conf. Ser.}, 16007 volume = {180}, 16008 year = {2009}, 16009 pages = {012012} 16010} 16011 16012@Article{ newman09, 16013 title = {Three Dimensional Coupled Simulation of Thermomechanics, Heat, and Oxygen 16014 Diffusion in {UO$_2$} Nuclear Fuel Rods}, 16015 author = {Chris Newman and Glen Hansen and Derek Gaston}, 16016 journal = {Journal of Nuclear Materials}, 16017 volume = {392}, 16018 issue = {1}, 16019 year = {2009}, 16020 pages = {6 -- 15} 16021} 16022 16023@Misc{ www:fenics, 16024 author = {{FE}ni{CS}}, 16025 title = {{FE}ni{CS} Project}, 16026 howpublished = {\url{http://www.fenics.org/}}, 16027 year = {2018} 16028} 16029 16030@InProceedings{ zwart08, 16031 title = {A Multiphysics and Multiscale Software Environment for Modeling Astrophysical 16032 Systems}, 16033 author = {S. Zwart and S. McMillan and B. Nuallain and D. Heggie and J. Lombarsi and P. Hut 16034 and S. Banerjee and H. Belkus and T. Fragos and J. Fregeau and M. Fuji and E. 16035 Gaburov and E. Glebbeek and D. Groen and S. Harfst and R. Izzard and J. Juric and 16036 S. Justham and P. Teuben and J. van Bever and O. Yaron and M. Zemp}, 16037 booktitle = {Proceedings of ICCS 2008}, 16038 year = {2008} 16039} 16040 16041@Article{ klocknerwarburtonbridgehesthaven09, 16042 author = {Kl\"{o}ckner, A. and Warburton, T. and Bridge, J. and Hesthaven, J. S.}, 16043 title = {Nodal discontinuous {G}alerkin methods on graphics processors}, 16044 journal = {J. Comput. Phys.}, 16045 volume = {228}, 16046 number = {21}, 16047 year = {2009}, 16048 issn = {0021-9991}, 16049 pages = {7863--7882}, 16050 doi = {10.1016/j.jcp.2009.06.041}, 16051 publisher = {Academic Press Professional}, 16052 address = {San Diego, CA} 16053} 16054 16055@PhDThesis{ rankin99, 16056 author = {Rankin, W. T.}, 16057 keywords = {FMM, parallel FMM}, 16058 school = {Department of Electrical and Computer Engineering, Duke University}, 16059 title = {Efficient parallel implementations of multipole-based {$N$}-body algorithms}, 16060 year = {1999} 16061} 16062 16063@InProceedings{ warrensalmon93, 16064 abstract = {We report on an efficient adaptive N-body method which we have recently designed 16065 and implemented. The algorithm computes the forces on an arbitrary distribution of 16066 bodies in a time which scales as N log N with the particle number. The accuracy of 16067 the force calculations is analytically bounded, and can be adjusted via a user 16068 defined parameter between a few percent relative accuracy, down to machine 16069 arithmetic accuracy. Instead of using pointers to indicate the topology of the 16070 tree, we identify...}, 16071 address = {New York}, 16072 author = {Warren, Michael S. and Salmon, John K.}, 16073 booktitle = {Proceedings of the 1993 ACM/IEEE Conference on Supercomputing}, 16074 citeulike-article-id={580952}, 16075 keywords = {oct-tree}, 16076 pages = {12--21}, 16077 publisher = {ACM}, 16078 title = {A parallel hashed Oct-Tree {N}-body algorithm}, 16079 year = {1993}, 16080 doi = {10.1145/169627.169640}, 16081 url = {http://citeseerx.ist.psu.edu/viewdoc/summary?doi=10.1.1.50.100} 16082} 16083 16084@Unpublished{ cruzwccm10, 16085 author = {Felipe A. Cruz}, 16086 title = {Heterogeneous extension of the PetFMM a Fast Multipole Library}, 16087 note = {Presentation at WCCM 2010, Sydney Australia}, 16088 year = {2010} 16089} 16090 16091@Article{ mcguffee06, 16092 author = {S.~R. {McGuffee} and A.~H. Elcock}, 16093 title = {Atomistically detailed simulations of concentrated protein solutions: the effects 16094 of salt, {pH}, point mutations, and protein concentration in simulations of 16095 1000-molecule systems}, 16096 journal = {Journal of the American Chemical Society}, 16097 volume = {128}, 16098 pages = {12098--12110}, 16099 year = {2006} 16100} 16101 16102@Article{ nilsencaihoylandlangtangen10, 16103 author = {{Nilsen}, J.~K. and {Cai}, X. and {Hoyland}, B. and {Petter Langtangen}, H.}, 16104 title = {{Simplifying Parallelization of Scientific Codes by a Function-Centric Approach 16105 in Python}}, 16106 journal = {ArXiv e-prints}, 16107 archiveprefix = {arXiv}, 16108 eprint = {1002.0705}, 16109 primaryclass = {cs.DC}, 16110 keywords = {Computer Science - Distributed, Parallel, and Cluster Computing, Computer Science 16111 - Programming Languages}, 16112 year = {2010}, 16113 month = feb, 16114 adsurl = {http://adsabs.harvard.edu/abs/2010arXiv1002.0705N}, 16115 adsnote = {Provided by the SAO/NASA Astrophysics Data System} 16116} 16117 16118@Misc{ mcinnes:siam09:minisymposium, 16119 title = {Implicit Nonlinear Solvers in Multimodel Simulations}, 16120 author = {L. C. McInnes and C. {Woodward (co-organizers)}}, 16121 note = {invited minisymposium session at the SIAM Annual Meeting, July 9-10, 2009, 16122 Denver, CO, speakers were: C. Woodward (LLNL), E. Myra (Univ. of Michigan), J. 16123 White (Stanford Univ.), A. Barker (Univ. of Colorado, Boulder), L. Wilcox (Univ. 16124 of Texas at Austin), R. Mills (ORNL), B. F. Smith (ANL), J. Shadid (SNL), D. Knoll 16125 (INL), G. Hansen (INL), J. Cary (Tech-X Corp.), T. Wildey (Univ. of Texas at 16126 Austin).} 16127} 16128 16129@Misc{ mcinnes:fsp-summary:feb2011, 16130 author = {Lois Curfman McInnes and Luis Chacon and John Shadid}, 16131 title = {Solvers and Time Integration Breakout Summary}, 16132 note = {FSP Planning Workshop, General Atomics, Feb 8-11, 2011, see 16133 \url{https://ice.txcorp.com/trac/2011_FspDefinitionWorkshop}} 16134} 16135 16136@Misc{ dvi-materials:siamcse11, 16137 title = {Progress in Large-Scale Differential Variational Inequalities for Heterogeneous 16138 Materials}, 16139 author = {M. Anitescu and A. El-Azab and J. Lee and L. C. McInnes and T. Munson and B. F. 16140 Smith and L. Wang}, 16141 note = {minisymposium presentation at the 2011 SIAM Conference on Computational Science 16142 and Engineering, March 3, 2011} 16143} 16144 16145@Misc{ jamroz:cemm10, 16146 title = {{JFNK} within the semi-implicit scheme in {NIMROD}}, 16147 author = {B. Jamroz and S. Kruger and T. Austin}, 16148 note = {presentation, CEMM Meeting, Chicago, IL, Nov 7, 2010} 16149} 16150 16151@Misc{ kruger:feb4-2011, 16152 title = {personal communication}, 16153 author = {S. Kruger}, 16154 note = {February, 2011} 16155} 16156 16157@Article{ elman1996, 16158 author = {H.C. Elman}, 16159 title = {Preconditioning for the steady-state {Navier-Stokes} equations for low 16160 viscosity}, 16161 journal = {SIAM J. Sci. Comput.}, 16162 volume = {20}, 16163 year = {1996}, 16164 pages = {1299--1316} 16165} 16166 16167@Article{ kayloghinwathen2002, 16168 author = {D. Kay and D. Loghin and A. Wathen}, 16169 title = {A preconditioning for the steady-state {Navier-Stokes} equations}, 16170 journal = {SIAM J. Sci. Comput.}, 16171 volume = {24}, 16172 year = {2002}, 16173 pages = {237--256} 16174} 16175 16176@Article{ elmanhowleshadidshuttleworthtuminaro2006, 16177 author = {H.C. Elman and V.E. Howle and J. Shadid and R. Shuttleworth and R. Tuminaro}, 16178 title = {Block preconditioners based on approximate commutators}, 16179 journal = {SIAM J. Sci. Comput.}, 16180 volume = {27}, 16181 number = {5}, 16182 year = {2006}, 16183 pages = {1651--1668} 16184} 16185 16186@Article{ braesssarazin1997, 16187 author = {Dietrich Braess and Regina Sarazin}, 16188 title = {An efficient smoother for the {Stokes} problem}, 16189 journal = {Applied Numerical Mathematics}, 16190 volume = {23}, 16191 number = {1}, 16192 year = {1997}, 16193 pages = {3--19}, 16194 doi = {10.1016/S0168-9274(96)00059-1} 16195} 16196 16197@Article{ wright2001large, 16198 title = {Large-Scale Computation of Pseudospectra Using {ARPACK} and \texttt{eigs}}, 16199 author = {Wright, T.G. and Trefethen, L.N.}, 16200 journal = {SIAM Journal on Scientific Computing}, 16201 volume = {23}, 16202 pages = {591}, 16203 year = {2001} 16204} 16205 16206@Misc{ wright2002eigtool, 16207 title = {Eig{T}ool}, 16208 author = {Wright, T.G. and Trefethen, LN}, 16209 howpublished = {Software available at \url{http://www.comlab.ox.ac.uk/pseudospectra/eigtool}}, 16210 year = {2002} 16211} 16212 16213@Misc{ visit-web-site, 16214 key = {{VisIt}}, 16215 title = {{VisIt web site}}, 16216 howpublished = {\url{http://wci.llnl.gov/codes/visit/}}, 16217 url = {http://wci.llnl.gov/codes/visit/}, 16218 year = {2011} 16219} 16220 16221@Book{ trefethen1996, 16222 title = {Finite difference and spectral methods for ordinary and partial differential 16223 equations}, 16224 author = {Lloyd Nicholas Trefethen}, 16225 year = {1996}, 16226 publisher = {Cornell University-Department of Computer Science and Center for Applied 16227 Mathematics} 16228} 16229 16230@Book{ trefethen2005spectra, 16231 title = {Spectra and pseudospectra: the behavior of nonnormal matrices and operators}, 16232 author = {Trefethen, L.N. and Embree, M.}, 16233 year = {2005}, 16234 publisher = {Princeton University Press} 16235} 16236 16237@Article{ gomez2010isogeometric, 16238 title = {Isogeometric analysis of the isothermal {N}avier-{S}tokes-{K}orteweg equations}, 16239 author = {Gomez, H. and Hughes, T.J.R. and Nogueira, X. and Calo, V.M.}, 16240 journal = {Computer Methods in Applied Mechanics and Engineering}, 16241 volume = {199}, 16242 number = {25-28}, 16243 pages = {1828--1840}, 16244 issn = {0045-7825}, 16245 year = {2010}, 16246 publisher = {Elsevier} 16247} 16248 16249@Article{ gomez2008isogeometric, 16250 title = {Isogeometric analysis of the {C}ahn-{H}illiard phase-field model}, 16251 author = {G{\'o}mez, H. and Calo, V.M. and Bazilevs, Y. and Hughes, T.J.R.}, 16252 journal = {Computer Methods in Applied Mechanics and Engineering}, 16253 volume = {197}, 16254 number = {49-50}, 16255 pages = {4333--4352}, 16256 year = {2008}, 16257 publisher = {Elsevier} 16258} 16259 16260@Misc{ fastmath:project, 16261 author = {Lori {Diachin (PI)}}, 16262 title = {{SciDAC Frameworks, Algorithms, and Scalable Technologies for Mathematics 16263 (FASTMath) Institute}}, 16264 howpublished = {\url{https://fastmath-scidac.llnl.gov}} 16265} 16266 16267@Misc{ exascale-software:proposal, 16268 author = {Peter {Beckman (PI)}}, 16269 title = {{Exascale Software Center}}, 16270 note = {proposal to DOE} 16271} 16272 16273@Misc{ imex:project, 16274 author = {Barry {Smith (PI)}}, 16275 title = {{Scalable Implicit-Explicit (IMEX) Algorithms and Software for Time-Dependent 16276 Multimodel PDEs}}, 16277 note = {DOE ASCR applied math project} 16278} 16279 16280@Misc{ intel-mic:website, 16281 author = {Intel}, 16282 title = {{Many Integrated Core Architecture}}, 16283 note = {\url{http://www.intel.com/technology/architecture-silicon/mic}} 16284} 16285 16286@Article{ dudson:2009, 16287 author = {B.D. Dudson and M.V. Umansky and X.Q. Xu and P.B. Snyder and H.R. Wilson}, 16288 title = {{{BOUT++:}} a framework for parallel plasma fluid simulations}, 16289 journal = {Computer Physics Communications}, 16290 volume = {180}, 16291 pages = {1467}, 16292 year = {2009} 16293} 16294 16295@Article{ umansky:2009, 16296 author = {M.V. Umansky and X.Q. Xu and B. Dudson and L.L. LoDestro and J.R. Myra}, 16297 title = {{Status and verification of edge plasma turbulence code BOUT}}, 16298 journal = {Computer Physics Communications}, 16299 year = {2009}, 16300 volume = {180}, 16301 pages = {887-903} 16302} 16303 16304@Article{ xu:1998, 16305 author = {X.Q. Xu and R.H. Cohen}, 16306 title = {{Scrape-Off Layer Turbulence Theory and Simulations}}, 16307 journal = {Computer Physics Communications}, 16308 year = {1998}, 16309 volume = {36}, 16310 number = {1-2}, 16311 pages = {158} 16312} 16313 16314@Article{ tron:1999, 16315 title = {Newton's Method for Large Bound-constrained Optimization Problems}, 16316 author = {Chih-Jen Lin and Jorge Mor\'{e}}, 16317 journal = {SIAM Journal on Optimization}, 16318 volume = {9}, 16319 number = {4}, 16320 pages = {1100-1127}, 16321 year = {1999} 16322} 16323 16324@Article{ stubenamg, 16325 author = {K. St\"{u}ben}, 16326 title = {A review of algebraic multigrid}, 16327 journal = {J. Comput. Appl. Math.}, 16328 volume = {128}, 16329 number = {1-2}, 16330 year = {2001}, 16331 issn = {0377-0427}, 16332 pages = {281--309}, 16333 doi = {10.1016/S0377-0427(00)00516-1}, 16334 publisher = {Elsevier Science Publishers B. V.}, 16335 address = {Amsterdam, The Netherlands, The Netherlands} 16336} 16337 16338@Article{ feuchtermg, 16339 author = {D. Feuchter and I. Heppner and S. Sauter and G. Wittum}, 16340 title = {Bridging the gap between geometric and algebraic multigrid methods}, 16341 journal = {Computing and visualization in science}, 16342 publisher = {Springer}, 16343 volume = {6}, 16344 number = {1}, 16345 year = {2003}, 16346 pages = {1--13} 16347} 16348 16349@Article{ chowmgsmoothness, 16350 abstract = {For non-M-matrices, this paper proposes an unstructured multigrid method that 16351 only attempts to interpolate in the directions of geometrical smoothness. These 16352 directions are determined by analyzing samples of algebraically smooth error, e. 16353 Neighboring grid points i and j are called smoothly coupled if e i and e j are 16354 consistently nearby in value. In addition, these dierences may be used to dene 16355 interpolation weights. These new ideas may be incorporated into the algebraic 16356 multigrid method. Test results show that the new method can have much lower grid 16357 and operator complexities compared to AMG, leading to lower solve timings. 1 }, 16358 author = {Chow, Edmond}, 16359 citeulike-article-id={7675372}, 16360 citeulike-linkout-0={http://citeseerx.ist.psu.edu/viewdoc/summary?doi=10.1.1.22.4305}, 16361 journal = {American Journal of Mathematics}, 16362 keywords = {fem, multigrid}, 16363 pages = {197--215}, 16364 posted-at = {2010-08-17 23:29:51}, 16365 priority = {2}, 16366 title = {An Unstructured Multigrid Method Based on Geometric Smoothness}, 16367 url = {http://citeseerx.ist.psu.edu/viewdoc/summary?doi=10.1.1.22.4305}, 16368 volume = {65}, 16369 year = {2001} 16370} 16371 16372@Article{ jonesamge, 16373 abstract = {{This paper contains the main ideas for an AMGe (algebraic multigrid for finite 16374 elements) method based on element agglomeration. In the method, coarse grid 16375 elements are formed by agglomerating fine grid elements. Compatible interpolation 16376 operators are constructed which yield coarse grid basis functions with a minimal 16377 energy property. Heuristics based on interpolation quality measures are used to 16378 guide the agglomeration procedure. The performance of the resulting method is 16379 demonstrated in two-level numerical experiments.}}, 16380 author = {Jones, Jim E. and Vassilevski, Panayot S.}, 16381 citeulike-article-id={8598569}, 16382 citeulike-linkout-0={http://scitation.aip.org/getabs/servlet/GetabsServlet?prog=normal&id=SJOCE3000023000001000109000001&idtype=cvips&gifs=yes}, 16383 citeulike-linkout-1={http://link.aip.org/link/?SCE/23/109}, 16384 journal = {SIAM Journal on Scientific Computing}, 16385 keywords = {amg, fem, multigrid}, 16386 number = {1}, 16387 pages = {109--133}, 16388 posted-at = {2011-01-13 18:05:55}, 16389 priority = {2}, 16390 publisher = {SIAM}, 16391 title = {{AMGE Based on Element Agglomeration}}, 16392 url = {http://scitation.aip.org/getabs/servlet/GetabsServlet?prog=normal&id=SJOCE3000023000001000109000001&idtype=cvips&gifs=yes}, 16393 volume = {23}, 16394 year = {2001} 16395} 16396 16397@Article{ saad1993, 16398 author = {Saad, Youcef}, 16399 doi = {10.1137/0914028}, 16400 issn = {10648275}, 16401 journal = {SIAM Journal on Scientific Computing}, 16402 keywords = {65f10,ams,especially since the popularization,gate gradient,general purpose 16403 iterative methods,gmres,krylov subspace methods,mos,non-hermitian systems,of 16404 precondition-,preconditioned conju-,subject classi cations,variable 16405 preconditioners}, 16406 number = {2}, 16407 pages = {461--469}, 16408 title = {{A flexible inner-outer preconditioned GMRES algorithm}}, 16409 volume = {14}, 16410 year = {1993} 16411} 16412 16413@Misc{ path:homepage, 16414 author = {S. Dirkse and M. Ferris and T. Munson}, 16415 title = {{{PATH} {W}eb page}}, 16416 howpublished = {\url{http://pages.cs.wisc.edu/~ferris/path.html}} 16417} 16418 16419@Article{ ketcheson2008, 16420 author = {David I Ketcheson}, 16421 title = {Highly Efficient Strong Stability Preserving {Runge-Kutta} Methods with 16422 Low-Storage Implementations}, 16423 volume = {30}, 16424 journal = {SIAM Journal on Scientific Computing}, 16425 year = {2008}, 16426 pages = {2113--2136} 16427} 16428 16429@Article{ elman2009boundary, 16430 title = {{Boundary conditions in approximate commutator preconditioners for the 16431 Navier-Stokes equations}}, 16432 author = {Elman, H.C. and Tuminaro, R.}, 16433 journal = {Electronic Transactions on Numerical Analysis}, 16434 volume = {35}, 16435 pages = {257--280}, 16436 year = {2009} 16437} 16438 16439@Article{ elman2008tcp, 16440 title = {{A taxonomy and comparison of parallel block multi-level preconditioners for the 16441 incompressible Navier-Stokes equations}}, 16442 author = {Elman, H.C. and Howle, V.E. and Shadid, J. and Shuttleworth, R. and Tuminaro, 16443 R.}, 16444 journal = {Journal of Computational Physics}, 16445 volume = {227}, 16446 number = {1}, 16447 pages = {1790--1808}, 16448 year = {2008}, 16449 publisher = {Academic Press}, 16450 url = {http://chess.cs.umd.edu/~elman/papers/tax.pdf} 16451} 16452 16453@Article{ arioli2013, 16454 title = {Generalized {G}olub--{K}ahan bidiagonalization and stopping criteria}, 16455 author = {Arioli, Mario}, 16456 journal = {SIAM Journal on Matrix Analysis and Applications}, 16457 volume = {34}, 16458 number = {2}, 16459 pages = {571--592}, 16460 year = {2013}, 16461 publisher = {SIAM} 16462} 16463 16464@Book{ wesseling2009, 16465 title = {Principles of computational fluid dynamics}, 16466 author = {Wesseling, Pieter}, 16467 volume = {29}, 16468 year = {2009}, 16469 publisher = {Springer Science \& Business Media} 16470} 16471 16472@Article{ silvester2001efficient, 16473 title = {{Efficient preconditioning of the linearized Navier-Stokes equations for 16474 incompressible flow}}, 16475 author = {Silvester, D. and Elman, H. and Kay, D. and Wathen, A.}, 16476 journal = {Journal of Computational and Applied Mathematics}, 16477 volume = {128}, 16478 number = {1-2}, 16479 pages = {261--279}, 16480 issn = {0377-0427}, 16481 year = {2001}, 16482 publisher = {Elsevier} 16483} 16484 16485@Article{ elman1999bfbt, 16486 title = {{Preconditioning for the steady-state Navier-Stokes equations with low 16487 viscosity}}, 16488 author = {Elman, H.C.}, 16489 journal = {SIAM Journal on Scientific Computing}, 16490 volume = {20}, 16491 number = {4}, 16492 pages = {1299--1316}, 16493 issn = {1064-8275}, 16494 year = {1999}, 16495 publisher = {Citeseer} 16496} 16497 16498@Article{ elman2006bpb, 16499 title = {{Block preconditioners based on approximate commutators}}, 16500 author = {Elman, H. and Howle, V.E. and Shadid, J. and Shuttleworth, R. and Tuminaro, R.}, 16501 journal = {SIAM Journal on Scientific Computing}, 16502 volume = {27}, 16503 number = {5}, 16504 pages = {1651--1668}, 16505 year = {2006}, 16506 publisher = {Philadelphia, PA: SIAM, c1993-} 16507} 16508 16509@Article{ olshanskii2006analysis, 16510 title = {{Analysis of a Stokes interface problem}}, 16511 author = {Olshanskii, M.A. and Reusken, A.}, 16512 journal = {Numerische Mathematik}, 16513 volume = {103}, 16514 number = {1}, 16515 pages = {129--149}, 16516 issn = {0029-599X}, 16517 year = {2006}, 16518 publisher = {Springer} 16519} 16520 16521@Article{ patankar1972cph, 16522 title = {{A calculation procedure for heat, mass and momentum transfer in 16523 three-dimensional parabolic flows}}, 16524 author = {Patankar, S.V. and Spalding, D.B.}, 16525 journal = {Int. J. Heat Mass Transfer}, 16526 volume = {15}, 16527 pages = {1787--1806}, 16528 year = {1972} 16529} 16530 16531@Article{ rannacher1992simple, 16532 title = {{Simple nonconforming quadrilateral Stokes element}}, 16533 author = {Rannacher, R. and Turek, S.}, 16534 journal = {Numerical Methods for Partial Differential Equations}, 16535 volume = {8}, 16536 number = {2}, 16537 pages = {97--111}, 16538 issn = {1098-2426}, 16539 year = {1992}, 16540 publisher = {Wiley Online Library} 16541} 16542 16543@Article{ rannacher2000finite, 16544 title = {Finite Element Methods for the Incompressible {N}avier-{S}tokes Equations}, 16545 author = {Rannacher, R.}, 16546 journal = {Fundamental Directions in Mathematical Fluid Mechanics}, 16547 pages = {191}, 16548 isbn = {3764364149}, 16549 year = {2000}, 16550 publisher = {Birkhauser} 16551} 16552 16553@Article{ vanka1986block, 16554 title = {{Block-implicit multigrid solution of Navier-Stokes equations in primitive 16555 variables}}, 16556 author = {Vanka, S.P.}, 16557 journal = {Journal of Computational Physics}, 16558 volume = {65}, 16559 number = {1}, 16560 pages = {138--158}, 16561 issn = {0021-9991}, 16562 year = {1986}, 16563 publisher = {Elsevier} 16564} 16565 16566@Article{ eisenstat1983variational, 16567 title = {Variational iterative methods for nonsymmetric systems of linear equations}, 16568 author = {Eisenstat, S.C. and Elman, H.C. and Schultz, M.H.}, 16569 journal = {SIAM Journal on Numerical Analysis}, 16570 volume = {20}, 16571 number = {2}, 16572 pages = {345--357}, 16573 year = {1983}, 16574 publisher = {JSTOR} 16575} 16576 16577@InProceedings{ burstedde2008scalable, 16578 title = {Scalable adaptive mantle convection simulation on petascale supercomputers}, 16579 author = {Burstedde, C. and Ghattas, O. and Gurnis, M. and Stadler, G. and Tan, E. and Tu, 16580 T. and Wilcox, L.C. and Zhong, S.}, 16581 booktitle = {Proceedings of the 2008 ACM/IEEE conference on Supercomputing}, 16582 pages = {62}, 16583 year = {2008}, 16584 organization = {IEEE Press} 16585} 16586 16587@Article{ burstedde2009parallel, 16588 title = {Parallel scalable adjoint-based adaptive solution of variable-viscosity {Stokes} 16589 flow problems}, 16590 author = {Burstedde, C. and Ghattas, O. and Stadler, G. and Tu, T. and Wilcox, L.C.}, 16591 journal = {Computer Methods in Applied Mechanics and Engineering}, 16592 volume = {198}, 16593 number = {21-26}, 16594 pages = {1691--1700}, 16595 year = {2009}, 16596 publisher = {Elsevier} 16597} 16598 16599@Article{ stadler2010dynamics, 16600 title = {The dynamics of plate tectonics and mantle flow: From local to global scales}, 16601 author = {Stadler, G. and Gurnis, M. and Burstedde, C. and Wilcox, L.C. and Alisic, L. and 16602 Ghattas, O.}, 16603 journal = {Science}, 16604 volume = {329}, 16605 number = {5995}, 16606 pages = {1033}, 16607 year = {2010}, 16608 publisher = {American Association for the Advancement of Science} 16609} 16610 16611@Article{ tackley2008modelling, 16612 title = {Modelling compressible mantle convection with large viscosity contrasts in a 16613 three-dimensional spherical shell using the yin-yang grid}, 16614 author = {Tackley, P.J.}, 16615 journal = {Physics of the Earth and Planetary Interiors}, 16616 volume = {171}, 16617 number = {1-4}, 16618 pages = {7--18}, 16619 year = {2008}, 16620 publisher = {Elsevier} 16621} 16622 16623@Article{ moresizhonggurnis96, 16624 author = {Louis N. Moresi and Shijie Zhong and Michael Gurnis}, 16625 title = {The accuracy of finite element solutions of {S}tokes' flow with strongly varying 16626 viscosity}, 16627 journal = {Physics of the Earth and Planetary Interiors}, 16628 volume = {97}, 16629 pages = {83-–94}, 16630 year = {1996} 16631} 16632 16633@Article{ moresisolomatov95, 16634 author = {Louis N. Moresi and V. S. Solomatov}, 16635 title = {Numerical investigation of {2D} convection with extremely large viscosity 16636 variations}, 16637 journal = {Physics of Fluids}, 16638 volume = {7}, 16639 number = {9}, 16640 pages = {2154-–2162}, 16641 year = {1995} 16642} 16643 16644@Article{ chenmolnar83, 16645 author = {W.-P. Chen and P. Molnar}, 16646 title = {Focal depths of intra-continental and intraplate earthquakes and their 16647 implications for the thermal and mechanical properties of the lithosphere}, 16648 journal = {Journal of Geophysical Research}, 16649 volume = {88}, 16650 pages = {4183–-4214}, 16651 year = {1983} 16652} 16653 16654@Article{ jackson02, 16655 author = {J. Jackson}, 16656 title = {Strength of the continental lithosphere: time to abandon the jelly sandwich?}, 16657 journal = {GSA Today}, 16658 volume = {12}, 16659 pages = {4–-10}, 16660 year = {2002} 16661} 16662 16663@Article{ burovwatts06, 16664 author = {E.B. Burov and A.B. Watts}, 16665 title = {The long-term strength of continental lithosphere: jelly sandwich or creme 16666 brulee?}, 16667 journal = {GSA Today}, 16668 volume = {16}, 16669 pages = {4–-10}, 16670 year = {2006} 16671} 16672 16673@InProceedings{ yang:brent:2002, 16674 title = {The Improved {BiCGStab} Method for Large and Sparse Unsymmetric Linear Systems on 16675 Parallel Distributed Memory Architectures}, 16676 author = {Laurence T. Yang and Richard Brent}, 16677 booktitle = {Proceedings of the Fifth International Conference on Algorithms and Architectures 16678 for Parallel Processing}, 16679 year = {2002}, 16680 publisher = {IEEE} 16681} 16682 16683@Article{ demmel2008communication, 16684 title = {Communication-optimal parallel and sequential {QR} and {LU} factorizations}, 16685 author = {Demmel, J. and Grigori, L. and Hoemmen, M. and Langou, J.}, 16686 journal = {Arxiv preprint arXiv:0808.2664}, 16687 year = {2008} 16688} 16689 16690@Article{ demmel09, 16691 author = {J. Demmel and M. Hoemmen and M. Mohiyuddin and K Yelick}, 16692 title = {Communication-optimal Iterative Methods}, 16693 journal = {Journal of Physics: Conf. Series}, 16694 volume = {180}, 16695 year = {2009} 16696} 16697 16698@TechReport{ parms04, 16699 author = {Yousef Saad and Masha Sosonkina}, 16700 title = {{pARMS}: A package for the parallel iterative solution of general large sparse 16701 linear systems user's guide}, 16702 number = {UMSI2004-8}, 16703 institution = {Minnesota Supercomputer Institute, University of Minnesota}, 16704 year = {2004} 16705} 16706 16707@Article{ picard1890, 16708 author = {Emile Picard}, 16709 title = {M\'emoire sur la th\'eorie des \'equations aux d\'eriv\'ees partielles et la 16710 m\'ethode des approximations successives}, 16711 journal = {Journal De Math\'ematiques Pures et Appliqu\'ees}, 16712 volume = {4}, 16713 number = {6}, 16714 pages = {145--210}, 16715 year = {1890}, 16716 url = {http://math-doc.ujf-grenoble.fr/JMPA/PDF/JMPA_1890_4_6_A3_0.pdf} 16717} 16718 16719@Book{ rall1969, 16720 author = {Louis B. Rall}, 16721 title = {Computational solution of nonlinear operator equations}, 16722 publisher = {Krieger Pub Co.}, 16723 pages = {225}, 16724 year = {1969} 16725} 16726 16727@Article{ fletcherreeves1964, 16728 author = {R. Fletcher and C. M. Reeves}, 16729 title = {Function Minimization by Conjugate Gradients}, 16730 journal = {Computer Journal}, 16731 volume = {7}, 16732 pages = {149–-154}, 16733 year = {1964} 16734} 16735 16736@InBook{ mcinnesallanetal06, 16737 author = {Lois Curfman McInnes and Benjamin Allan and Robert Armstrong and Steven Benson 16738 and David Bernholdt and Tamara Dahlgren and Lori Diachin and Manojkumar Krishnan 16739 and James Kohl and Jay Larson and Sophia Lefantzi and Jarek Nieplocha and Boyana 16740 Norris and Steven Parker and Jaideep Ray and Shujia Zhou}, 16741 editor = {A.~M.~Bruaset and A.~Tveito}, 16742 title = {Numerical Solution of Partial Differential Equations on Parallel Computers}, 16743 chapter = {Parallel {PDE}-Based Simulations Using the {Common Component Architecture}}, 16744 publisher = {Springer}, 16745 year = {2006}, 16746 number = {51}, 16747 series = {Lecture Notes in Computational Science and Engineering}, 16748 pages = {327--381}, 16749 doi = {10.1016/S0167-8191(02)00191-6} 16750} 16751 16752@Article{ cyrshadidtuminaro12, 16753 title = {Stabilization and scalable block preconditioning for the {Navier–Stokes} 16754 equations}, 16755 journal = {Journal of Computational Physics}, 16756 volume = {231}, 16757 number = {2}, 16758 pages = {345 - 363}, 16759 year = {2012}, 16760 issn = {0021-9991}, 16761 doi = {10.1016/j.jcp.2011.09.001}, 16762 author = {Eric C. Cyr and John N. Shadid and Raymond S. Tuminaro} 16763} 16764 16765@Article{ keyesmcinneswoodwardetal13, 16766 title = {Multiphysics Simulations: Challenges and Opportunities}, 16767 author = {David E. Keyes and Lois Curfman McInnes and Carol Woodward and William Gropp and 16768 Eric Myra and Michael Pernice and John Bell and Jed Brown and Alain Clo and 16769 Jeffrey Connors and Emil Constantinescu and Don Estep and Kate Evans and Charbel 16770 Farhat and Ammar Hakim and Glenn Hammond and Glen Hansen and Judith Hill and Tobin 16771 Isaac and Xiangmin Jiao and Kirk Jordan and Dinesh Kaushik and Efthimios Kaxiras 16772 and Alice Koniges and Kihwan Lee and Aaron Lott and Qiming Lu and John Magerlein 16773 and Reed Maxwell and Michael McCourt and Miriam Mehl and Roger Pawlowski and 16774 Amanda Peters Randles and Daniel Reynolds and B\'{e}atrice Rivi\`{e}re and Ulrich 16775 R\"{u}de and Tim Scheibe and John Shadid and Brendan Sheehan and Mark Shephard and 16776 Andrew Siegel and Barry Smith and Xianzhu Tang and Cian Wilson and Barbara Wohlmuth}, 16777 journal = {International Journal of High Performance Computing Applications}, 16778 month = feb, 16779 year = {2013}, 16780 volume = {27}, 16781 number = {1}, 16782 pages = {4--83}, 16783 doi = {10.1177/1094342012468181}, 16784 note = {Special issue}, 16785 abstract = {We consider multiphysics applications from algorithmic and architectural 16786 perspectives, where ``algorithmic'' includes both mathematical analysis and 16787 computational complexity and ``architectural'' includes both software and hardware 16788 environments. Many diverse multiphysics applications can be reduced, en route to 16789 their computational simulation, to a common algebraic coupling paradigm. 16790 Mathematical analysis of multiphysics coupling in this form is not always 16791 practical for realistic applications, but model problems representative of 16792 applications discussed herein can provide insight. A variety of software 16793 frameworks for multiphysics applications have been constructed and refined within 16794 disciplinary communities and executed on leading-edge computer systems. We examine 16795 several of these, expose some commonalities among them, and attempt to extrapolate 16796 best practices to future systems. From our study, we summarize challenges and 16797 forecast opportunities.} 16798} 16799 16800@Misc{ rosner10, 16801 author = {Robert {Rosner (Chair)}}, 16802 title = {{The Opportunities and Challenges of Exascale Computing}}, 16803 year = {2010}, 16804 howpublished = {Office of Science, U.S. Department of Energy}, 16805 url = {http://science.energy.gov/~/media/ascr/ascac/pdf/reports/Exascale_subcommittee_report.pdf} 16806} 16807 16808@Misc{ kogge2008exascale, 16809 title = {ExaScale Computing Study: {T}echnology Challenges in achieving exascale systems}, 16810 author = {Peter Kogge and Keren Bergman and Shekhar Borkar and Dan Campbell and Willian 16811 Carlson and William Dally and Monty Denneau and Paul Franzon and William Harrod 16812 and Kerry Hill and Jon Hiller and Sherman Karp and Stephen Keckler and Dean Klein 16813 and Robert Lucas and Mark Richards and Al Scarpelly and Steven Scott and Allan 16814 Snavely and Themas Sterling and R. Stanley Williams and Katherine Yelick}, 16815 howpublished = {DARPA}, 16816 year = {2008}, 16817 url = {http://www.cse.nd.edu/Reports/2008/TR-2008-13.pdf} 16818} 16819 16820@Misc{ doegrandchallengeworkshops, 16821 key = {Office of Science, U.S. Department of Energy}, 16822 title = {{Scientific Grand Challenges Workshop Series}}, 16823 howpublished = {Office of Science, U.S. Department of Energy, see 16824 \url{http://extremecomputing.labworks.org/workshops.stm}} 16825} 16826 16827@Misc{ lawrence2011, 16828 key = {Lawrence}, 16829 title = {{Ernest Orlando Lawrence Award Winners}}, 16830 howpublished = {U.S. Department of Energy, {\footnotesize 16831 \url{http://energy.gov/articles/secretary-chu-announces-2011-ernest-orlando-lawrence-award-winners}}}, 16832 year = {2011} 16833} 16834 16835@Article{ murphy2000npi, 16836 title = {{A note on preconditioning for indefinite linear systems}}, 16837 author = {Murphy, M.F. and Golub, G.H. and Wathen, A.J.}, 16838 journal = {SIAM Journal on Scientific Computing}, 16839 volume = {21}, 16840 number = {6}, 16841 pages = {1969--1972}, 16842 year = {2000}, 16843 publisher = {Philadelphia, PA: SIAM, c1993-} 16844} 16845 16846@Article{ elman2011bouyancy, 16847 title = {Fast iterative solvers for buoyancy driven flow problems}, 16848 journal = {Journal of Computational Physics}, 16849 volume = {230}, 16850 number = {10}, 16851 pages = {3900 - 3914}, 16852 year = {2011}, 16853 note = {}, 16854 issn = {0021-9991}, 16855 doi = {10.1016/j.jcp.2011.02.014}, 16856 author = {Howard Elman and Milan Mihajlovic and David Silvester}, 16857 keywords = {Navier-Stokes, Boussinesq, Finite element approximation, Time stepping, 16858 Adaptivity, Preconditioning, Algebraic multigrid} 16859} 16860 16861@Article{ dongarrabeckman11, 16862 author = {J. Dongarra and P. Beckman and et al.}, 16863 title = {The {I}nternational {E}xascale {S}oftware {P}roject {R}oadmap}, 16864 journal = {Int. J. High Perf. Comput. Applics.}, 16865 volume = {25}, 16866 year = {2011}, 16867 pages = {3--60} 16868} 16869 16870@Article{ mandel1999energy, 16871 title = {Energy optimization of algebraic multigrid bases}, 16872 author = {Mandel, J. and Brezina, M. and Van{\v{e}}k, P.}, 16873 journal = {Computing}, 16874 volume = {62}, 16875 number = {3}, 16876 pages = {205--228}, 16877 year = {1999}, 16878 publisher = {Springer} 16879} 16880 16881@Article{ vanek1996algebraic, 16882 title = {Algebraic multigrid by smoothed aggregation for second and fourth order elliptic 16883 problems}, 16884 author = {Van{\v{e}}k, P. and Mandel, J. and Brezina, M.}, 16885 journal = {Computing}, 16886 volume = {56}, 16887 number = {3}, 16888 pages = {179--196}, 16889 year = {1996}, 16890 publisher = {Springer} 16891} 16892 16893@Article{ vanek2001convergence, 16894 title = {Convergence of algebraic multigrid based on smoothed aggregation}, 16895 author = {Van{\v{e}}ek, P. and Brezina, M. and Mandel, J.}, 16896 journal = {Numerische Mathematik}, 16897 volume = {88}, 16898 number = {3}, 16899 pages = {559--579}, 16900 year = {2001}, 16901 publisher = {Springer} 16902} 16903 16904@Article{ brannick2007algebraic, 16905 title = {Algebraic multigrid methods based on compatible relaxation and energy 16906 minimization}, 16907 author = {Brannick, J. and Zikatanov, L.}, 16908 journal = {Domain decomposition methods in science and engineering XVI}, 16909 pages = {15--26}, 16910 year = {2007}, 16911 publisher = {Springer} 16912} 16913 16914@Article{ brannickfalgout2010, 16915 title = {{Compatible Relaxation and Coarsening in Algebraic Multigrid}}, 16916 author = {James J. Brannick and Robert D. Falgout}, 16917 journal = {SIAM Journal on Scientific Computing}, 16918 volume = {32}, 16919 number = {3}, 16920 pages = {1393--1416}, 16921 url = {http://epubs.siam.org/doi/10.1137/090772216}, 16922 doi = {10.1137/090772216}, 16923 issn = {1064-8275}, 16924 year = {2010} 16925} 16926 16927@Article{ xu2004energy, 16928 title = {On an energy minimizing basis for algebraic multigrid methods}, 16929 author = {Xu, J. and Zikatanov, L.}, 16930 journal = {Computing and Visualization in Science}, 16931 volume = {7}, 16932 number = {3}, 16933 pages = {121--127}, 16934 year = {2004}, 16935 publisher = {Springer} 16936} 16937 16938@Article{ dblp:journals/toms/bakerhlt09, 16939 author = {C. G. Baker and Ulrich Hetmaniuk and Richard B. Lehoucq and Heidi Thornquist}, 16940 title = {Anasazi software for the numerical solution of large-scale eigenvalue problems}, 16941 journal = {ACM Trans. Math. Softw.}, 16942 volume = {36}, 16943 number = {3}, 16944 year = {2009}, 16945 doi = {10.1145/1527286.1527287}, 16946 bibsource = {DBLP, http://dblp.uni-trier.de} 16947} 16948 16949@Article{ dblp:journals/siamsc/yanggbllhn05, 16950 author = {Chao Yang and Weiguo Gao and Zhaojun Bai and Xiaoye S. Li and Lie-Quan Lee and 16951 Parry Husbands and Esmond G. Ng}, 16952 title = {An Algebraic Substructuring Method for Large-Scale Eigenvalue Calculation}, 16953 journal = {SIAM J. Scientific Computing}, 16954 volume = {27}, 16955 number = {3}, 16956 year = {2005}, 16957 pages = {873-892}, 16958 doi = {10.1137/040613767}, 16959 bibsource = {DBLP, http://dblp.uni-trier.de} 16960} 16961 16962@TechReport{ ml-guide, 16963 author = {M.W. Gee and C.M. Siefert and J.J. Hu and R.S. Tuminaro and M.G. Sala}, 16964 title = {{ML} 5.0 Smoothed Aggregation User's Guide}, 16965 institution = {Sandia National Laboratories}, 16966 year = {2006}, 16967 number = {SAND2006-2649} 16968} 16969 16970@Article{ brannick06, 16971 title = {An energy-based AMG coarsening strategy}, 16972 volume = {13}, 16973 doi = {10.1002/nla.480}, 16974 number = {2-3}, 16975 journal = {Numerical Linear Algebra with Applications}, 16976 author = {Brannick, J and Brezina, M and MacLachlan, S and Manteuffel, T and McCormick, S 16977 and Ruge, J}, 16978 year = {2006}, 16979 pages = {133--148} 16980} 16981 16982@Article{ olson10, 16983 author = {Olson, Luke N. and Schroder, Jacob and Tuminaro, Raymond S.}, 16984 title = {A new perspective on strength measures in algebraic multigrid}, 16985 journal = {Numerical Linear Algebra with Applications}, 16986 volume = {17}, 16987 number = {4}, 16988 pages = {713--733}, 16989 year = {2010}, 16990 publisher = {John Wiley \& Sons, Ltd.}, 16991 issn = {1099-1506}, 16992 doi = {10.1002/nla.669} 16993} 16994 16995@Article{ olson11, 16996 author = {Olson, Luke N. and Schroder, Jacob B. and Tuminaro, Raymond S.}, 16997 title = {A General Interpolation Strategy for Algebraic Multigrid Using Energy 16998 Minimization}, 16999 journal = {SIAM J. Sci. Comput.}, 17000 issue_date = {April 2011}, 17001 volume = {33}, 17002 issue = {2}, 17003 month = apr, 17004 year = {2011}, 17005 issn = {1064-8275}, 17006 pages = {966--991}, 17007 numpages = {26}, 17008 doi = {10.1137/100803031}, 17009 acmid = {2078825}, 17010 publisher = {Society for Industrial and Applied Mathematics}, 17011 address = {Philadelphia, PA}, 17012 keywords = {algebraic multigrid, interpolation, non-Hermitian, nonsymmetric, smoothed 17013 aggregation} 17014} 17015 17016@Article{ dorit2011, 17017 author = {Dorit Ron and Ilya Safro and Achi Brandt}, 17018 title = {Relaxation-Based Coarsening and Multiscale Graph Organization}, 17019 journal = {Multiscale Modeling {\&} Simulation}, 17020 volume = {9}, 17021 number = {1}, 17022 year = {2011}, 17023 pages = {407-423}, 17024 doi = {10.1137/100791142} 17025} 17026 17027@Article{ chen2011algebraic, 17028 title = {Algebraic distance on graphs}, 17029 author = {Chen, Jie and Safro, Ilya}, 17030 journal = {SIAM Journal on Scientific Computing}, 17031 volume = {33}, 17032 number = {6}, 17033 pages = {3468--3490}, 17034 year = {2011}, 17035 publisher = {SIAM} 17036} 17037 17038@InProceedings{ adams04, 17039 author = {Adams, M.~F. and Bayraktar, H.~H. and Keaveny, T.~M. and Papadopoulos, P.}, 17040 booktitle = {ACM/IEEE Proceedings of SC2004: High Performance Networking and Computing}, 17041 title = {Ultrascalable implicit finite element analyses in solid mechanics with over a 17042 half a billion degrees of freedom}, 17043 note = {Gordon Bell Award}, 17044 year = {2004} 17045} 17046 17047@Article{ adams03a, 17048 author = {Adams, M.~F.}, 17049 journal = {Numerical Linear Algebra with Applications}, 17050 number = {2-3}, 17051 pages = {141-153}, 17052 title = {Algebraic multigrid methods for constrained linear systems with applications to 17053 contact problems in solid mechanics}, 17054 volume = {11}, 17055 year = {2004} 17056} 17057 17058@Article{ adams-10a, 17059 author = {M. ~F. Adams and Ravi Samtaney and Achi Brandt}, 17060 doi = {10.1016/j.jcp.2010.04.024}, 17061 issn = {0021-9991}, 17062 journal = {Journal of Computational Physics}, 17063 keywords = {Implicit magnetohydrodynamics}, 17064 number = {18}, 17065 pages = {6208 - 6219}, 17066 title = {Toward textbook multigrid efficiency for fully implicit resistive 17067 magnetohydrodynamics}, 17068 volume = {229}, 17069 year = {2010} 17070} 17071 17072@InProceedings{ adams98, 17073 address = {Copper Mountain, CO}, 17074 author = {Adams, M.~F.}, 17075 booktitle = {Proceedings 5th Copper Mountain Conference on Iterative Methods}, 17076 title = {A Parallel Maximal Independent Set Algorithm}, 17077 year = {1998} 17078} 17079 17080@InProceedings{ madaypatera89, 17081 author = {Y. Maday and A. T. Patera}, 17082 title = {Spectral element methods for the {Navier-Stokes} equations}, 17083 editor = {A. K. Noor and J. T. Oden}, 17084 booktitle = {State-of-the-Art Surveys in Computational Mechanics}, 17085 pages = {71-–143}, 17086 publisher = {ASME}, 17087 address = {New York, NY}, 17088 year = {1989} 17089} 17090 17091@Article{ mishra2012mlmcfvm, 17092 title = {Multi-level {M}onte {C}arlo finite volume methods for nonlinear systems of 17093 conservation laws in multi-dimensions}, 17094 journal = {Journal of Computational Physics}, 17095 volume = {231}, 17096 number = {8}, 17097 pages = {3365--3388}, 17098 year = {2012}, 17099 issn = {0021-9991}, 17100 doi = {10.1016/j.jcp.2012.01.011}, 17101 author = {S. Mishra and Ch. Schwab and J. {\v S}ukys}, 17102 keywords = {Conservation laws, Euler, MHD, Uncertainty quantification, Multi-level Monte 17103 Carlo, Parallelization} 17104} 17105 17106@Article{ barth2011mlmcfe, 17107 author = {Barth, Andrea and Schwab, Christoph and Zollinger, Nathaniel}, 17108 affiliation = {ETH Zentrum, Seminar für Angewandte Mathematik, Rämistrasse 101, 8092 Zurich, 17109 Switzerland}, 17110 title = {Multi-Level {M}onte {C}arlo Finite Element method for elliptic {PDE}s with 17111 stochastic coefficients}, 17112 journal = {Numerische Mathematik}, 17113 publisher = {Springer Berlin / Heidelberg}, 17114 issn = {0029-599X}, 17115 keyword = {Mathematics and Statistics}, 17116 pages = {123-161}, 17117 volume = {119}, 17118 issue = {1}, 17119 doi = {10.1007/s00211-011-0377-0}, 17120 year = {2011} 17121} 17122 17123@Article{ nguyen2011hybridizable, 17124 title = {Hybridizable discontinuous {G}alerkin methods}, 17125 author = {Nguyen, N.C. and Peraire, J. and Cockburn, B.}, 17126 journal = {Spectral and High Order Methods for Partial Differential Equations}, 17127 pages = {63--84}, 17128 year = {2011}, 17129 publisher = {Springer} 17130} 17131 17132@Misc{ snyder-scidac3:proposal, 17133 author = {Philip {Snyder (PI)}}, 17134 title = {{Plasma Edge Advanced Computation (PEAC) Center}}, 17135 note = {proposal to DOE SciDAC3}, 17136 month = oct, 17137 year = {2011} 17138} 17139 17140@Misc{ wirth-scidac3:proposal, 17141 author = {Brian {Wirth (PI)}}, 17142 title = {{Plasma Surface Interactions: Bridging from the Surface to the Micron Frontier 17143 through Leadership Class Computing}}, 17144 note = {proposal to DOE SciDAC3}, 17145 month = oct, 17146 year = {2011} 17147} 17148 17149@Misc{ cary-scidac3:proposal, 17150 author = {John {Cary (PI)}}, 17151 title = {{Integrated Multiscale Modeling for Plasma Analysis and Control of Tokamak 17152 Stability (IMMPACTS)}}, 17153 note = {proposal to DOE SciDAC3}, 17154 month = oct, 17155 year = {2011} 17156} 17157 17158@Misc{ vashista-scidac3:proposal, 17159 author = {Priya {Vashista (PI)}}, 17160 title = {{Design of Damage-Tolerance Material Interfaces for Extreme 17161 Stress-Temperature-Corrosion Environments: Algorithms and Methods for 17162 Multi-Petaflops Simulations}}, 17163 note = {proposal to DOE SciDAC3}, 17164 month = mar, 17165 year = {2012} 17166} 17167 17168@Article{ elemental2012, 17169 author = {Jack Poulson and Bryan Marker and Jeff R. Hammond and Nichols A. Romero and 17170 Robert {v}an~{d}e~{G}eijn}, 17171 title = {Elemental: A New Framework for Distributed Memory Dense Matrix Computations}, 17172 journal = {{ACM} Transactions on Mathematical Software}, 17173 volume = {39}, 17174 number = {2}, 17175 year = {2013} 17176} 17177 17178@Misc{ elemental-web-page, 17179 author = {Jack Poulson}, 17180 title = {Elemental: Distributed memory dense linear algebra}, 17181 howpublished = {\url{http://libelemental.org}}, 17182 url = {http://libelemental.org/}, 17183 year = {2015} 17184} 17185 17186@Book{ scalesreport, 17187 title = {A Science-based Case for Large-scale Simulation}, 17188 editor = {D. E. Keyes}, 17189 publisher = {U.S. Department of Energy}, 17190 year = {2004}, 17191 url = {http://www.pnl.gov/scales} 17192} 17193 17194@InProceedings{ cilk95, 17195 address = {Santa Barbara, California}, 17196 author = {Robert D. Blumofe and Christopher F. Joerg and Bradley C. Kuszmaul and Charles E. 17197 Leiserson and Keith H. Randall and Yuli Zhou}, 17198 booktitle = {Proceedings of the Fifth ACM SIGPLAN Symposium on Principles and Practice of 17199 Parallel Programming (PPoPP)}, 17200 day = {19--21}, 17201 month = jul, 17202 pages = {207--216}, 17203 title = {{Cilk}: An Efficient Multithreaded Runtime System}, 17204 year = {1995} 17205} 17206 17207@Misc{ valgrind-web-page, 17208 author = {Julian Seward}, 17209 title = {Valgrind}, 17210 url = {http://valgrind.org/}, 17211 howpublished = {\url{http://valgrind.org/}}, 17212 year = {2012} 17213} 17214 17215@Article{ blas79, 17216 author = {C.~L. Lawson and R.~J. Hanson and D. Kincaid and F.~T. Krogh}, 17217 title = {Basic linear algebra subprograms for Fortran usage}, 17218 journal = {ACM Transactions on Mathematical Software}, 17219 volume = {5}, 17220 pages = {308--323}, 17221 year = {1979} 17222} 17223 17224@TechReport{ lapack90, 17225 author = {E. Anderson and Z. Bai and C. Bischof and J. Demmel and J. Dongarra and J. 17226 Du~Croz and A. Greenbaum and S. Hammarling and A. McKenney and D. Sorensen}, 17227 title = {{LAPACK}: A portable linear algebra library for high-performance computers}, 17228 institution = {Computer Science Dept., University of Tennessee}, 17229 number = {CS-90-105}, 17230 month = may, 17231 year = {1990} 17232} 17233 17234@TechReport{ nvidiafermi, 17235 author = {NVIDIA}, 17236 title = {{NVIDIA}'s Next Generation {CUDA} Compute Architecture: {F}ermi}, 17237 institution = {NVIDIA}, 17238 year = {2009} 17239} 17240 17241@Misc{ intelmic, 17242 author = {Many Core Group, Cambridge University}, 17243 title = {Intel Many Integrated Core Architecture}, 17244 howpublished = {\url{http://www.many-core.group.cam.ac.uk/ukgpucc2/talks/Elgar.pdf}}, 17245 month = dec, 17246 year = {2010} 17247} 17248 17249@Article{ abusufahkucklawrie81, 17250 author = {W. Abu-Sufah and D.~J. Kuck and D.~H. Lawrie}, 17251 title = {On the Performance Enhancement of Paging Systems Through Program Analysis and 17252 Transformations}, 17253 journal = {IEEE Trans. Comput.}, 17254 volume = {30}, 17255 number = {5}, 17256 pages = {341--356}, 17257 year = {1981} 17258} 17259 17260@InProceedings{ guobikshandifraguelagarzaranpadua08, 17261 author = {Guo, Jia and Bikshandi, Ganesh and Fraguela, Basilio B. and Garzaran, Maria J. 17262 and Padua, David}, 17263 title = {Programming with tiles}, 17264 booktitle = {Proceedings of the 13th ACM SIGPLAN Symposium on Principles and practice of 17265 parallel programming}, 17266 series = {PPoPP '08}, 17267 year = {2008}, 17268 isbn = {978-1-59593-795-7}, 17269 location = {Salt Lake City, UT}, 17270 pages = {111--122}, 17271 numpages = {12}, 17272 doi = {10.1145/1345206.1345225}, 17273 acmid = {1345225}, 17274 publisher = {ACM}, 17275 address = {New York, NY} 17276} 17277 17278@Article{ strout04, 17279 journal = {International Journal of High Performance Computing Applications}, 17280 year = {2004}, 17281 title = {Sparse Tiling for Stationary Iterative Methods}, 17282 month = feb, 17283 publisher = {Sage Publications}, 17284 pages = {95-114}, 17285 volume = {18}, 17286 number = {1}, 17287 author = {Michelle Mills Strout and Larry Carter and Jeanne Ferrante and Barbara Kreaseck} 17288} 17289 17290@Misc{ openclstandard, 17291 author = {Khronos Group}, 17292 title = {{OpenCL} 1.2 Specification}, 17293 howpublished = {\url{http://www.khronos.org/registry/cl/specs/opencl-1.2.pdf}}, 17294 url = {http://www.khronos.org/registry/cl/specs/opencl-1.2.pdf}, 17295 year = {2011} 17296} 17297 17298@Misc{ stlguide, 17299 author = {SGI}, 17300 title = {Standard Template Library Programmer's Guide}, 17301 howpublished = {\url{http://www.sgi.com/tech/stl/}}, 17302 url = {http://www.sgi.com/tech/stl/}, 17303 year = {2011} 17304} 17305 17306@Book{ stepanov09, 17307 author = {Alexander Stepanov and Paul McJones}, 17308 title = {Elements of Programming}, 17309 publisher = {Addison-Wesley}, 17310 isbn = {978-0-321-63537-2}, 17311 year = {2009} 17312} 17313 17314@Article{ bangerthhartmannkanschat2007, 17315 author = {W. Bangerth and R. Hartmann and G. Kanschat}, 17316 title = {{deal.II} -- a General Purpose Object Oriented Finite Element Library}, 17317 journal = {ACM Trans. Math. Softw.}, 17318 year = {2007}, 17319 volume = {33}, 17320 number = {4}, 17321 pages = {24/1--24/27} 17322} 17323 17324@Misc{ dealii-web-page, 17325 author = {W. Bangerth and R. Hartmann and G. Kanschat}, 17326 title = {{deal.II}}, 17327 howpublished = {\url{http://www.dealii.org/}}, 17328 url = {http://www.dealii.org/}, 17329 year = {2012} 17330} 17331 17332@InBook{ siek2012, 17333 title = {The C++0x ``Concepts'' Effort}, 17334 author = {Jeremy G. Siek}, 17335 editor = {Jeremy Gibbons}, 17336 booktitle = {Generic and Indexed Programming: International Spring School, SSGIP 2010, Oxford, 17337 UK, March 22-26, 2010, Revised Lectures}, 17338 pages = {175--216}, 17339 isbn = {978-3-642-32202-0}, 17340 doi = {10.1007/978-3-642-32202-0_4}, 17341 url = {http://arxiv.org/abs/1201.0027}, 17342 note = {\url{http://arxiv.org/abs/1201.0027}}, 17343 publisher = {Springer Berlin Heidelberg}, 17344 year = {2012} 17345} 17346 17347@Misc{ sharpclaw, 17348 note = {\url{http://numerics.kaust.edu.sa/sharpclaw}}, 17349 author = {Ketcheson, D. I. and Parsani, M.}, 17350 keywords = {clawpack,finite volumes,godunov type methods,high order methods,hyperbolic 17351 PDEs,sharpclaw,software}, 17352 mendeley-tags = {clawpack,finite volumes,godunov type methods,high order methods,hyperbolic 17353 PDEs,sharpclaw,software}, 17354 title = {{SharpClaw software}}, 17355 year = {2011} 17356} 17357 17358@Book{ leveque2002, 17359 title = {Finite volume methods for hyperbolic problems}, 17360 author = {Randall J LeVeque}, 17361 volume = {31}, 17362 year = {2002} 17363} 17364 17365@Misc{ clawpack45, 17366 note = {\url{http://www.clawpack.org}}, 17367 author = {LeVeque, R. J. and Berger, M. J.}, 17368 keywords = {clawpack,finite volumes,hyperbolic PDEs,software}, 17369 mendeley-tags = {clawpack,finite volumes,hyperbolic PDEs,software}, 17370 title = {{Clawpack Software version 4.5}}, 17371 url = {www.clawpack.org}, 17372 year = {2011} 17373} 17374 17375@Article{ nilsen2010, 17376 archiveprefix = {arXiv}, 17377 arxivid = {arXiv:1002.0705v1}, 17378 author = {Nilsen, J.K. and Cai, X. and H{\o}yland, Bj{\o} rn and Langtangen, H. P.}, 17379 eprint = {arXiv:1002.0705v1}, 17380 file = {:Users/ketch/Documents/Mendeley Desktop/Nilsen et al/2010 - Simplifying the 17381 parallelization of scientific codes by a function-centric approach in 17382 Python.pdf:pdf}, 17383 journal = {Computational Science \& Discovery}, 17384 keywords = {parallel,programming,python,software}, 17385 mendeley-tags = {parallel,programming,python,software}, 17386 pages = {015003}, 17387 publisher = {IOP Publishing}, 17388 title = {{Simplifying the parallelization of scientific codes by a function-centric 17389 approach in Python}}, 17390 url = {http://iopscience.iop.org/1749-4699/3/1/015003}, 17391 volume = {3}, 17392 year = {2010} 17393} 17394 17395@Book{ langtangen09, 17396 author = {Hans Petter Langtangen}, 17397 title = {Python Scripting for Computational Science}, 17398 publisher = {Springer}, 17399 series = {Texts in Computational Science and Engineering}, 17400 pages = {784}, 17401 isbn = {3540739157}, 17402 year = {2009} 17403} 17404 17405@Book{ numpyguide, 17406 author = {Travis E. Oliphant}, 17407 title = {Guide to Numpy}, 17408 publisher = {Trelgol}, 17409 year = {2008} 17410} 17411 17412@Misc{ pycuda, 17413 author = {Andreas Kl\"ockner}, 17414 title = {{PyCUDA}}, 17415 howpublished = {\url{http://mathema.tician.de/software/pycuda}}, 17416 year = {2011} 17417} 17418 17419@Misc{ pyopencl, 17420 author = {Andreas Kl\"ockner}, 17421 title = {{PyOpenCL}}, 17422 howpublished = {\url{http://mathema.tician.de/software/pyopencl}}, 17423 year = {2011} 17424} 17425 17426@Article{ klockner2012, 17427 author = {Andreas Kl\"{o}ckner and Nicolas Pinto and Yunsup Lee and Bryan Catanzaro and 17428 Paul Ivanov and Ahmed Fasih}, 17429 title = {{PyCUDA} and {PyOpenCL}: A scripting-based approach to {GPU} run-time code 17430 generation}, 17431 journal = {Parallel Computing}, 17432 volume = {38}, 17433 number = {3}, 17434 pages = {157--174}, 17435 year = {2012}, 17436 issn = {0167-8191}, 17437 doi = {10.1016/j.parco.2011.09.001} 17438} 17439 17440%%%%%% Matt Stuff %%%%%% 17441@Article{ morrabozdagknepleyrassvesselinov, 17442 title = {A Tectonic Shift in Analytics and Computing Is Coming}, 17443 author = {Gabriele Morra and Ebru Bozdag and Matthew G. Knepley and Ludovic R\"ass and 17444 Velimir Vesselinov}, 17445 journal = {Eos}, 17446 volume = {102}, 17447 doi = {10.1029/2021EO159258}, 17448 month = jun, 17449 year = {2021} 17450} 17451 17452@Misc{ knepley:icerm-workshop:2012, 17453 author = {David Keyes and Matthew Knepley and Katherine Yelick}, 17454 title = {Synchronization-reducing and Communication-reducing Algorithms and Programming 17455 Models for Large-scale Simulations}, 17456 note = {Workshop sponsored by the Institute for Computational and Experimental Research 17457 in Mathematics (ICERM), Jan. 9-13, 2012, Providence, RI, 17458 \url{http://icerm.brown.edu/tw12-1-exascale}}, 17459 year = {2012} 17460} 17461 17462@TechReport{ kirbyknepleyscott04, 17463 author = {Robert C. Kirby and Matthew G. Knepley and L. Ridgway Scott}, 17464 title = {Optimal Evaluation of Finite Element Matrices}, 17465 type = {Technical Report}, 17466 number = {TR-2004-04}, 17467 institution = {University of Chicago}, 17468 url = {http://www.cs.uchicago.edu/research/publications/techreports/TR-2004-04}, 17469 note = {\url{http://www.cs.uchicago.edu/research/publications/techreports/TR-2004-04}}, 17470 pages = {14}, 17471 month = may, 17472 year = {2004} 17473} 17474 17475@TechReport{ kirbyknepleyscott10, 17476 author = {Robert C. Kirby and Matthew G. Knepley and L. Ridgway Scott}, 17477 title = {Languages and Compilers for Variational Forms}, 17478 type = {Technical Report}, 17479 number = {TR-2010-09}, 17480 institution = {University of Chicago}, 17481 url = {http://www.cs.uchicago.edu/research/publications/techreports/TR-2010-09}, 17482 note = {\url{http://www.cs.uchicago.edu/research/publications/techreports/TR-2010-09}}, 17483 month = oct, 17484 year = {2010} 17485} 17486 17487@TechReport{ kirbyknepleyscott10b, 17488 author = {Robert C. Kirby and Matthew G. Knepley and L. Ridgway Scott}, 17489 title = {Evaluation of the Action of Finite Element Operators}, 17490 type = {Technical Report}, 17491 number = {TR-2010-08}, 17492 institution = {University of Chicago}, 17493 url = {http://www.cs.uchicago.edu/research/publications/techreports/TR-2010-08}, 17494 note = {\url{http://www.cs.uchicago.edu/research/publications/techreports/TR-2010-08}}, 17495 month = oct, 17496 year = {2010} 17497} 17498 17499@TechReport{ bruneknepleyscott11, 17500 author = {Peter R. Brune and Matthew G. Knepley and L. Ridgway Scott}, 17501 title = {Exponential grids in high-dimensional space}, 17502 type = {Technical Report}, 17503 number = {TR-2011-07}, 17504 institution = {University of Chicago}, 17505 url = {http://www.cs.uchicago.edu/research/publications/techreports/TR-2011-07}, 17506 note = {\url{http://www.cs.uchicago.edu/research/publications/techreports/TR-2011-07}}, 17507 month = dec, 17508 year = {2011} 17509} 17510 17511@TechReport{ zheng11, 17512 author = {Liang Zheng and Taras Gerya and Matthew G. Knepley and David A. Yuen and Huai 17513 Zhang and Yaolin Shi}, 17514 title = {Implementation of a multigrid solver on {GPU} for {Stokes} equations with 17515 strongly variable viscosity based on {Matlab} and {CUDA}}, 17516 type = {Research Report}, 17517 number = {UMSI 2011/33}, 17518 institution = {University of Minnesota Supercomputing Institute}, 17519 url = {http://static.msi.umn.edu/rreports/2011/33.pdf}, 17520 note = {\url{http://static.msi.umn.edu/rreports/2011/33.pdf}}, 17521 month = mar, 17522 year = {2011} 17523} 17524 17525@InProceedings{ zheng2010, 17526 author = {Liang Zheng and Taras Gerya and David A. Yuen and Matthew G. Knepley and Huai 17527 Zhang and Yaolin Shi}, 17528 title = {{GPU} Implementation of {Stokes} Equation with Strongly Variable Coefficients}, 17529 booktitle = {Eos Transactions of the AGU}, 17530 organization = {American Geophysical Union}, 17531 note = {Fall Meeting Supplemental, Abstract IN41A-1350}, 17532 year = {2010} 17533} 17534 17535@InCollection{ terrelkirbyknepleyscott12, 17536 author = {Andy R. Terrel and Robert C. Kirby and Matthew G. Knepley and L. Ridgway Scott 17537 and Garth N. Wells}, 17538 title = {Finite elements for incompressible fluids}, 17539 editors = {A. Logg and K.A. Mardal and G. N. Wells}, 17540 booktitle = {Automated solutions of differential equations by the finite element method}, 17541 series = {Lecture Notes in Computational Science and Engineering}, 17542 volume = {84}, 17543 pages = {163--169}, 17544 publisher = {Springer-Verlag}, 17545 year = {2012} 17546} 17547 17548@InCollection{ kirbyknepleyloggscottterrel12, 17549 author = {Robert C. Kirby and Matthew G. Knepley and Anders Logg and L. Ridgway Scott and 17550 Andy R. Terrel}, 17551 title = {Discrete optimization of finite element matrix evaluation}, 17552 editors = {A. Logg and K.A. Mardal and G. N. Wells}, 17553 booktitle = {Automated solutions of differential equations by the finite element method}, 17554 series = {Lecture Notes in Computational Science and Engineering}, 17555 volume = {84}, 17556 pages = {385--397}, 17557 publisher = {Springer-Verlag}, 17558 year = {2012} 17559} 17560 17561@InCollection{ kirby12, 17562 author = {Robert C. Kirby}, 17563 title = {{FIAT}: Numerical Construction of Finite Element Basis Functions}, 17564 editors = {A. Logg and K.A. Mardal and G. N. Wells}, 17565 booktitle = {Automated solutions of differential equations by the finite element method}, 17566 series = {Lecture Notes in Computational Science and Engineering}, 17567 volume = {84}, 17568 publisher = {Springer-Verlag}, 17569 year = {2012} 17570} 17571 17572@Article{ brownconveryhotesknepleypetropolous1993, 17573 author = {Robert W. Brown and Mary Convery and Scott Hotes and Matthew G. Knepley and 17574 Labros Petropolous}, 17575 title = {Closed strings with low harmonics and kinks}, 17576 journal = {Physical Review D}, 17577 volume = {48}, 17578 number = {6}, 17579 year = {1993} 17580} 17581 17582@Article{ minimax1996, 17583 title = {MiniMax: What has been learned thus far}, 17584 author = {Mary E. Convery and W.~L. Davis and Ken W. Del Signore and Tom L. Jenkins and 17585 Erik Kangas and Matthew G. Knepley and Ken L. Kowalski and Cyrus C. Taylor and 17586 C.~H. Wang and S.~H. Oh and W.~D. Walker and P.~L. Colestock and B. Hanna and M. 17587 Martens and J. Streets and R.~C. Ball and H.~R. Gustafson and L.~W. Jones and 17588 M.~J. Longo and J.~D. Bjorken and N. Morgan and C.~A. Pruneau}, 17589 journal = {Nuovo Cimento}, 17590 volume = {19}, 17591 number = {1}, 17592 pages = {1045--1049}, 17593 year = {1996} 17594} 17595 17596@Article{ minimax1997, 17597 author = {Minimax Collaboration}, 17598 title = {Analysis of Charged Particle/Photon Correlations in Hadronic Multiparticle 17599 Production}, 17600 journal = {Physical Review D}, 17601 volume = {55}, 17602 number = {9}, 17603 year = {1997} 17604} 17605 17606@Article{ minimax2000, 17607 author = {Minimax Collaboration}, 17608 title = {Search for disoriented chiral condensate at the {Fermilab} {Tevatron}}, 17609 journal = {Physical Review D}, 17610 volume = {61}, 17611 number = {3}, 17612 year = {2000} 17613} 17614 17615@Article{ kirbyknepleyloggscott05, 17616 author = {Robert C. Kirby and Matthew G. Knepley and Anders Logg and L. Ridgway Scott}, 17617 title = {Optimizing the evaluation of finite element matrices}, 17618 journal = {SIAM Journal on Scientific Computing}, 17619 volume = {27}, 17620 number = {3}, 17621 pages = {741--758}, 17622 year = {2005} 17623} 17624 17625@Article{ bardhanknepleyanitescu2008, 17626 author = {Jaydeep P. Bardhan and Matthew G. Knepley and Mihai Anitescu}, 17627 title = {Bounding the Electrostatic Free Energies Associated with Linear Continuum Models 17628 of Molecular Solvation}, 17629 journal = {Journal of Chemical Physics}, 17630 volume = {130}, 17631 number = {10}, 17632 pages = {104108}, 17633 note = {Selected for the March 15, 2009 issue of Virtual Journal of Biological Physics 17634 Research}, 17635 doi = {10.1063/1.3081148}, 17636 year = {2008} 17637} 17638 17639%Poster at Biophysical Society Fall Meeting 17640@Article{ bardhanknepley2017, 17641 author = {Jaydeep P. Bardhan and Matthew G. Knepley}, 17642 title = {Accurate Atom-by-Atom Predictions of Solvation Electrostatics Using a 17643 Hydration-Shell {Poisson}-{Boltzmann} Model}, 17644 journal = {Biophysical Journal}, 17645 volume = {110}, 17646 number = {3}, 17647 note = {Fall Meeting Supplemental, Abstract DI14A-08}, 17648 doi = {10.1016/j.bpj.2015.11.1766}, 17649 year = {2017} 17650} 17651 17652@Article{ tabrizirahimigoossensknepleybardhan2018, 17653 title = {Solvation Thermodynamics of Neutral and Charged Solutes Using the Solvation-Layer 17654 Interface Condition (SLIC) Continuum Dielectric Model}, 17655 author = {Amirhossein Molavi Tabrizi and Ali Mehdizadeh Rahimi and Spencer Goossens and 17656 Matthew G. Knepley and Jaydeep P. Bardhan}, 17657 journal = {International Journal of Quantum Chemistry}, 17658 note = {Accepted}, 17659 year = {2018} 17660} 17661 17662@Article{ knepley2010, 17663 author = {Stodden, V. and Knepley, M. G. and Wiggins, C. and LeVeque, R. J. and Donoho, D. 17664 and Fomel, S. and Friedlander, M. P. and Gerstein, M. and Mitchell, I. and 17665 Ouellette, L. L. and Bramble, N. W. and Brown, P. O. and Carey, V. and DeNardis, 17666 L. and Gentleman, R. and {Gezelter, J}, D. and Goodman, A. and Moore, J. E. and 17667 Pasquale, F. A. and Rolnick, J. and Seringhaus, M. and Subramanian, R.}, 17668 title = {{Reproducible Research: addressing the need for data and code sharing in 17669 computational science}}, 17670 journal = {Computing in Science and Engineering}, 17671 volume = {12}, 17672 number = {5}, 17673 pages = {8--13}, 17674 url = {http://www.bepress.com/cgi/viewcontent.cgi?article=1034\&amp;context=sagmb}, 17675 year = {2010} 17676} 17677 17678@Article{ ketchesonahmadiaknepley2011, 17679 title = {Conference Review: High Performance Computing and Hybrid Programming Concepts for 17680 Hyperbolic PDE Codes}, 17681 author = {David I. Ketcheson and Aron Ahmadia and Matthew G. Knepley}, 17682 journal = {SIAM News}, 17683 volume = {44}, 17684 number = {7}, 17685 month = sep, 17686 note = {\url{http://www.siam.org/pdf/news/1912.pdf}}, 17687 year = {2011} 17688} 17689 17690@Article{ yokotabardhanknepleybarbahamada2011, 17691 author = {Rio Yokota and Jaydeep P. Bardhan and Matthew G. Knepley and L.A. Barba and 17692 Tsuyoshi Hamada}, 17693 title = {Biomolecular electrostatics using a fast multipole {BEM} on up to 512 {GPU}s and 17694 a billion unknowns}, 17695 journal = {Computer Physics Communications}, 17696 volume = {182}, 17697 number = {6}, 17698 pages = {1272--1283}, 17699 year = {2011}, 17700 issn = {0010-4655}, 17701 doi = {10.1016/j.cpc.2011.02.013}, 17702 url = {http://arxiv.org/abs/1007.4591} 17703} 17704 17705@Article{ bardhanknepley2011, 17706 author = {Jaydeep P. Bardhan and Matthew G. Knepley}, 17707 title = {Mathematical Analysis of the {BIBEE} Approximation for Molecular Solvation: Exact 17708 Results for Spherical Inclusions}, 17709 journal = {Journal of Chemical Physics}, 17710 volume = {135}, 17711 number = {12}, 17712 pages = {124107--124117}, 17713 url = {http://arxiv.org/abs/1109.0651}, 17714 note = {\url{http://arxiv.org/abs/1109.0651}}, 17715 year = {2011} 17716} 17717 17718@Article{ bruneknepleyscott2013, 17719 author = {Peter R. Brune and Matthew G. Knepley and L. Ridgway Scott}, 17720 title = {Unstructured Geometric Multigrid in Two and Three Dimensions on Complex and 17721 Graded Meshes}, 17722 journal = {SIAM Journal on Scientific Computing}, 17723 url = {http://arxiv.org/abs/1104.0261}, 17724 note = {\url{http://arxiv.org/abs/1104.0261}}, 17725 volume = {35}, 17726 number = {1}, 17727 pages = {A173--A191}, 17728 year = {2013} 17729} 17730 17731@Article{ bardhanknepley2012a, 17732 author = {Jaydeep P. Bardhan and Matthew G. Knepley}, 17733 title = {Computational science and re-discovery: open-source implementations of 17734 ellipsoidal harmonics for problems in potential theory}, 17735 journal = {Computational Science \& Discovery}, 17736 volume = {5}, 17737 pages = {014006}, 17738 note = {\url{http://arxiv.org/abs/1204.0267}}, 17739 doi = {10.1088/1749-4699/5/1/014006}, 17740 year = {2012} 17741} 17742 17743@Article{ kreienkampetal2013, 17744 author = {Amy Kreienkamp and Lucy Y. Liu and Mona S. Minkara and Matthew G. Knepley and 17745 Jaydeep P. Bardhan and Mala L. Radhakrishnan}, 17746 title = {Analysis of fast boundary-integral approximations for modeling electrostatic 17747 contributions of molecular binding}, 17748 journal = {Molecular Based Mathematical Biology}, 17749 volume = {1}, 17750 pages = {124--150}, 17751 doi = {10.2478/mlbmb-2013-0007}, 17752 issn = {2299-3266}, 17753 month = jun, 17754 note = {\url{http://www.degruyter.com/view/j/mlbmb.2012.1.issue/mlbmb-2013-0007/mlbmb-2013-0007.xml}}, 17755 year = {2013} 17756} 17757 17758@Article{ bardhanknepleybrune2015, 17759 author = {Jaydeep P. Bardhan and Matthew G. Knepley and Peter R. Brune}, 17760 title = {Analytical Nonlocal Electrostatics Using Eigenfunction Expansions of 17761 Boundary-Integral Operators}, 17762 journal = {Molecular Based Mathematical Biology}, 17763 volume = {3}, 17764 number = {1}, 17765 pages = {1--22}, 17766 doi = {10.1515/mlbmb-2015-0001}, 17767 year = {2015} 17768} 17769 17770@Article{ bardhanknepley14, 17771 author = {Jaydeep P. Bardhan and Matthew G. Knepley}, 17772 title = {Modeling Charge-Sign Asymmetric Solvation Free Energies With Nonlinear Boundary 17773 Conditions}, 17774 journal = {Journal of Chemical Physics}, 17775 volume = {141}, 17776 number = {13}, 17777 pages = {131103}, 17778 doi = {10.1063/1.4897324}, 17779 year = {2014} 17780} 17781 17782@InProceedings{ bardhantejaniwieckowskiramaswamyknepley2015, 17783 title = {A Nonlinear Boundary Condition for Continuum Models of Biomolecular 17784 Electrostatics}, 17785 author = {Jaydeep P. Bardhan and D. A. Tejani and N. S. Wieckowski and A. Ramaswamy and 17786 Matthew G. Knepley}, 17787 booktitle = {Proceedings of PIERS}, 17788 pages = {1215--1221}, 17789 month = jul, 17790 url = {http://piers.org/piersproceedings/piers2015PragueProc.php?start=250}, 17791 year = {2015} 17792} 17793 17794@Article{ tabriziknepleybardhan2016, 17795 title = {Generalising the mean spherical approximation as a multiscale, nonlinear boundary 17796 condition at the solute-solvent interface}, 17797 author = {Amirhossein Molavi Tabrizi and Matthew G. Knepley and Jaydeep P. Bardhan}, 17798 journal = {Molecular Physics}, 17799 volume = {114}, 17800 number = {16-17}, 17801 pages = {2558--2567}, 17802 doi = {10.1080/00268976.2016.1198503}, 17803 year = {2016} 17804} 17805 17806% http://tex.stackexchange.com/questions/155532/biblatex-and-pubmed-pubmed-central-ids 17807@Article{ tabrizigoossensrahimiknepleybardhan2017, 17808 title = {Predicting Solvation Free Energies and Thermodynamics in Polar Solvents and 17809 Mixtures Using a Solvation-Layer Interface Condition}, 17810 author = {Amirhossein Molavi Tabrizi and Spencer Goossens and Ali Mehdizadeh Rahimi and 17811 Matthew G. Knepley and Jaydeep P. Bardhan}, 17812 journal = {Journal of Chemical Physics}, 17813 volume = {146}, 17814 number = {9}, 17815 pages = {094103}, 17816 url = {http://scitation.aip.org/content/aip/journal/jcp/146/9/10.1063/1.4977037}, 17817 eprint = {https://arxiv.org/abs/1611.02150}, 17818 doi = {10.1063/1.4977037}, 17819 note = {PMCID: PMC5336475}, 17820 year = {2017} 17821} 17822 17823@Article{ tabrizigoossenscooperknepleybardhan2017, 17824 title = {Extending the Solvation-Layer Interface Condition {(SLIC)} Continum Electrostatic 17825 Model to Linearized {Poisson}-{Boltzmann} Solvent}, 17826 author = {Amirhossein Molavi Tabrizi and Spencer Goossens and Christopher D. Cooper and 17827 Matthew G. Knepley and Jaydeep P. Bardhan}, 17828 journal = {Journal of Chemical Theory and Computation}, 17829 year = {2017} 17830} 17831 17832@InProceedings{ mcclanahan2011, 17833 author = {McClanahan, C and Czechowski, Kent and Battaglino, Casey and Iyer, K and Yeung, P 17834 K and Vuduc, Richard}, 17835 booktitle = {Proc. ACM/IEEE Conf. Supercomputing (SC)}, 17836 title = {{Prospects for scalable 3D FFTs on heterogeneous exascale systems}}, 17837 url = {http://mcclanahoochie.com/blog/wp-content/uploads/2011/01/fft-sc11.pdf}, 17838 year = {2011} 17839} 17840 17841@TechReport{ ghysels_ashby_meerbergen_vanroose_2012, 17842 author = {Ghysels, P. and Ashby, T.J. and Meerbergen, K. and Vanroose, W.}, 17843 institution = {Intel Exascience Lab}, 17844 address = {Leuven, Belgium}, 17845 number = {04.2012.1}, 17846 type = {Tech. report}, 17847 title = {Hiding global communication latency in the {GMRES} algorithm on massively 17848 parallel machines}, 17849 url = {http://twna.ua.ac.be/sites/twna.ua.ac.be/files/latency_gmres.pdf}, 17850 year = {2012} 17851} 17852 17853@Article{ ghyselsashbymeerbergenvanroose2013, 17854 author = {Ghysels, P. and Ashby, T.J. and Meerbergen, K. and Vanroose, W.}, 17855 title = {Hiding global communication latency in the {GMRES} algorithm on massively 17856 parallel machines}, 17857 journal = {SIAM Journal on Scientific Computing}, 17858 volume = {35}, 17859 number = {1}, 17860 pages = {C48--C71}, 17861 year = {2013} 17862} 17863 17864@Article{ ghyselsvanroose2014, 17865 author = {P. Ghysels and W. Vanroose}, 17866 title = {Hiding Global Synchronization Latency in the Preconditioned Conjugate Gradient 17867 Algorithm}, 17868 journal = {Parallel Computing}, 17869 volume = {40}, 17870 number = {7}, 17871 pages = {224--238}, 17872 note = {7th Workshop on Parallel Matrix Algorithms and Applications}, 17873 doi = {10.1016/j.parco.2013.06.001}, 17874 year = {2014} 17875} 17876 17877@InProceedings{ strzodkagoddeke06, 17878 author = {R. Strzodka and D. G\"oddeke}, 17879 title = {Pipelined Mixed Precision Algorithms on {FPGA}s for Fast and Accurate PDE Solvers 17880 from Low Precision Components}, 17881 booktitle = {Proceedings of the 14th Annual IEEE Symposium on Field-Programmable Custom 17882 Computing Machines}, 17883 note = {FCCM ’06}, 17884 pages = {259--270}, 17885 year = {2006}, 17886 organization = {IEEE Computer Society} 17887} 17888 17889@InCollection{ jacquesnicolasvollaire12, 17890 author = {T. Jacques and L. Nicolas and C. Vollaire}, 17891 title = {Electromagnetic Scattering with the Boundary Integral Method on {MIMD} Systems}, 17892 editors = {P. Sloot, M. Bubak, A. Hoekstra, and B. Hertzberger}, 17893 booktitle = {High-Performance Computing and Networking}, 17894 series = {Lecture Notes in Computer Science}, 17895 volume = {1593}, 17896 pages = {1025--1031}, 17897 publisher = {Springer}, 17898 year = {1999} 17899} 17900 17901@InProceedings{ hoeflerlumsdainerehm07, 17902 author = {T. Hoefler and A. Lumsdaine and W. Rehm}, 17903 title = {{Implementation and Performance Analysis of Non-Blocking Collective Operations 17904 for MPI}}, 17905 booktitle = {Proceedings of the 2007 International Conference on High Performance Computing, 17906 Networking, Storage and Analysis, SC07}, 17907 location = {Reno, NV}, 17908 publisher = {IEEE Computer Society/ACM}, 17909 source = {http://www.unixer.de/~htor/publications/}, 17910 month = nov, 17911 year = {2007} 17912} 17913 17914@InProceedings{ hoeflersiebretlumsdaine10, 17915 author = {T. Hoefler and C. Siebert and A. Lumsdaine}, 17916 title = {{Scalable Communication Protocols for Dynamic Sparse Data Exchange}}, 17917 booktitle = {Proceedings of the 2010 ACM SIGPLAN Symposium on Principles and Practice of 17918 Parallel Programming (PPoPP'10)}, 17919 month = jan, 17920 location = {Bangalore, India}, 17921 publisher = {ACM}, 17922 isbn = {978-1-60558-708-0}, 17923 source = {http://www.unixer.de/~htor/publications/}, 17924 pages = {159--168}, 17925 year = {2010} 17926} 17927 17928@Article{ ruppweinbubjungelgrasser15, 17929 title = {Pipelined iterative solvers with kernel fusion for graphics processing units}, 17930 author = {Rupp, Karl and Weinbub, Josef and J{\"u}ngel, Ansgar and Grasser, Tibor}, 17931 journal = {ACM Transactions on Mathematical Software (TOMS)}, 17932 volume = {43}, 17933 number = {2}, 17934 pages = {11}, 17935 year = {2016}, 17936 publisher = {ACM} 17937} 17938 17939@Article{ bai_hu_reichel_1994, 17940 title = {A {Newton} basis {GMRES} implementation}, 17941 volume = {14}, 17942 url = {}, 17943 number = {}, 17944 journal = {IMA Journal of Numerical Analysis}, 17945 author = {Z. Bai and D. Hu and L. Reichel}, 17946 year = {1994}, 17947 pages = {563--581} 17948} 17949 17950@Article{ chronopoulos_gear_1989, 17951 title = {{S-step} iterative methods for symmetric linear systems}, 17952 volume = {25}, 17953 url = {}, 17954 number = {}, 17955 journal = {Journal of Computational and Applied Mathematics}, 17956 author = {A. T. Chronopoulos and C. W. Gear}, 17957 year = {1989}, 17958 pages = {153--168} 17959} 17960 17961@Article{ chronopoulos_1996, 17962 title = {Parallel Iterative {S-step} Methods for Unsymmetric Linear Systems}, 17963 author = {A. T. Chronopoulos and C. D. Swanson}, 17964 journal = {Parallel Computing}, 17965 volume = {22}, 17966 number = {5}, 17967 year = {1996}, 17968 pages = {623--641} 17969} 17970 17971@Article{ chronopoulos_2010, 17972 author = {A. T. Chronopoulos and A. Kucherov}, 17973 title = {Block {S-step} {Krylov} Iterative Methods}, 17974 journal = {Numerical Linear Algebra with Applications}, 17975 volume = {17}, 17976 number = {1}, 17977 pages = {3--15}, 17978 year = {2010} 17979} 17980 17981@Article{ sturler_vorst_1995, 17982 title = {Reducing the effect of global communication in {GMRES(m)} and {CG} on parallel 17983 distributed memory computers}, 17984 volume = {18}, 17985 url = {}, 17986 number = {}, 17987 journal = {Applied Numerical Mathematics}, 17988 author = {E. De Sturler and H. A. van der Vorst}, 17989 year = {1995}, 17990 pages = {441--459} 17991} 17992 17993@Article{ joubert_carey_1992, 17994 title = {Parallelizable restarted iterative methods for nonsymmetric linear systems. part 17995 I: Theory}, 17996 volume = {44}, 17997 url = {}, 17998 number = {}, 17999 journal = {International journal of computer mathematics}, 18000 author = {W. D. Joubert and G. F. Carey}, 18001 year = {1992}, 18002 pages = {243--267} 18003} 18004 18005@Article{ elman_saadsaylor_1986, 18006 title = {A hybrid {Chebyshev} {Krylov}-subspace algorithm for solving nonsymmetric systems 18007 of linear equations}, 18008 volume = {7}, 18009 url = {}, 18010 number = {3}, 18011 journal = {SIAM Journal on Scientific and Statistical Computing}, 18012 author = {Howard Elman and Y. Saad and P. E. Saylor}, 18013 year = {1986}, 18014 pages = {840--855} 18015} 18016 18017@Article{ golub95innerand, 18018 author = {Eldar Giladi and Gene H. Golub and Joseph B. Keller}, 18019 title = {Inner and outer iterations for the {Chebyshev} algorithm}, 18020 journal = {SIAM J. Numer. Anal}, 18021 year = {1995}, 18022 volume = {35}, 18023 pages = {300--319} 18024} 18025 18026@Article{ golub_varga_1961, 18027 title = {{Chebyshev} semi-iterative methods, successive overrelaxation iterative methods, 18028 and second-order {Richardson} iterative methods, parts {I} and {II}}, 18029 volume = {3}, 18030 url = {}, 18031 number = {}, 18032 journal = {Numer. Math.}, 18033 author = {Gene Golub and R.S. Varga}, 18034 year = {1961}, 18035 pages = {147--168} 18036} 18037 18038@Article{ el_maliki_guenette_fortin_2011, 18039 title = {An efficient hierarchical preconditioner for quadratic discretizations of finite 18040 element problems}, 18041 volume = {18}, 18042 doi = {10.1002/nla.757}, 18043 number = {5}, 18044 journal = {Numerical Linear Algebra with Applications}, 18045 author = {A. {El maliki} and R. Guenette and M. Fortin}, 18046 year = {2011}, 18047 pages = {789-803} 18048} 18049 18050@Article{ adavani2008multigrid, 18051 title = {Multigrid Algorithms for Inverse Problems with Linear Parabolic {PDE} 18052 Constraints}, 18053 author = {Adavani, S.S. and Biros, G.}, 18054 journal = {SIAM Journal on Scientific Computing}, 18055 volume = {31}, 18056 number = {1}, 18057 pages = {369--397}, 18058 year = {2008}, 18059 publisher = {Society for Industrial and Applied Mathematics} 18060} 18061 18062@Article{ horton1995space, 18063 title = {A space-time multigrid method for parabolic {PDE}s}, 18064 author = {Horton, G. and Vandewalle, S.}, 18065 journal = {SIAM Journal on Scientific Computing}, 18066 volume = {16}, 18067 number = {4}, 18068 pages = {848--864}, 18069 year = {1995} 18070} 18071 18072@Article{ lewis2005model, 18073 title = {Model problems for the multigrid optimization of systems governed by differential 18074 equations}, 18075 author = {Lewis, R.M. and Nash, S.G.}, 18076 journal = {SIAM Journal on Scientific Computing}, 18077 volume = {26}, 18078 number = {6}, 18079 pages = {1811--1837}, 18080 year = {2005}, 18081 publisher = {Philadelphia, PA: SIAM, c1993-} 18082} 18083 18084@Article{ nash2000mgopt, 18085 title = {A multigrid approach to discretized optimization problems}, 18086 author = {Nash, S.G.}, 18087 journal = {Optimization Methods and Software}, 18088 volume = {14}, 18089 number = {1-2}, 18090 pages = {99--116}, 18091 year = {2000}, 18092 publisher = {Taylor \& Francis} 18093} 18094 18095@Article{ borzi2009multigrid, 18096 title = {Multigrid Methods for {PDE} Optimization}, 18097 author = {Borz{\`i}, A. and Schulz, V.}, 18098 journal = {SIAM Review}, 18099 volume = {51}, 18100 pages = {361}, 18101 year = {2009} 18102} 18103 18104@Article{ borzi2005multigrid, 18105 title = {A multigrid scheme for elliptic constrained optimal control problems}, 18106 author = {Borz{\`i}, A. and Kunisch, K.}, 18107 journal = {Computational Optimization and Applications}, 18108 volume = {31}, 18109 number = {3}, 18110 pages = {309--333}, 18111 year = {2005}, 18112 publisher = {Springer} 18113} 18114 18115@Article{ borzi2003multigrid, 18116 title = {Multigrid methods for parabolic distributed optimal control problems}, 18117 author = {Borz{\`i}, A.}, 18118 journal = {Journal of Computational and Applied Mathematics}, 18119 volume = {157}, 18120 number = {2}, 18121 pages = {365--382}, 18122 year = {2003}, 18123 publisher = {Elsevier} 18124} 18125 18126@Article{ ito2002receding, 18127 title = {Receding horizon optimal control for infinite dimensional systems}, 18128 author = {Ito, K. and Kunisch, K.}, 18129 journal = {ESAIM: Control, Optimisation and Calculus of Variations}, 18130 volume = {8}, 18131 number = {1}, 18132 pages = {741--760}, 18133 year = {2002}, 18134 publisher = {Cambridge University Press} 18135} 18136 18137@Article{ schulz1998solving, 18138 title = {Solving discretized optimization problems by partially reduced {SQP} methods}, 18139 author = {Schulz, V.H.}, 18140 journal = {Computing and Visualization in Science}, 18141 volume = {1}, 18142 number = {2}, 18143 pages = {83--96}, 18144 year = {1998}, 18145 publisher = {Springer} 18146} 18147 18148@Article{ hazra2005aerodynamic, 18149 title = {Aerodynamic shape optimization using simultaneous pseudo-timestepping}, 18150 author = {Hazra, S.B. and Schulz, V. and Brezillon, J. and Gauger, N.R.}, 18151 journal = {Journal of Computational Physics}, 18152 volume = {204}, 18153 number = {1}, 18154 pages = {46--64}, 18155 year = {2005}, 18156 publisher = {Elsevier} 18157} 18158 18159@Article{ mandel1985multilevel, 18160 title = {On multilevel iterative methods for integral equations of the second kind and 18161 related problems}, 18162 author = {Mandel, J.}, 18163 journal = {Numerische Mathematik}, 18164 volume = {46}, 18165 number = {1}, 18166 pages = {147--157}, 18167 year = {1985}, 18168 publisher = {Springer} 18169} 18170 18171@Article{ king1992multilevel, 18172 title = {Multilevel algorithms for ill-posed problems}, 18173 author = {King, J.T.}, 18174 journal = {Numerische Mathematik}, 18175 volume = {61}, 18176 number = {1}, 18177 pages = {311--334}, 18178 year = {1992}, 18179 publisher = {Springer} 18180} 18181 18182@Article{ kaltenbacher2001regularizing, 18183 title = {On the regularizing properties of a full multigrid method for ill-posed 18184 problems}, 18185 author = {Kaltenbacher, B.}, 18186 journal = {Inverse Problems}, 18187 volume = {17}, 18188 pages = {767}, 18189 year = {2001}, 18190 publisher = {IOP Publishing} 18191} 18192 18193@Article{ kaltenbacher2002multi, 18194 title = {A multi-grid method with a priori and a posteriori level choice for the 18195 regularization of nonlinear ill-posed problems}, 18196 author = {Kaltenbacher, B. and Schicho, J.}, 18197 journal = {Numerische Mathematik}, 18198 volume = {93}, 18199 number = {1}, 18200 pages = {77--107}, 18201 year = {2002}, 18202 publisher = {Springer} 18203} 18204 18205@Article{ burger2006regularizing, 18206 title = {Regularizing {N}ewton-{K}aczmarz Methods for Nonlinear Ill-Posed Problems}, 18207 author = {Burger, M. and Kaltenbacher, B.}, 18208 journal = {SIAM Journal on Numerical Analysis}, 18209 volume = {44}, 18210 pages = {153}, 18211 year = {2006} 18212} 18213 18214@Article{ draganescu2008optimal, 18215 title = {Optimal order multilevel preconditioners for regularized ill-posed problems}, 18216 author = {Andrei Dr{\u{a}}g{\u{a}}nescu and Todd F. Dupont}, 18217 journal = {Mathematics of Computation}, 18218 volume = {77}, 18219 number = {264}, 18220 pages = {2001--2038}, 18221 year = {2008} 18222} 18223 18224@Article{ bastian1998additive, 18225 title = {Additive and multiplicative multi-grid---a comparison}, 18226 author = {Bastian, P. and Wittum, G. and Hackbusch, W.}, 18227 journal = {Computing}, 18228 volume = {60}, 18229 number = {4}, 18230 pages = {345--364}, 18231 year = {1998}, 18232 publisher = {Springer} 18233} 18234 18235@Article{ fournier2001multiplicative, 18236 title = {Multiplicative and additive parallel multigrid algorithms for the acceleration of 18237 compressible flow computations on unstructured meshes}, 18238 author = {Fournier, L. and Lanteri, S.}, 18239 journal = {Applied Numerical Mathematics}, 18240 volume = {36}, 18241 number = {4}, 18242 pages = {401--426}, 18243 year = {2001}, 18244 publisher = {Elsevier} 18245} 18246 18247@Article{ chow2006survey, 18248 title = {A survey of parallelization techniques for multigrid solvers}, 18249 author = {Chow, E. and Falgout, R.D. and Hu, J.J. and Tuminaro, R.S. and Yang, U.M.}, 18250 journal = {Parallel Processing for Scientific Computing, MA Heroux, P. Raghavan, and HD 18251 Simon, eds}, 18252 volume = {20}, 18253 pages = {179--201}, 18254 year = {2006} 18255} 18256 18257@InBook{ brandt2001multiscale, 18258 title = {Multiscale scientific computation: {R}eview 2001}, 18259 author = {Brandt, A.}, 18260 booktitle = {Multiscale and Multiresolution Methods: Theory and Applications}, 18261 editors = {Barth, T.J. and Chan, T.F. and Haimes, R.}, 18262 series = {Lecture Notes in Computational Science and Engineering}, 18263 year = {2001}, 18264 volume = {20}, 18265 pages = {3--96}, 18266 publisher = {Springer Verlag} 18267} 18268 18269@InCollection{ brandt2003multigrid, 18270 title = {Multigrid solvers and multilevel optimization strategies}, 18271 author = {Brandt, A. and Ron, D.}, 18272 booktitle = {Multilevel Optimization and VLSICAD}, 18273 editors = {J. Cong and J.R. Shinnerl}, 18274 pages = {1--69}, 18275 publisher = {Kluwer Academic Publishers}, 18276 year = {2003} 18277} 18278 18279@InBook{ brandt2009principles, 18280 title = {Principles of systematic upscaling}, 18281 author = {Brandt, A.}, 18282 booktitle = {Bridging the Scales in Science and Engineering}, 18283 editors = {J. Fish}, 18284 publisher = {Oxford University Press}, 18285 pages = {193--215}, 18286 year = {2009} 18287} 18288 18289@Article{ livne2004coarsening, 18290 title = {Coarsening by compatible relaxation}, 18291 author = {Livne, O.E.}, 18292 journal = {Numerical Linear Algebra with Applications}, 18293 volume = {11}, 18294 number = {2-3}, 18295 pages = {205--227}, 18296 year = {2004}, 18297 publisher = {Wiley Online Library} 18298} 18299 18300@InProceedings{ brandt1986stochastic, 18301 title = {Multi-Level Approaches to Discrete-State and Stochastic Problems}, 18302 author = {Brandt, A. and Ron, D. and Amit, D.J.}, 18303 booktitle = {Multigrid methods II: proceedings of the 2nd European Conference on Multigrid 18304 Methods, held at Cologne, October 1-4, 1985}, 18305 volume = {1228}, 18306 pages = {65--98}, 18307 year = {1986}, 18308 organization = {Springer} 18309} 18310 18311@Article{ halko2011finding, 18312 author = {Nathan Halko and Per-Gunnar Martinsson and Joel A. Tropp}, 18313 title = {Finding Structure with Randomness: Probabilistic Algorithms for Constructing 18314 Approximate Matrix Decompositions}, 18315 journal = {SIAM Review}, 18316 volume = {53}, 18317 number = {2}, 18318 year = {2011}, 18319 pages = {217-288}, 18320 doi = {10.1137/090771806} 18321} 18322 18323@InProceedings{ mhdy09, 18324 author = {Mohiyuddin, M. and Hoemmen, M. and Demmel, J. and Yelick, K.}, 18325 booktitle = {Proceedings of SC09}, 18326 organization = {ACM}, 18327 title = {Minimizing communication in sparse matrix solvers}, 18328 doi = {10.1145/1654059.1654096}, 18329 year = {2009} 18330} 18331 18332@InProceedings{ vanrosendale83, 18333 title = {Minimizing inner product data dependencies in conjugate gradient iteration}, 18334 booktitle = {Proceedings of the IEEE International Conference on Parallel Processing}, 18335 author = {J. van Rosendale}, 18336 year = {1983}, 18337 publisher = {IEEE Computer Society} 18338} 18339 18340@PhDThesis{ vuduc95, 18341 title = {Quantitative performance modeling of scientific computations and creating 18342 locality in numerical algorithms}, 18343 author = {R. Vuduc}, 18344 journal = {Massachusetts Institute of Technology}, 18345 school = {Massachusetts Institute of Technology}, 18346 year = {1995} 18347} 18348 18349@Article{ simoncini2003flexible, 18350 title = {Flexible inner-outer {Krylov} subspace methods}, 18351 author = {Simoncini, V. and Szyld, D.B.}, 18352 journal = {SIAM Journal on Numerical Analysis}, 18353 pages = {2219--2239}, 18354 year = {2003}, 18355 publisher = {JSTOR} 18356} 18357 18358@Article{ parks2006recycling, 18359 title = {Recycling {K}rylov Subspaces for Sequences of Linear Systems}, 18360 author = {Parks, M.L. and de Sturler, E. and Mackey, G. and Johnson, D.D. and Maiti, S.}, 18361 journal = {SIAM Journal on Scientific Computing}, 18362 volume = {28}, 18363 number = {5}, 18364 pages = {1651--1674}, 18365 year = {2006}, 18366 publisher = {Society for Industrial and Applied Mathematics} 18367} 18368 18369@Article{ freund2003model, 18370 title = {Model reduction methods based on Krylov subspaces}, 18371 author = {Freund, R.W.}, 18372 journal = {Acta Numerica}, 18373 volume = {12}, 18374 number = {1}, 18375 pages = {267--319}, 18376 year = {2003}, 18377 publisher = {Cambridge Univ Press} 18378} 18379 18380@InBook{ gutknecht2006block, 18381 title = {Block {K}rylov space methods for linear systems with multiple right-hand sides: 18382 an introduction}, 18383 booktitle = {Modern Mathematical Models, Methods and Algorithms for Real World Systems}, 18384 author = {Gutknecht, M.H.}, 18385 editors = {Siddiqi A.H. and Duff I.S. and Christensen O.}, 18386 publisher = {Anamaya Publishers}, 18387 location = {New Delhi}, 18388 pages = {420-447}, 18389 year = {2006} 18390} 18391 18392@Article{ moulton1998black, 18393 title = {The black box multigrid numerical homogenization algorithm}, 18394 author = {Moulton, J.D. and Dendy, J.E. and Hyman, J.M. and others}, 18395 journal = {Journal of Computational Physics}, 18396 volume = {142}, 18397 number = {1}, 18398 pages = {80--108}, 18399 year = {1998}, 18400 publisher = {Elsevier} 18401} 18402 18403@Article{ neuss2001homogenization, 18404 title = {Homogenization and multigrid}, 18405 author = {Neuss, N. and J{\"a}ger, W. and Wittum, G.}, 18406 journal = {Computing}, 18407 volume = {66}, 18408 number = {1}, 18409 pages = {1--26}, 18410 year = {2001}, 18411 publisher = {Springer} 18412} 18413 18414@Article{ bai2002krylov, 18415 title = {Krylov subspace techniques for reduced-order modeling of large-scale dynamical 18416 systems}, 18417 author = {Bai, Z.}, 18418 journal = {Applied Numerical Mathematics}, 18419 volume = {43}, 18420 number = {1}, 18421 pages = {9--44}, 18422 year = {2002}, 18423 publisher = {Elsevier} 18424} 18425 18426@InProceedings{ dong2003piecewise, 18427 title = {Piecewise polynomial nonlinear model reduction}, 18428 author = {Dong, N. and Roychowdhury, J.}, 18429 booktitle = {Design Automation Conference, 2003. Proceedings}, 18430 pages = {484--489}, 18431 year = {2003}, 18432 organization = {IEEE} 18433} 18434 18435@Article{ bond2009stable, 18436 title = {Stable reduced models for nonlinear descriptor systems through piecewise-linear 18437 approximation and projection}, 18438 author = {Bond, B.N. and Daniel, L.}, 18439 journal = {IEEE Transactions on Computer-Aided Design of Integrated Circuits and Systems}, 18440 volume = {28}, 18441 number = {10}, 18442 pages = {1467--1480}, 18443 year = {2009}, 18444 publisher = {IEEE} 18445} 18446 18447@Article{ xin2000front, 18448 title = {Front Propagation in Heterogeneous Media}, 18449 author = {Xin, J.}, 18450 journal = {SIAM Review}, 18451 volume = {42}, 18452 number = {2}, 18453 pages = {161--230}, 18454 year = {2000}, 18455 publisher = {Society for Industrial and Applied Mathematics} 18456} 18457 18458@Article{ owhadi2011localized, 18459 title = {Localized Bases for Finite-Dimensional Homogenization Approximations with 18460 Nonseparated Scales and High Contrast}, 18461 author = {Owhadi, H. and Zhang, L.}, 18462 journal = {Multiscale Modeling and Simulation}, 18463 volume = {9}, 18464 pages = {1373}, 18465 year = {2011} 18466} 18467 18468@Article{ berlyand2010flux, 18469 title = {Flux norm approach to finite dimensional homogenization approximations with 18470 non-separated scales and high contrast}, 18471 author = {Berlyand, L. and Owhadi, H.}, 18472 journal = {Archive for rational mechanics and analysis}, 18473 volume = {198}, 18474 number = {2}, 18475 pages = {677--721}, 18476 year = {2010}, 18477 publisher = {Springer} 18478} 18479 18480@Article{ babuska2011optimal, 18481 title = {Optimal Local Approximation Spaces for Generalized Finite Element Methods with 18482 Application to Multiscale Problems}, 18483 author = {Babuska, I. and Lipton, R.}, 18484 journal = {Multiscale Modeling \& Simulation}, 18485 volume = {9}, 18486 pages = {373}, 18487 year = {2011} 18488} 18489 18490@Article{ boettinger2002phase, 18491 title = {Phase-Field Simulation of Solidification}, 18492 author = {Boettinger, W.J. and Warren, J.A. and Beckermann, C. and Karma, A.}, 18493 journal = {Annual review of materials research}, 18494 volume = {32}, 18495 number = {1}, 18496 pages = {163--194}, 18497 year = {2002}, 18498 publisher = {Annual Reviews} 18499} 18500 18501@Article{ karma1998quantitative, 18502 title = {Quantitative phase-field modeling of dendritic growth in two and three 18503 dimensions}, 18504 author = {Karma, A. and Rappel, W.J.}, 18505 journal = {Physical Review E}, 18506 volume = {57}, 18507 number = {4}, 18508 pages = {4323}, 18509 year = {1998}, 18510 publisher = {APS} 18511} 18512 18513@Article{ chen2002phase, 18514 title = {Phase-field models for microstructure evolution}, 18515 author = {Chen, L.Q.}, 18516 journal = {Annual review of materials research}, 18517 volume = {32}, 18518 number = {1}, 18519 pages = {113--140}, 18520 year = {2002}, 18521 publisher = {Annual Reviews} 18522} 18523 18524@Article{ galbally2010reductionuq, 18525 title = {Non-linear model reduction for uncertainty quantification in large-scale inverse 18526 problems}, 18527 author = {Galbally, D. and Fidkowski, K. and Willcox, K. and Ghattas, O.}, 18528 journal = {International journal for numerical methods in engineering}, 18529 volume = {81}, 18530 number = {12}, 18531 pages = {1581--1608}, 18532 year = {2010}, 18533 publisher = {Wiley Online Library} 18534} 18535 18536@Article{ griebel1995abstract, 18537 title = {On the abstract theory of additive and multiplicative {Schwarz} algorithms}, 18538 author = {Griebel, M. and Oswald, P.}, 18539 journal = {Numerische Mathematik}, 18540 volume = {70}, 18541 number = {2}, 18542 pages = {163--180}, 18543 year = {1995}, 18544 publisher = {Springer} 18545} 18546 18547@InProceedings{ voutchkov2006multiobjective, 18548 title = {Multiobjective optimization using surrogates}, 18549 author = {Voutchkov, I. and Keane, A.J.}, 18550 booktitle = {Adaptive Computing in Design and Manufacture}, 18551 pages = {167--175}, 18552 year = {2006}, 18553 publisher = {The MC Escher Company} 18554} 18555 18556@Article{ leary2001constraint, 18557 title = {A constraint mapping approach to the structural optimization of an expensive 18558 model using surrogates}, 18559 author = {Leary, S.J. and Bhaskar, A. and Keane, A.J.}, 18560 journal = {Optimization and Engineering}, 18561 volume = {2}, 18562 number = {4}, 18563 pages = {385--398}, 18564 year = {2001}, 18565 publisher = {Springer} 18566} 18567 18568@InProceedings{ legresley2000airfoil, 18569 title = {Airfoil design optimization using reduced order models based on proper orthogonal 18570 decomposition}, 18571 author = {LeGresley, P.A. and Alonso, J.J.}, 18572 booktitle = {Fluids 2000 Conference and Exhibit, Denver, CO}, 18573 year = {2000} 18574} 18575 18576@Book{ myers2009response, 18577 title = {Response surface methodology: process and product optimization using designed 18578 experiments}, 18579 author = {Myers, R.H. and Montgomery, D.C. and Anderson-Cook, C.M.}, 18580 volume = {705}, 18581 year = {2009}, 18582 publisher = {John Wiley \& Sons} 18583} 18584 18585@Article{ carlberg2012gnat, 18586 title = {The {GNAT} method for nonlinear model reduction: effective implementation and 18587 application to computational fluid dynamics and turbulent flows}, 18588 author = {Kevin Carlberg and Charbel Farhat and Julien Cortial and David Amsallem}, 18589 journal = {arXiv}, 18590 volume = {1207.1349}, 18591 year = {2012} 18592} 18593 18594@Article{ biros2008multilevel, 18595 title = {A multilevel algorithm for inverse problems with elliptic {PDE} constraints}, 18596 author = {Biros, G. and Dogan, G.}, 18597 journal = {Inverse Problems}, 18598 volume = {24}, 18599 pages = {034010}, 18600 year = {2008}, 18601 publisher = {IOP Publishing} 18602} 18603 18604@Article{ rees2010optimal, 18605 title = {Optimal Solvers for {PDE}-Constrained Optimization}, 18606 author = {Rees, T. and Dollar, H.S. and Wathen, A.J.}, 18607 journal = {SIAM Journal on Scientific Computing}, 18608 volume = {32}, 18609 pages = {271}, 18610 year = {2010} 18611} 18612 18613@Article{ rees2010block, 18614 title = {Block-triangular preconditioners for {PDE}-constrained optimization}, 18615 author = {Rees, T. and Stoll, M.}, 18616 journal = {Numerical Linear Algebra with Applications}, 18617 volume = {17}, 18618 number = {6}, 18619 pages = {977--996}, 18620 year = {2010}, 18621 publisher = {Wiley Online Library} 18622} 18623 18624@Article{ rees2011preconditioning, 18625 title = {Preconditioning Iterative Methods for the Optimal Control of the {S}tokes 18626 Equations}, 18627 author = {Rees, T. and Wathen, A.J.}, 18628 journal = {SIAM Journal on Scientific Computing}, 18629 volume = {33}, 18630 number = {5}, 18631 pages = {2903--2926}, 18632 year = {2011}, 18633 publisher = {Society for Industrial and Applied Mathematics} 18634} 18635 18636@Article{ vogel2007fbicg, 18637 title = {Flexible {BiCG} and flexible {Bi-CGSTAB} for nonsymmetric linear systems}, 18638 author = {Vogel,J.A.}, 18639 journal = {Applied Mathematics and Computation}, 18640 volume = {188}, 18641 number = {1}, 18642 pages = {226–-233}, 18643 year = {2007}, 18644 publisher = {Elsevier} 18645} 18646 18647@Unpublished{ leehammond2010, 18648 author = {B. Lee and G.E. Hammond}, 18649 title = {Parallel Performance of Preconditioned {Krylov} Solvers for the {Richards} 18650 Equation}, 18651 key = {multigrid}, 18652 note = {manuscript, 2010} 18653} 18654 18655@Article{ vandeneshop2004inexact, 18656 title = {Inexact {Krylov} Subspace Methods for Linear Systems}, 18657 author = {Jasper {van den} Eshof and Gerard L. G. Sleijpen}, 18658 journal = {SIAM Journal on Matrix Analysis and Applications}, 18659 volume = {26}, 18660 number = {1}, 18661 pages = {125--153}, 18662 year = {2004} 18663} 18664 18665@Article{ fbicg.fbcgs, 18666 title = {Flexible {BiCG} and flexible {Bi-CGSTAB} for nonsymmetric linear systems}, 18667 author = {Judith A. Vogel}, 18668 journal = {Applied Mathematics and Computation}, 18669 volume = {188}, 18670 number = {1}, 18671 pages = {226--233}, 18672 year = {2007} 18673} 18674 18675@Article{ simoncini2003inexact, 18676 title = {Theory of Inexact {Krylov} Subspace Methods and Applications to Scientific 18677 Computing}, 18678 author = {Valeria Simoncini and Daniel B. Szyld}, 18679 journal = {SIAM Journal on Scientific Computing}, 18680 volume = {25}, 18681 number = {2}, 18682 pages = {454--477}, 18683 year = {2003} 18684} 18685 18686@Article{ fqmr, 18687 title = {{FQMR}: A Flexible {Quasi-Minimal Residual} Method with Inexact Preconditioning}, 18688 author = {Daniel B. Szyld and Judith A. Vogel}, 18689 journal = {SIAM Journal on Scientific Computing}, 18690 volume = {23}, 18691 number = {2}, 18692 pages = {363--380}, 18693 year = {2001} 18694} 18695 18696@Article{ ipcg, 18697 title = {Inexact Preconditioned {Conjugate Gradient} Method with Inner-Outer Iteration}, 18698 author = {Gene H. Golub and Qiang Ye}, 18699 journal = {SIAM Journal on Scientific Computing}, 18700 volume = {21}, 18701 number = {4}, 18702 pages = {1305--1320}, 18703 year = {1999} 18704} 18705 18706@Article{ idr.sonneveld, 18707 title = {{IDR}(s): A Family of Simple and Fast Algorithms for Solving Large Nonsymmetric 18708 Systems of Linear Equations}, 18709 author = {Peter Sonneveld and Martin B. van Gijzen}, 18710 journal = {SIAM Journal on Scientific Computing}, 18711 volume = {31}, 18712 number = {2}, 18713 pages = {1035--1062}, 18714 year = {2008} 18715} 18716 18717@Article{ flexiblecg, 18718 title = {Flexible {Conjugate Gradients}}, 18719 author = {Yvan Notay}, 18720 journal = {SIAM Journal on Scientific Computing}, 18721 volume = {22}, 18722 number = {4}, 18723 pages = {1444--1460}, 18724 year = {2000} 18725} 18726 18727@Article{ generalizedcg, 18728 title = {A Black Box Generalized {Conjugate Gradient} Solver with Inner Iterations and 18729 Variable-Step Preconditioning}, 18730 author = {O. Axelsson and P. S. Vassilevski}, 18731 journal = {SIAM Journal on Matrix Analysis and Applications}, 18732 volume = {12}, 18733 number = {4}, 18734 pages = {625--644}, 18735 year = {1991} 18736} 18737 18738@Article{ bicg, 18739 title = {{Conjugate Gradient} methods for indefinite systems}, 18740 author = {R. Fletcher}, 18741 journal = {Lecture Notes in Mathematics}, 18742 volume = {506}, 18743 pages = {73--89}, 18744 year = {1976} 18745} 18746 18747@Article{ idr.bcgs, 18748 title = {{Bi-CGSTAB} as an induced dimension reduction method}, 18749 author = {Gerard L.G. Sleijpen and Peter Sonneveld and Martin B. van Gijzen}, 18750 journal = {Applied Numerical Mathematics}, 18751 volume = {60}, 18752 pages = {1100--1114}, 18753 year = {2010} 18754} 18755 18756@Article{ idr.bcgsl, 18757 title = {Exploiting {BiCGstab($\ell$)} strategies to induce dimension reduction}, 18758 author = {Gerard L.G. Sleijpen and Martin B. van Gijzen}, 18759 journal = {SIAM J. Sci. Comput.}, 18760 volume = {32}, 18761 number = {5}, 18762 pages = {2687--2709}, 18763 year = {2010} 18764} 18765 18766@Article{ idr.min.sync, 18767 title = {Minimizing synchronization in {IDR(s)}}, 18768 author = {T.P. Collignon and M.B. van Gijzen}, 18769 journal = {Numerical Linear Algebra with Applications}, 18770 volume = {18}, 18771 number = {5}, 18772 pages = {805--825}, 18773 year = {2011} 18774} 18775 18776@TechReport{ flexible.idr, 18777 title = {Flexible and Multi-Shift Induced Dimension Reduction Algorithms for solving Large 18778 Sparse Linear Systems}, 18779 author = {Martin B. van Gijzen and Gerard L.G. Sleijpen and Jens-Peter M. Zemke}, 18780 institution = {Delft University of Technology}, 18781 number = {11-06}, 18782 year = {2011} 18783} 18784 18785@Article{ vangenuchten1980, 18786 title = {A Closed-form Equation for Predicting the Hydraulic Conductivity of Unsaturated 18787 Soils}, 18788 author = {M. Th. van Genuchten}, 18789 journal = {Soil Science Society of America Journal}, 18790 volume = {44}, 18791 pages = {892--898}, 18792 year = {1980} 18793} 18794 18795@Article{ gmresr94, 18796 title = {{GMRESR}: a family of nested {GMRES} methods}, 18797 author = {H. A. Van der Vorst and C. Vuik}, 18798 journal = {Numerical Linear Algebra with Applications}, 18799 volume = {1}, 18800 number = {4}, 18801 pages = {369--386}, 18802 year = {1994} 18803} 18804 18805@Article{ knepley10, 18806 author = {Matthew G. Knepley}, 18807 title = {Removing the Barrier to Scalability in Parallel FMM}, 18808 journal = {CoRR}, 18809 volume = {abs/1008.2410}, 18810 note = {\url{http://arxiv.org/abs/1008.2410}}, 18811 year = {2010} 18812} 18813 18814@Article{ teng1998, 18815 author = {Shang-Hua Teng}, 18816 title = {Provably Good Partitioning and Load Balancing Algorithms for Parallel Adaptive 18817 N-Body Simulation}, 18818 journal = {SIAM J. Sci. Comput.}, 18819 volume = {19}, 18820 number = {2}, 18821 month = mar, 18822 pages = {635--656}, 18823 year = {1998}, 18824 issn = {1064-8275}, 18825 numpages = {22}, 18826 doi = {10.1137/S1064827595288942}, 18827 acmid = {289842}, 18828 issue_date = {March 1998}, 18829 publisher = {Society for Industrial and Applied Mathematics}, 18830 address = {Philadelphia, PA}, 18831 keywords = {N-body simulation, adaptive computing, hierarchical methods, load balancing, 18832 parallel processing, partitioning, scientific computing, the fast multipole 18833 method, tree-codes} 18834} 18835 18836@InProceedings{ skinnerkramer05, 18837 author = {David Skinner and William Kramer}, 18838 title = {Understanding the causes of performance variability in HPC workloads}, 18839 booktitle = {Workload Characterization Symposium, 2005. Proceedings of the IEEE 18840 International}, 18841 organization = {IEEE}, 18842 pages = {137--149}, 18843 year = {2005} 18844} 18845 18846@Article{ notay_2000, 18847 author = {Yvan Notay}, 18848 title = {Flexible {Conjugate Gradients}}, 18849 journal = {SIAM Journal on Scientific Computing}, 18850 volume = {22}, 18851 number = {4}, 18852 year = {2000}, 18853 pages = {1444--1460} 18854} 18855 18856@Article{ bereux1996, 18857 title = {Zero-relaxation limit versus operator splitting for two-phase fluid flow 18858 computations}, 18859 author = {Fran{\c{c}}ois B{\'e}reux}, 18860 journal = {Computer Methods in Applied Mechanics and Engineering}, 18861 volume = {133}, 18862 number = {1-2}, 18863 pages = {93--124}, 18864 year = {1996} 18865} 18866 18867@Article{ pawlowski2006globalization, 18868 title = {Globalization techniques for {N}ewton-{K}rylov methods and applications to the 18869 fully coupled solution of the {N}avier-{S}tokes equations}, 18870 author = {Pawlowski, Roger P and Shadid, John N and Simonis, Joseph P and Walker, Homer F}, 18871 journal = {SIAM Review}, 18872 volume = {48}, 18873 number = {4}, 18874 pages = {700--721}, 18875 year = {2006}, 18876 publisher = {SIAM} 18877} 18878 18879@Article{ roppshadid2009, 18880 title = {Stability of operator splitting methods for systems with indefinite operators: 18881 Advection--diffusion--reaction systems}, 18882 author = {David L Ropp and John N Shadid}, 18883 journal = {Journal of Computational Physics}, 18884 volume = {228}, 18885 number = {9}, 18886 pages = {3508--3516}, 18887 year = {2009} 18888} 18889 18890@Article{ brown1985experiments, 18891 title = {Experiments with quasi-{N}ewton methods in solving stiff {ODE} systems}, 18892 author = {Brown, P.N. and Hindmarsh, A.C. and Walker, H.F.}, 18893 journal = {SIAM Journal on Scientific and Statistical Computing}, 18894 volume = {6}, 18895 number = {2}, 18896 pages = {297--313}, 18897 year = {1985}, 18898 publisher = {SIAM} 18899} 18900 18901@Article{ bicgsl_1993, 18902 author = {GERARD L.G. SLEIJPEN and DIEDERIK R. FOKKEMA}, 18903 title = {{BiCGSTAB(l)} for Linear Equations involving Unsymmetric Matrices with Complex 18904 Spectrum}, 18905 journal = {Electronic Transactions on Numerical Analysis}, 18906 volume = {1}, 18907 year = {1993}, 18908 pages = {11--32} 18909} 18910 18911@Book{ brandt2011revised, 18912 title = {Multigrid Techniques: 1984 Guide with Applications to Fluid Dynamics, Revised 18913 Edition}, 18914 author = {Achi Brandt and Oren Livne}, 18915 year = {2011}, 18916 publisher = {SIAM} 18917} 18918 18919@Article{ axelsson1990algebraic, 18920 title = {Algebraic multilevel preconditioning methods, {II}}, 18921 author = {Axelsson, O. and Vassilevski, P.S.}, 18922 journal = {SIAM Journal on Numerical Analysis}, 18923 volume = {27}, 18924 number = {6}, 18925 pages = {1569--1590}, 18926 year = {1990}, 18927 publisher = {SIAM} 18928} 18929 18930@Article{ zulehner2002analysis, 18931 title = {Analysis of iterative methods for saddle point problems: a unified approach}, 18932 author = {Zulehner, W.}, 18933 journal = {Mathematics of computation}, 18934 volume = {71}, 18935 number = {238}, 18936 pages = {479--506}, 18937 year = {2002} 18938} 18939 18940@Article{ pralet2010, 18941 author = {L. Giraud and A. Haidar and S. Pralet}, 18942 title = {Using multiple levels of parallelism to enhance the performance of domain 18943 decomposition solvers}, 18944 journal = {Parallel Computing}, 18945 volume = {36}, 18946 number = {5-6}, 18947 pages = {285--296}, 18948 year = {2010} 18949} 18950 18951@Book{ brennerscottfem, 18952 title = {The Mathematical Theory of Finite Element Methods}, 18953 author = {Susanne C. Brenner and L. Ridgway Scott}, 18954 edition = {3rd Edition}, 18955 series = {Texts in Applied Mathematics}, 18956 year = {2008}, 18957 publisher = {Springer-Verlag} 18958} 18959 18960@Book{ ortega1987iterative, 18961 title = {Iterative solution of nonlinear equations in several variables}, 18962 author = {Ortega, James M and Rheinboldt, Werner C}, 18963 volume = {30}, 18964 publisher = {Society for Industrial and Applied Mathematics}, 18965 year = {1987} 18966} 18967 18968@InBook{ rheinboldtch6, 18969 author = {Werner C. Rheinboldt}, 18970 title = {6. Combinations of Processes}, 18971 booktitle = {Methods for Solving Systems of Nonlinear Equations}, 18972 chapter = {6}, 18973 pages = {59--74}, 18974 doi = {10.1137/1.9781611970012.ch6}, 18975 year = {1998} 18976} 18977 18978@Article{ allgowerbohmerpotrarheinboldt86, 18979 author = {E. Allgower and K. B\"ohmer and F. Potra and W.~C. Rheinboldt}, 18980 title = {A Mesh-Independence Principle for Operator Equations and Their Discretizations}, 18981 journal = {SIAM Journal on Numerical Analysis}, 18982 volume = {23}, 18983 number = {1}, 18984 pages = {160-169}, 18985 year = {1986}, 18986 doi = {10.1137/0723011} 18987} 18988 18989@Article{ rheinboldt76, 18990 author = {Werner C. Rheinboldt}, 18991 title = {On measures of ill-conditioning for nonlinear equations}, 18992 journal = {Mathematics of Computation}, 18993 volume = {30}, 18994 number = {133}, 18995 pages = {104--111}, 18996 year = {1976} 18997} 18998 18999@Article{ little61, 19000 author = {John D. C. Little}, 19001 title = {A Proof for the Queuing Formula: {$L = \lambda W$}}, 19002 journal = {Operations Research}, 19003 volume = {9}, 19004 number = {3}, 19005 pages = {383--387}, 19006 note = {\url{http://www.jstor.org/stable/167570}}, 19007 year = {1961} 19008} 19009 19010@Misc{ top500, 19011 author = {{TOP500 Supercomputer Sites}}, 19012 url = {http://www.top500.org}, 19013 year = {2013} 19014} 19015 19016@Misc{ hassediagram, 19017 author = {Wikipedia}, 19018 title = {Hasse Diagram}, 19019 url = {http://en.wikipedia.org/wiki/Hasse_diagram}, 19020 note = {\url{http://en.wikipedia.org/wiki/Hasse_diagram}}, 19021 year = {2015} 19022} 19023 19024@Misc{ groupoid, 19025 author = {Wikipedia}, 19026 title = {Groupoid}, 19027 url = {https://en.wikipedia.org/wiki/Groupoid}, 19028 note = {\url{http://en.wikipedia.org/wiki/Groupoid}}, 19029 year = {2015} 19030} 19031 19032@Misc{ cwcomplex, 19033 author = {Wikipedia}, 19034 title = {{CW} complex}, 19035 url = {http://en.wikipedia.org/wiki/CW_complex}, 19036 note = {\url{http://en.wikipedia.org/wiki/CW_complex}}, 19037 year = {2015} 19038} 19039 19040@Misc{ linearalgebra, 19041 author = {Wikipedia}, 19042 title = {Linear Algebra}, 19043 url = {https://en.wikipedia.org/wiki/Linear_algebra}, 19044 note = {\url{https://en.wikipedia.org/wiki/Linear_algebra}}, 19045 year = {2015} 19046} 19047 19048@Misc{ amdahlslaw, 19049 author = {Wikipedia}, 19050 title = {Amdahl's Law}, 19051 url = {https://en.wikipedia.org/wiki/Amdahl's_law}, 19052 note = {\url{https://en.wikipedia.org/wiki/Amdahl's_law}}, 19053 year = {2015} 19054} 19055 19056@Misc{ gustafsonslaw, 19057 author = {Wikipedia}, 19058 title = {Gustafson's Law}, 19059 url = {https://en.wikipedia.org/wiki/Gustafson's_law}, 19060 note = {\url{https://en.wikipedia.org/wiki/Gustafson's_law}}, 19061 year = {2015} 19062} 19063 19064@InProceedings{ amdahl1967, 19065 title = {Validity of the Single Processor Approach to Achieving Large Scale Computing 19066 Capabilities}, 19067 author = {Gene M. Amdahl}, 19068 booktitle = {Proceedings of the April 18-20, 1967, Spring Joint Computer Conference}, 19069 series = {AFIPS '67 (Spring)}, 19070 location = {Atlantic City, New Jersey}, 19071 pages = {483--485}, 19072 numpages = {3}, 19073 doi = {10.1145/1465482.1465560}, 19074 acmid = {1465560}, 19075 publisher = {ACM}, 19076 address = {New York, NY, USA}, 19077 year = {1967} 19078} 19079 19080@Article{ gustafson1988, 19081 title = {Reevaluating {Amdahl}'s Law}, 19082 author = {Gustafson, John L.}, 19083 journal = {Communications of the ACM}, 19084 volume = {31}, 19085 number = {5}, 19086 month = may, 19087 issn = {0001-0782}, 19088 pages = {532--533}, 19089 doi = {10.1145/42411.42415}, 19090 acmid = {42415}, 19091 year = {1988} 19092} 19093 19094@Book{ eijkhout2014, 19095 title = {Introduction to High Performance Scientific Computing}, 19096 author = {Victor Eijkhout}, 19097 url = {http://pages.tacc.utexas.edu/~eijkhout/Articles/EijkhoutIntroToHPC.pdf}, 19098 publisher = {TACC}, 19099 year = {2014} 19100} 19101 19102@Article{ korelc2002multilanguage, 19103 title = {Multi-language and multi-environment generation of nonlinear finite element 19104 codes}, 19105 author = {Korelc, J.}, 19106 journal = {Engineering with Computers}, 19107 volume = {18}, 19108 number = {4}, 19109 pages = {312--327}, 19110 year = {2002}, 19111 publisher = {Springer} 19112} 19113 19114@TechReport{ taylor2011feap, 19115 title = {{FEAP}: A Finite Element Analysis Program}, 19116 subtitle = {Version 8.3 User Manual}, 19117 author = {R. L. Taylor}, 19118 year = {2011}, 19119 institution = {University of California, Berkeley} 19120} 19121 19122@Article{ bergeraftosmismurman2005, 19123 title = {Analysis of slope limiters on irregular grids}, 19124 author = {Berger, Marsha and Aftosmis, Michael J and Murman, Scott M}, 19125 journal = {AIAA paper}, 19126 volume = {490}, 19127 pages = {2005}, 19128 year = {2005} 19129} 19130 19131@InProceedings{ ferreirabridgesbrightwell08, 19132 author = {Kurt B. Ferreira and Patrick Bridges and Ron Brightwell}, 19133 title = {Characterizing Application Sensitivity to OS Interference Using Kernel-level 19134 Noise Injection}, 19135 booktitle = {Proceedings of the 2008 ACM/IEEE Conference on Supercomputing}, 19136 series = {SC '08}, 19137 year = {2008}, 19138 isbn = {978-1-4244-2835-9}, 19139 location = {Austin, Texas}, 19140 pages = {19:1--19:12}, 19141 articleno = {19}, 19142 numpages = {12}, 19143 url = {http://dl.acm.org/citation.cfm?id=1413370.1413390}, 19144 acmid = {1413390}, 19145 publisher = {IEEE Press}, 19146 address = {Piscataway, NJ} 19147} 19148 19149@Article{ banach22, 19150 author = {Stefan Banach}, 19151 title = {Sur les op\'erations dans les ensembles abstraits et leur application aux 19152 \'equations int\'egrales}, 19153 journal = {Fund. Math.}, 19154 volume = {3}, 19155 pages = {133--181}, 19156 year = {1922} 19157} 19158 19159@Article{ bangerthbursteddeheisterkronbichler2012, 19160 author = {Wolfgang Bangerth and Carsten Burstedde and Timo Heister and Martin Kronbichler}, 19161 title = {Algorithms and Data Structures for Massively Parallel Generic Adaptive Finite 19162 Element Codes}, 19163 journal = {ACM Trans. Math. Softw.}, 19164 issue_date = {December 2011}, 19165 volume = {38}, 19166 number = {2}, 19167 month = jan, 19168 year = {2012}, 19169 issn = {0098-3500}, 19170 pages = {14:1--14:28}, 19171 articleno = {14}, 19172 numpages = {28}, 19173 doi = {10.1145/2049673.2049678}, 19174 acmid = {2049678}, 19175 publisher = {ACM}, 19176 address = {New York, NY, USA}, 19177 keywords = {Adaptive mesh refinement, object-orientation, parallel algorithms, software 19178 design} 19179} 19180 19181@Article{ eisenstatwalker1994, 19182 author = {Stanley Eisenstat and Homer Walker}, 19183 title = {Globally Convergent Inexact {N}ewton Methods}, 19184 journal = {SIAM Journal on Optimization}, 19185 volume = {4}, 19186 number = {2}, 19187 pages = {393--422}, 19188 year = {1994}, 19189 doi = {10.1137/0804022} 19190} 19191 19192@Book{ blumcuckershubsmale98, 19193 title = {Complexity and Real Computation}, 19194 author = {Lenore Blum and Felipe Cucker and Michael Shub and Steve Smale}, 19195 year = {1998}, 19196 publisher = {Springer} 19197} 19198 19199@Article{ caili2011, 19200 author = {Cai, X.-C. and Li, X.}, 19201 title = {Inexact {N}ewton Methods with Restricted Additive {S}chwarz Based Nonlinear 19202 Elimination for Problems with High Local Nonlinearity}, 19203 journal = {SIAM Journal on Scientific Computing}, 19204 volume = {33}, 19205 number = {2}, 19206 pages = {746-762}, 19207 year = {2011}, 19208 doi = {10.1137/080736272} 19209} 19210 19211@Article{ cai2009, 19212 author = {X.-C. Cai}, 19213 title = { Nonlinear overlapping domain decomposition methods}, 19214 journal = {Lecture Notes in Computational Science}, 19215 volume = {70}, 19216 pages = {217-224}, 19217 year = {2009} 19218} 19219 19220@Article{ lanzkronrosewilkes1996, 19221 title = {An analysis of approximate nonlinear elimination}, 19222 author = {Lanzkron, Paul J and Rose, Donald J and Wilkes, James T}, 19223 journal = {SIAM Journal on Scientific Computing}, 19224 volume = {17}, 19225 number = {2}, 19226 pages = {538--559}, 19227 year = {1996}, 19228 publisher = {SIAM} 19229} 19230 19231@TechReport{ gropp1993sowing, 19232 title = {Users manual for bfort: Producing {F}ortran interfaces to {C} source code}, 19233 author = {Gropp, W}, 19234 year = {1995}, 19235 number = {ANL/MCS-TM-208}, 19236 institution = {Argonne National Laboratory} 19237} 19238 19239@TechReport{ gropp1993sowing2, 19240 title = {Users Manual for doctext: Producing Documentation from Source Code}, 19241 author = {Gropp, W}, 19242 year = {1995}, 19243 number = {ANL/MCS-TM-206}, 19244 institution = {Argonne National Laboratory} 19245} 19246 19247@TechReport{ gropp1993simplified, 19248 title = {Simplified Linear Equation Solvers users manual}, 19249 author = {Gropp, W and Smith, B}, 19250 year = {1993}, 19251 number = {ANL--93/8}, 19252 institution = {Argonne National Laboratory} 19253} 19254 19255@Misc{ simplifiedbsd, 19256 author = {{University of California, Berkeley}}, 19257 title = {Simplified {Berkeley} Software Distribution License}, 19258 note = {see 19259 \url{http://en.wikipedia.org/wiki/BSD_licenses#2-clause_license_.28.22Simplified_BSD_License.22_or_.22FreeBSD_License.22.29}} 19260} 19261 19262@Book{ chaconstraub14, 19263 author = {Scott Chacon and Ben Straub}, 19264 title = {Pro Git}, 19265 publisher = {Apress}, 19266 year = {2014}, 19267 pages = {456}, 19268 note = {Available online at \url{http://git-scm.com/book/}} 19269} 19270 19271@Misc{ bitbucket, 19272 author = {Atlassian}, 19273 title = {Bitbucket}, 19274 note = {Platform available from \url{http://bitbucket.org}} 19275} 19276 19277@Misc{ gitworkflows, 19278 author = {GitWorkflows}, 19279 note = {Available at 19280 \url{https://www.kernel.org/pub/software/scm/git/docs/gitworkflows.html}} 19281} 19282 19283@Misc{ figshare, 19284 author = {FigShare}, 19285 note = {Available at \url{http://palgrave.figshare.com/}} 19286} 19287 19288@InProceedings{ beazley1996swig, 19289 title = {{SWIG}: An easy to use tool for integrating scripting languages with {C} and 19290 {C++}}, 19291 author = {Beazley, David M}, 19292 booktitle = {Proceedings of the 4th USENIX Tcl/Tk workshop}, 19293 pages = {129--139}, 19294 year = {1996} 19295} 19296 19297@Misc{ softwareproductivityworkshopreport14, 19298 author = {H. Johansen and L. C. McInnes and D. Bernholdt and J. Carver and M. Heroux and R. 19299 Hornung and P. Jones and B. Lucas and A. Siegel and T. Ndousse-Fetter}, 19300 title = {Software Productivity for Extreme-Scale Science}, 19301 note = {Report on DOE Workshop, January 13-14, 2014}, 19302 url = {http://www.orau.gov/swproductivity2014/SoftwareProductivityWorkshopReport2014.pdf}, 19303 year = {2014} 19304} 19305 19306@Misc{ softwareproductivitywhitepaper13, 19307 author = {H. Johansen and D. Bernholdt and B. Collins and M. Heroux and R. Jacob and P. 19308 Jones and L. C. McInnes and J. D. Moulton and T. Ndousse-Fetter and D. Post and W. 19309 Tang}, 19310 title = {Extreme-Scale Scientific Application Software Productivity: Harnessing the Full 19311 Capability of Extreme-Scale Computing}, 19312 note = {whitepaper submitted to DOE, available via 19313 \url{http://www.orau.gov/swproductivity2014/reference.htm}}, 19314 year = {2013} 19315} 19316 19317@Misc{ ideas:project, 19318 author = {Michael Heroux and Lois Curfman McInnes and J. David {Moulton (PIs)}}, 19319 title = {{Interoperable Design of Extreme-Scale Application Software (IDEAS)}}, 19320 howpublished = {\url{http://ideas-productivity.org}}, 19321 year = {2015} 19322} 19323 19324@TechReport{ keyesmcinneswoodwardetal2012, 19325 author = {D. E. Keyes and L. C. McInnes and C. Woodward and E. Constantinescu and D. Estep 19326 and B. Sheehan}, 19327 title = {First Steps Toward a Multiphysics Exemplars and Benchmarks Suite}, 19328 institution = {Argonne National Laboratory}, 19329 number = {ANL/MCS-TM-330}, 19330 month = oct, 19331 year = {2012} 19332} 19333 19334@Misc{ sawsfs-web-page, 19335 author = {Surtai Han and Barry Smith and Hong Zhang}, 19336 title = {{{SAWs Tutorial: Fieldsplit Preconditioner}}}, 19337 note = {\url{https://www.youtube.com/watch?v=-w0fPhmZT3c}}, 19338 year = {2015} 19339} 19340 19341@Misc{ sawshk-web-page, 19342 author = {Surtai Han and Barry Smith and Hong Zhang}, 19343 title = {{{SAWs Tutorial: Hierarchical Krylov Method}}}, 19344 note = {\url{https://www.youtube.com/watch?v=hWbqppTrcOw}}, 19345 year = {2015} 19346} 19347 19348@Misc{ sawsnestk-web-page, 19349 author = {Surtai Han and Barry Smith and Hong Zhang}, 19350 title = {{{SAWs Tutorial: Nested Krylov Method}}}, 19351 note = {\url{https://www.youtube.com/watch?v=kqPXZxMOJmA}}, 19352 year = {2015} 19353} 19354 19355@Misc{ m2acs:project, 19356 author = {M. {Anitescu et al.}}, 19357 title = {{Multifaceted Mathematics for Complex Energy Systems (M2ACS) {W}eb page}}, 19358 howpublished = {\url{http://www.mcs.anl.gov/MACS}}, 19359 year = {2015} 19360} 19361 19362@Misc{ hssmn13, 19363 author = {P. Hovland and B. Smith and M. Snir and L. C. McInnes and B. Norris}, 19364 title = {Exposing and Expanding Compiler Technologies to Improve Software Productivity in 19365 Developing Mathematical Libraries and Simulation Codes}, 19366 note = {whitepaper submitted to DOE Workshop on Software Productivity for Extreme-Scale 19367 Science, available via \url{http://www.orau.gov/swproductivity2014/papers.htm}}, 19368 year = {2013} 19369} 19370 19371@Misc{ atpesc:website, 19372 key = {{Argonne Training Program for Extreme-Scale Computing}}, 19373 title = {{Argonne Training Program for Extreme-Scale Computing (ATPESC)}}, 19374 howpublished = {\url{http://extremecomputingtraining.anl.gov}}, 19375 year = {2018} 19376} 19377 19378@Article{ barraultmadaynguyenpatera2004, 19379 author = {Maxime Barrault and Yvon Maday and Ngoc Cuong Nguyen and Anthony T. Patera}, 19380 title = {An empirical interpolation method: application to efficient reduced-basis 19381 discretization of partial differential equations}, 19382 journal = {Comptes Rendus Mathematique}, 19383 volume = {339}, 19384 number = {9}, 19385 pages = {667--672}, 19386 year = {2004}, 19387 issn = {1631-073X}, 19388 doi = {10.1016/j.crma.2004.08.006} 19389} 19390 19391@Article{ simongogotsi08, 19392 title = {Materials for electrochemical capacitors}, 19393 author = {Patrice Simon and Yury Gogotsi}, 19394 journal = {Nature Materials}, 19395 volume = {7}, 19396 number = {11}, 19397 pages = {845--854}, 19398 year = {2008}, 19399 doi = {10.1038/nmat2297} 19400} 19401 19402@Article{ vladsinghrollandmelinteajayangohy14, 19403 title = {Hybrid supercapacitor-battery materials for fast electrochemical charge storage}, 19404 author = {A. Vlad and N. Singh and J. Rolland and S. Melinte and P. M. Ajayan and J.-F. 19405 Gohy}, 19406 journal = {Scientific Reports}, 19407 volume = {4}, 19408 year = {2014}, 19409 doi = {10.1038/srep04315} 19410} 19411 19412@Article{ lichengshashurinkeidar12, 19413 title = {Review of Electrochemical Capacitors Based on Carbon Nanotubes and Graphene}, 19414 author = {J. Li and X. Cheng and A. Shashurin and M. Keidar}, 19415 journal = {Graphene}, 19416 volume = {1}, 19417 number = {1}, 19418 pages = {1--13}, 19419 year = {2012}, 19420 doi = {10.4236/graphene.2012.11001} 19421} 19422 19423@Article{ miller07, 19424 title = {A Brief History of Supercapacitors}, 19425 author = {John R. Miller}, 19426 journal = {Battery and Energy Storage Technology}, 19427 pages = {61--78}, 19428 year = {2007} 19429} 19430 19431@Book{ deshpande14, 19432 title = {Ultracapacitors: Future of Energy Storage}, 19433 author = {R. P. Deshpande}, 19434 publisher = {McGraw Hill Education}, 19435 isbn = {978-9339214050}, 19436 pages = {452}, 19437 year = {2014} 19438} 19439 19440@Article{ hojowboggs10, 19441 title = {Historical introduction to capacitor technology}, 19442 author = {J. Ho and T.R. Jow and S. Boggs}, 19443 journal = {IEEE Electrical Insulation Magazine}, 19444 month = jan, 19445 volume = {26}, 19446 number = {1}, 19447 pages = {20--25}, 19448 year = {2010}, 19449 doi = {10.1109/MEI.2010.5383924}, 19450 issn = {0883-7554} 19451} 19452 19453@Article{ gillespie14, 19454 title = {A review of steric interactions of ions: Why some theories succeed and others 19455 fail to acount for ion size}, 19456 author = {Dirk Gillespie}, 19457 journal = {Microfluidics and Nanofluidics}, 19458 volume = {18}, 19459 number = {5-6}, 19460 pages = {717--738}, 19461 year = {2015} 19462} 19463 19464@Article{ gillespievaliskoboda05, 19465 author = {Dirk Gillespie and Monica Valisk\'{o} and Dezs\H{o} Boda}, 19466 title = {Density functional theory of the electrical double layer: the RFD functional}, 19467 journal = {J. Phys.: Condens. Matter}, 19468 volume = {17}, 19469 pages = {6609--6626}, 19470 year = {2005} 19471} 19472 19473@Article{ valiskobodagillespie07, 19474 author = {Monica Valisk\'{o} and Dezs\H{o} Boda and Dirk Gillespie}, 19475 title = {Selective adsorption of ions with different diameter and valence at 19476 highly-charged interfaces}, 19477 journal = {J. Phys. Chem. C}, 19478 volume = {111}, 19479 pages = {15575--15585}, 19480 year = {2007} 19481} 19482 19483@Article{ gillespie08, 19484 author = {Dirk Gillespie}, 19485 title = {Energetics of divalent selectivity in a calcium channel: the ryanodine receptor 19486 case study}, 19487 journal = {Biophys. J.}, 19488 volume = {94}, 19489 pages = {1169--1184}, 19490 year = {2008} 19491} 19492 19493@Article{ liwuwang15, 19494 title = {Osmotic Pressure and Packaging Structure of Caged DNA}, 19495 author = {Zhidong Li and Jianzhong Wu and Zhen-Gang Wang}, 19496 journal = {Biophysical Journal}, 19497 volume = {94}, 19498 number = {3}, 19499 pages = {737--746}, 19500 doi = {10.1529/biophysj.107.112508}, 19501 url = {http://www.cell.com/biophysj/abstract/S0006-3495(08)70675-1}, 19502 year = {2015} 19503} 19504 19505@Article{ gillespie12, 19506 title = {High energy conversion efficiency in nanofluidic channels}, 19507 author = {Dirk Gillespie}, 19508 journal = {Nano Letters}, 19509 volume = {12}, 19510 pages = {1410--1416}, 19511 year = {2012} 19512} 19513 19514@Article{ dieterich79, 19515 title = {Modeling of rock friction: 1. Experimental results and constitutive equations}, 19516 author = {James H. Dieterich}, 19517 journal = {Journal of Geophysical Research: Solid Earth}, 19518 volume = {84}, 19519 number = {B5}, 19520 pages = {2161--2168}, 19521 year = {1979}, 19522 publisher = {Wiley Online Library} 19523} 19524 19525@Article{ bodakovacsgillespiekristof14, 19526 title = {Selective transport through a model calcium channel studied by Local Equilibrium 19527 Monte Carlo simulations coupled to the Nernst--Planck equation}, 19528 author = {Dezs{\H{o}} Boda and R{\'o}bert Kov{\'a}cs and Dirk Gillespie and Tam{\'a}s 19529 Krist{\'o}f}, 19530 journal = {Journal of Molecular Liquids}, 19531 volume = {189}, 19532 pages = {100--112}, 19533 year = {2014}, 19534 publisher = {Elsevier} 19535} 19536 19537@Article{ brandt05, 19538 title = {Multiscale solvers and systematic upscaling in computational physics}, 19539 author = {Brandt, A}, 19540 journal = {Computer Physics Communications}, 19541 volume = {169}, 19542 number = {1}, 19543 pages = {438--441}, 19544 year = {2005}, 19545 publisher = {Elsevier} 19546} 19547 19548@Article{ rosenfeld89, 19549 title = {Free-energy model for the inhomogeneous hard-sphere fluid mixture and 19550 density-functional theory of freezing}, 19551 author = {Yaakov Rosenfeld}, 19552 journal = {Physical review letters}, 19553 volume = {63}, 19554 number = {9}, 19555 pages = {980}, 19556 year = {1989}, 19557 publisher = {APS} 19558} 19559 19560@Article{ schindlermitchellmccabecummingslevan13, 19561 title = {Adsorption of Chain Molecules in Slit-Shaped Pores: Development of a SAFT-FMT-DFT 19562 Approach}, 19563 author = {Bryan J Schindler and Lucas A Mitchell and Clare McCabe and Peter T Cummings and 19564 M Douglas LeVan}, 19565 journal = {The Journal of Physical Chemistry C}, 19566 volume = {117}, 19567 number = {41}, 19568 pages = {21337--21350}, 19569 year = {2013}, 19570 publisher = {ACS Publications} 19571} 19572 19573@Misc{ tramonto, 19574 author = {Laura Frink and et. al.}, 19575 title = {TRAMONTO 3.0 web site}, 19576 url = {https://software.sandia.gov/DFTfluids/tramonto3_0.html}, 19577 year = {2014} 19578} 19579 19580@InCollection{ zhongyuenmoresiknepley15, 19581 author = {Shijie Zhong and David A. Yuen and Louis N. Moresi and Matthew G. Knepley}, 19582 title = {Numerical Methods for Mantle Convection}, 19583 booktitle = {Treatise on Geophysics}, 19584 publisher = {Elsevier}, 19585 volume = {7}, 19586 editor = {Gerald Schubert}, 19587 edition = {Second Edition}, 19588 year = {2015} 19589} 19590 19591@Article{ richarson1911, 19592 author = {Lewis Fry Richardson}, 19593 title = {The approximate arithmetical solution by finite differences of physical problems 19594 including differential equations, with an application to the stresses in a masonry 19595 dam}, 19596 journal = {Philosophical Transactions of the Royal Society A}, 19597 volume = {210}, 19598 number = {459--470}, 19599 pages = {307--357}, 19600 doi = {10.1098/rsta.1911.0009}, 19601 year = {1911} 19602} 19603 19604@Article{ kirkwood34, 19605 author = {John G. Kirkwood}, 19606 title = {Theory of Solutions of Molecules Containing Widely Separated Charges with Special 19607 Application to Zwitterions}, 19608 journal = {The Journal of Chemical Physics}, 19609 volume = {2}, 19610 number = {7}, 19611 year = {1934} 19612} 19613 19614@TechReport{ schoof1994exodus, 19615 title = {{EXODUS II}: a finite element data model}, 19616 author = {Larry A Schoof and Victor R Yarberry}, 19617 institution = {Sandia National Laboratories}, 19618 number = {SAND92-2137}, 19619 address = {Albuquerque, NM}, 19620 year = {1994} 19621} 19622 19623@Misc{ poirier1998cgns, 19624 author = {Diane Poirier and Steven R Allmaras and Douglas R McCarthy and Matthew F Smith 19625 and Fancis Y Enomoto}, 19626 title = {The CGNS system}, 19627 note = {AIAA Paper 98-3007}, 19628 year = {1998} 19629} 19630 19631@Article{ geuzaine2009gmsh, 19632 title = {Gmsh: A 3-D finite element mesh generator with built-in pre-and post-processing 19633 facilities}, 19634 author = {Christophe Geuzaine and Jean-Fran{\c{c}}ois Remacle}, 19635 journal = {International Journal for Numerical Methods in Engineering}, 19636 volume = {79}, 19637 number = {11}, 19638 pages = {1309--1331}, 19639 year = {2009}, 19640 publisher = {Wiley Online Library} 19641} 19642 19643@Article{ si2015, 19644 title = {{TetGen}, a {Delaunay}-Based Quality Tetrahedral Mesh Generator}, 19645 author = {Hang Si}, 19646 journal = {ACM Trans. on Mathematical Software}, 19647 volume = {41}, 19648 number = {2}, 19649 month = feb, 19650 doi = {10.1145/2629697}, 19651 year = {2015} 19652} 19653 19654@TechReport{ blackerbohnhoffedwards1994, 19655 title = {CUBIT mesh generation environment. Volume 1: Users manual}, 19656 author = {Ted D Blacker and William J Bohnhoff and Tony L Edwards}, 19657 institution = {Sandia National Labs., Albuquerque, NM (United States)}, 19658 year = {1994} 19659} 19660 19661@Article{ bjorck1994, 19662 title = {Numerics of Gram-Schmidt orthogonalization}, 19663 author = {{\AA}ke Bj{\"o}rck}, 19664 journal = {Linear Algebra and Its Applications}, 19665 volume = {197}, 19666 pages = {297--316}, 19667 year = {1994}, 19668 publisher = {Elsevier} 19669} 19670 19671@PhDThesis{ yood05, 19672 author = {Charles Nelson Yood}, 19673 title = {Argonne National Laboratory and the Emergence of Computer and Computational 19674 Science, 1946--1992}, 19675 school = {The Pennsylvania State University}, 19676 month = aug, 19677 year = {2005} 19678} 19679 19680@Article{ fearnleysander79, 19681 title = {Hermann Grassmann and the Creation of Linear Algebra}, 19682 author = {Desmond Fearnley-Sander}, 19683 journal = {The American Mathematical Monthly}, 19684 volume = {86}, 19685 pages = {809--817}, 19686 url = {http://www.maa.org/sites/default/files/pdf/upload_library/22/Ford/DesmondFearnleySander.pdf}, 19687 year = {1979} 19688} 19689 19690@InCollection{ knepley2012, 19691 author = {Matthew G. Knepley}, 19692 title = {Programming Languages for Scientific Computing}, 19693 booktitle = {Encyclopedia of Applied and Computational Mathematics}, 19694 publisher = {Springer}, 19695 year = {2012}, 19696 editor = {Bj\"orn Engquist}, 19697 doi = {10.1007/978-3-540-70529-1}, 19698 url = {http://arxiv.org/abs/1209.1711} 19699} 19700 19701@InBook{ knepley2015, 19702 title = {Programming Languages for Scientific Computing}, 19703 author = {Matthew G. Knepley}, 19704 booktitle = {Encyclopedia of Applied and Computational Mathematics}, 19705 editor = {Bj{\"o}rn Engquist}, 19706 publisher = {Springer Berlin Heidelberg}, 19707 address = {Berlin, Heidelberg}, 19708 pages = {1173--1181}, 19709 isbn = {978-3-540-70529-1}, 19710 doi = {10.1007/978-3-540-70529-1_250}, 19711 year = {2015} 19712} 19713 19714@Book{ hughes2000, 19715 author = {Thomas J. R. Hughes}, 19716 title = {The Finite Element Method: Linear Static and Dynamic Finite Element Analysis}, 19717 series = {Dover Civil and Mechanical Engineering}, 19718 pages = {704}, 19719 year = {2000}, 19720 isbn = {978-0486411811}, 19721 publisher = {Dover} 19722} 19723 19724@Article{ roache2002, 19725 title = {Code verification by the method of manufactured solutions}, 19726 author = {Patrick J. Roache}, 19727 journal = {Journal of Fluids Engineering}, 19728 volume = {124}, 19729 number = {1}, 19730 pages = {4--10}, 19731 year = {2002}, 19732 publisher = {American Society of Mechanical Engineers} 19733} 19734 19735@InCollection{ rokosgorman13, 19736 title = {PRAgMaTIc - Parallel Anisotropic Adaptive Mesh Toolkit}, 19737 author = {Georgios Rokos and Gerard Gorman}, 19738 booktitle = {Facing the Multicore-Challenge III}, 19739 series = {Lecture Notes in Computer Science}, 19740 editor = {Keller, Rainer and Kramer, David and Weiss, Jan-Philipp}, 19741 publisher = {Springer Berlin Heidelberg}, 19742 volume = {7686}, 19743 pages = {143-144}, 19744 doi = {10.1007/978-3-642-35893-7_22}, 19745 isbn = {978-3-642-35892-0}, 19746 year = {2013} 19747} 19748 19749@Misc{ hdf5:homepage, 19750 author = {{The HDF Group}}, 19751 title = {The {HDF5} Homepage}, 19752 howpublished = {\url{https://www.hdfgroup.org/HDF5/}}, 19753 year = {2015} 19754} 19755 19756@Misc{ paraview:homepage, 19757 author = {Kitware}, 19758 title = {The {ParaView} Homepage}, 19759 howpublished = {\url{http://www.paraview.org/}}, 19760 year = {2015} 19761} 19762 19763@Misc{ xdmf:homepage, 19764 author = {Kitware}, 19765 title = {The Extensible Data Model and Format ({XDMF})}, 19766 howpublished = {\url{http://www.xdmf.org/}}, 19767 year = {2015} 19768} 19769 19770@Article{ cullerkarp1993, 19771 title = {LogP: Towards a realistic model of parallel computation}, 19772 author = {David Culler and Richard Karp and David Patterson and Abhijit Sahay and Klaus 19773 Erik Schauser and Eunice Santos and Ramesh Subramonian and Thorsten Von Eicken}, 19774 journal = {SIGPLAN Notices}, 19775 volume = {28}, 19776 number = {7}, 19777 pages = {1--12}, 19778 year = {1993}, 19779 publisher = {ACM} 19780} 19781 19782@Article{ aggarwalvitter1988, 19783 title = {The input/output complexity of sorting and related problems}, 19784 author = {Alok Aggarwal and Jeffrey Vitter}, 19785 journal = {Communications of the ACM}, 19786 volume = {31}, 19787 number = {9}, 19788 pages = {1116--1127}, 19789 year = {1988}, 19790 publisher = {ACM} 19791} 19792 19793@InProceedings{ czechowskibattaglinomcclanahanchandramowlishwaranvuduc2011, 19794 author = {Kenneth Czechowski and Casey Battaglino and Chris McClanahan and Aparna 19795 Chandramowlishwaran and Richard Vuduc}, 19796 title = {Balance principles for algorithm-architecture co-design}, 19797 booktitle = {Proc.~USENIX Wkshp. Hot Topics in Parallelism (HotPar)}, 19798 month = may, 19799 address = {Berkeley, CA, USA}, 19800 url = {http://www.usenix.org/events/hotpar11/tech/final_files/Czechowski.pdf}, 19801 year = {2011} 19802} 19803 19804@Article{ williamswatermanpatterson2009, 19805 title = {Roofline: an insightful visual performance model for multicore architectures}, 19806 author = {Samuel Williams and Andrew Waterman and David Patterson}, 19807 journal = {Communications of the ACM}, 19808 volume = {52}, 19809 number = {4}, 19810 pages = {65--76}, 19811 year = {2009}, 19812 publisher = {ACM} 19813} 19814 19815@Misc{ roofline-web-page, 19816 author = {Samuel Williams and {et. al.}}, 19817 title = {{R}oofline {P}erformance {M}odel}, 19818 key = {Roofline}, 19819 url = {http://crd.lbl.gov/departments/computer-science/performance-and-algorithms-research/research/roofline/}, 19820 howpublished = {\url{http://crd.lbl.gov/departments/computer-science/performance-and-algorithms-research/research/roofline/}} 19821} 19822 19823@Misc{ roofline-talk2008, 19824 author = {Samuel Williams and David Patterson}, 19825 title = {{R}oofline {P}erformance {M}odel}, 19826 key = {Roofline}, 19827 year = {2008}, 19828 note = {ParLab Summer Retreat}, 19829 url = {http://crd.lbl.gov/assets/pubs_presos/parlab08-roofline-talk.pdf}, 19830 howpublished = {\url{http://crd.lbl.gov/assets/pubs_presos/parlab08-roofline-talk.pdf}} 19831} 19832 19833@Article{ lee2006, 19834 title = {The problem with threads}, 19835 author = {Edward A Lee}, 19836 journal = {Computer}, 19837 volume = {39}, 19838 number = {5}, 19839 pages = {33--42}, 19840 year = {2006}, 19841 url = {http://ptolemy.eecs.berkeley.edu/publications/papers/06/problemwithThreads/}, 19842 publisher = {IEEE Computer Society Press} 19843} 19844 19845@Article{ hoefler2012, 19846 title = {{Optimization principles for collective neighborhood communications}}, 19847 author = {Torsten Hoefler and Timo Schneider}, 19848 journal = {International Conference for High Performance Computing, Networking, Storage and 19849 Analysis, SC}, 19850 doi = {10.1109/SC.2012.86}, 19851 isbn = {9781467308069}, 19852 issn = {21674329}, 19853 year = {2012} 19854} 19855 19856@Book{ grahamknuthpatashnik1989, 19857 title = {Concrete Mathematics}, 19858 author = {Ronald L Graham and Donald E Knuth and Oren Patashnik}, 19859 publisher = {Addison-Wesley}, 19860 year = {1989} 19861} 19862 19863@Book{ jackson1962, 19864 title = {Classical Electrodynamics}, 19865 author = {John David Jackson}, 19866 publisher = {John Wiley \& Sons}, 19867 year = {1962} 19868} 19869 19870@Article{ leveque2013, 19871 title = {Top Ten Reasons to Not Share Your Code (and why you should anyway)}, 19872 author = {Randall J. LeVeque}, 19873 journal = {SIAM News}, 19874 volume = {46}, 19875 number = {3}, 19876 month = apr, 19877 url = {http://faculty.washington.edu/rjl/pubs/topten/}, 19878 year = {2013} 19879} 19880 19881@InProceedings{ wang2014, 19882 title = {Fjos: Practical, predictable, and efficient system support for fork/join 19883 parallelism}, 19884 author = {Qi Wang and Gabriel Parmer}, 19885 booktitle = {Real-Time and Embedded Technology and Applications Symposium (RTAS), 2014 IEEE 19886 20th}, 19887 pages = {25--36}, 19888 year = {2014}, 19889 organization = {IEEE} 19890} 19891 19892@Article{ fangsaad2009, 19893 author = {Haw-ren Fang and Yousef Saad}, 19894 title = {Two classes of multisecant methods for nonlinear acceleration}, 19895 journal = {Numerical Linear Algebra with Applications}, 19896 volume = {16}, 19897 number = {3}, 19898 pages = {197--221}, 19899 year = {2009}, 19900 doi = {10.1002/nla.617} 19901} 19902 19903@Misc{ hpcchallenge, 19904 title = {HPC Challenge}, 19905 author = {Jack Dongarra and Piotr Luszczek and others}, 19906 url = {http://icl.cs.utk.edu/hpcc/hpcc_results_lat_band.cgi?display=opt}, 19907 year = {2015} 19908} 19909 19910@InProceedings{ hoeflerschneiderlumsdaine2008, 19911 title = {Accurately measuring collective operations at massive scale}, 19912 author = {Torsten Hoefler and Timo Schneider and Andrew Lumsdaine}, 19913 booktitle = {Proceedings of the 22nd IEEE International Symposium on Parallel and Distributed 19914 Processing (IPDPS)}, 19915 pages = {1--8}, 19916 year = {2008}, 19917 doi = {10.1109/IPDPS.2008.4536494}, 19918 organization = {IEEE} 19919} 19920 19921@Book{ potraptak1984, 19922 title = {Nondiscrete Induction and Iterative Processes}, 19923 author = {Florian A. Potra and Vlastimil Pt{\'a}k}, 19924 series = {Research Notes in Mathematics}, 19925 year = {1984}, 19926 publisher = {Pitman} 19927} 19928 19929@Book{ pilz1977, 19930 title = {Near-rings: the theory and its applications}, 19931 author = {G{\"u}nter Pilz}, 19932 year = {1977}, 19933 publisher = {New York} 19934} 19935 19936@Article{ birkenjameson2009, 19937 title = {{On nonlinear preconditioners in {N}ewton-{K}rylov methods for unsteady flows}}, 19938 author = {Philipp Birken and Antony Jameson}, 19939 journal = {International Journal for Numerical Methods in Fluids}, 19940 volume = {62}, 19941 number = {5}, 19942 pages = {565--573}, 19943 publisher = {John Wiley \& Sons, Ltd.}, 19944 doi = {10.1002/fld.2030}, 19945 issn = {1097-0363}, 19946 year = {2010} 19947} 19948 19949@Article{ anderson1965, 19950 title = {Iterative procedures for nonlinear integral equations}, 19951 author = {Donald G Anderson}, 19952 journal = {Journal of the ACM (JACM)}, 19953 volume = {12}, 19954 number = {4}, 19955 pages = {547--560}, 19956 year = {1965}, 19957 publisher = {ACM} 19958} 19959 19960@Article{ ptak1966, 19961 title = {Some metric aspects of the open mapping and closed graph theorems}, 19962 author = {Vlastimil Pt{\'a}k}, 19963 journal = {Mathematische Annalen}, 19964 volume = {163}, 19965 number = {2}, 19966 pages = {95--104}, 19967 year = {1966}, 19968 publisher = {Springer} 19969} 19970 19971@Article{ ptak1974, 19972 title = {A quantitative refinement of the closed graph theorem}, 19973 author = {Vlastimil Pt{\'a}k}, 19974 journal = {Czechoslovak Mathematical Journal}, 19975 volume = {24}, 19976 number = {3}, 19977 pages = {503--506}, 19978 year = {1974}, 19979 publisher = {Institute of Mathematics, Academy of Sciences of the Czech Republic} 19980} 19981 19982@Article{ ptak1975, 19983 title = {The rate of convergence of {Newton's} process}, 19984 author = {Vlastimil Pt{\'a}k}, 19985 journal = {Numerische Mathematik}, 19986 volume = {25}, 19987 number = {3}, 19988 pages = {279--285}, 19989 year = {1975}, 19990 publisher = {Springer} 19991} 19992 19993@Article{ ptak1976, 19994 title = {Nondiscrete mathematical induction and iterative existence proofs}, 19995 author = {Vlastimil Pt{\'a}k}, 19996 journal = {Linear algebra and its applications}, 19997 volume = {13}, 19998 number = {3}, 19999 pages = {223--238}, 20000 year = {1976}, 20001 publisher = {Elsevier} 20002} 20003 20004@Article{ ptak1977, 20005 title = {What should be a rate of convergence?}, 20006 author = {Vlastimil Pt{\'a}k}, 20007 journal = {RAIRO-Analyse num{\'e}rique}, 20008 volume = {11}, 20009 number = {3}, 20010 pages = {279--286}, 20011 year = {1977} 20012} 20013 20014@Article{ potraptak1980, 20015 title = {Sharp error bounds for {Newton's} process}, 20016 author = {Florian A Potra and Vlastimil Pt{\'a}k}, 20017 journal = {Numerische Mathematik}, 20018 volume = {34}, 20019 number = {1}, 20020 pages = {63--72}, 20021 year = {1980}, 20022 publisher = {Springer} 20023} 20024 20025@Article{ liesen2014, 20026 title = {Pt\'ak's nondiscrete induction and its application to matrix iterations}, 20027 author = {J{\"o}rg Liesen}, 20028 journal = {IMA Journal of Numerical Analysis}, 20029 doi = {10.1093/imanum/drv037}, 20030 archiveprefix = {arXiv}, 20031 eprint = {1405.2683}, 20032 primaryclass = {math-na}, 20033 year = {2015} 20034} 20035 20036@Book{ traub1964, 20037 title = {Iterative Methods for the Solution of Equations}, 20038 author = {Joseph F Traub}, 20039 year = {1964}, 20040 publisher = {Prentice-Hall, Englewood Cliffs, NJ} 20041} 20042 20043@InProceedings{ shalfvecpar2010, 20044 title = {Exascale Computing Technology Challenges}, 20045 author = {John Shalf and Sudip Dosanjh and John Morrison}, 20046 booktitle = {J.M.L.M. Palma et al. (Eds.): VECPAR 2010, LNCS 6449}, 20047 pages = {1–-25}, 20048 year = {2010} 20049} 20050 20051@Article{ frechet1907, 20052 title = {Sur les ensembles de fonctions et les op\'erations lin\'eaires}, 20053 author = {Maurice Ren\'e Fr\'echet}, 20054 journal = {C. R. Acad. Sci. Paris}, 20055 volume = {144}, 20056 pages = {1414--1416}, 20057 year = {1907} 20058} 20059 20060@Article{ riesz1907, 20061 title = {Sur une esp\'ece de g\'eom\'etrie analytique des syst\'emes de fonctions sommables}, 20062 author = {Frigyes Riesz}, 20063 journal = {C. R. Acad. Sci. Paris}, 20064 volume = {144}, 20065 pages = {1409--1411}, 20066 year = {1907} 20067} 20068 20069@Article{ riesz1909, 20070 title = {Sur les op\'erations fonctionnelles lin\'eaires}, 20071 author = {Frigyes Riesz}, 20072 journal = {C. R. Acad. Sci. Paris}, 20073 volume = {149}, 20074 pages = {974--977}, 20075 year = {1909} 20076} 20077 20078@Misc{ rieszmarkovkakutanirepresentationtheorem, 20079 author = {Wikipedia}, 20080 title = {Riesz-Markov-Kakutani Representation Theorem}, 20081 url = {http://en.wikipedia.org/wiki/Riesz-Markov-Kakutani_representation_theorem}, 20082 note = {\url{http://en.wikipedia.org/wiki/Riesz-Markov-Kakutani_representation_theorem}}, 20083 year = {2015} 20084} 20085 20086@Article{ markov1938, 20087 title = {On mean values and exterior densities}, 20088 author = {Andrey Markov}, 20089 journal = {Rec. Math. Moscou}, 20090 volume = {4}, 20091 pages = {165--190}, 20092 year = {1938} 20093} 20094 20095@Article{ kakutani1941, 20096 title = {Concrete representation of abstract {(M)}-spaces. (A characterization of the 20097 space of continuous functions.)}, 20098 author = {Shizuo Kakutani}, 20099 journal = {Ann. of Math.}, 20100 volume = {2}, 20101 number = {42}, 20102 pages = {994--1024}, 20103 doi = {10.2307/1968778}, 20104 year = {1941} 20105} 20106 20107@Article{ michoskimeyersonisaacwaelbroeck2014, 20108 title = {Discontinuous Galerkin methods for plasma physics in the scrape-off layer of 20109 tokamaks}, 20110 author = {Craig Michoski and D. Meyerson and Tobin Isaac and F. Waelbroeck}, 20111 journal = {Journal of Computational Physics}, 20112 volume = {274}, 20113 pages = {898--919}, 20114 year = {2014}, 20115 publisher = {Elsevier} 20116} 20117 20118@InProceedings{ bursteddeghattasgurnisisaacstadlerwarburtonwilcox2010, 20119 title = {Extreme-scale AMR}, 20120 author = {Carsten Burstedde and Omar Ghattas and Michael Gurnis and Tobin Isaac and Georg 20121 Stadler and Tim Warburton and Lucas Wilcox}, 20122 booktitle = {Proceedings of the 2010 ACM/IEEE International Conference for High Performance 20123 Computing, Networking, Storage and Analysis}, 20124 pages = {1--12}, 20125 year = {2010}, 20126 organization = {IEEE Computer Society}, 20127 doi = {10.1109/SC.2010.25} 20128} 20129 20130@InProceedings{ isaacbursteddeghattas2012, 20131 title = {Low-cost parallel algorithms for 2: 1 octree balance}, 20132 author = {Tobin Isaac and Carsten Burstedde and Omar Ghattas}, 20133 booktitle = {Parallel \& Distributed Processing Symposium (IPDPS), 2012 IEEE 26th 20134 International}, 20135 pages = {426--437}, 20136 year = {2012}, 20137 organization = {IEEE}, 20138 doi = {10.1109/IPDPS.2012.47} 20139} 20140 20141@Article{ isaacpetrastadlerghattas2015, 20142 title = {Scalable and efficient algorithms for the propagation of uncertainty from data 20143 through inference to prediction for large-scale problems, with application to flow 20144 of the {Antarctic} ice sheet}, 20145 author = {Tobin Isaac and Noemi Petra and Georg Stadler and Omar Ghattas}, 20146 journal = {Journal of Computational Physics}, 20147 volume = {296}, 20148 pages = {348--368}, 20149 year = {2015}, 20150 publisher = {Elsevier}, 20151 doi = {10.1016/j.jcp.2015.04.047} 20152} 20153 20154@Article{ isaacbursteddewilcoxghattas2015, 20155 title = {Recursive Algorithms for Distributed Forests of Octrees}, 20156 author = {Tobin Isaac and Carsten Burstedde and Lucas C Wilcox and Omar Ghattas}, 20157 journal = {SIAM Journal on Scientific Computing}, 20158 volume = {37}, 20159 number = {5}, 20160 pages = {C497-C531}, 20161 eprint = {1406.0089}, 20162 eprinttype = {arXiv}, 20163 year = {2015}, 20164 doi = {10.1137/140970963} 20165} 20166 20167@Article{ isaacstadlerghattas2015, 20168 title = {Solution of nonlinear {S}tokes equations discretized by high-order finite 20169 elements on nonconforming and anisotropic meshes, with application to ice sheet 20170 dynamics}, 20171 author = {Isaac, Tobin and Stadler, Georg and Ghattas, Omar}, 20172 journal = {SIAM Journal on Scientific Computing}, 20173 number = {6}, 20174 pages = {804--833}, 20175 volume = {37}, 20176 year = {2015}, 20177 doi = {10.1137/140974407} 20178} 20179 20180@InProceedings{ rudimalossiisaacstadlergurnisstaarineichenbekascurionighattas2015, 20181 title = {An extreme-scale implicit solver for complex {PDEs}: highly heterogeneous flow in 20182 earth's mantle}, 20183 author = {Johann Rudi and A Cristiano I Malossi and Tobin Isaac and Georg Stadler and 20184 Michael Gurnis and Peter WJ Staar and Yves Ineichen and Costas Bekas and 20185 Alessandro Curioni and Omar Ghattas}, 20186 booktitle = {Proceedings of the International Conference for High Performance Computing, 20187 Networking, Storage and Analysis}, 20188 pages = {5}, 20189 year = {2015}, 20190 organization = {ACM}, 20191 doi = {10.1145/2807591.2807675} 20192} 20193 20194@Article{ bunchhopcroft1974, 20195 title = {Triangular factorization and inversion by fast matrix multiplication}, 20196 author = {James R Bunch and John E Hopcroft}, 20197 journal = {Mathematics of Computation}, 20198 volume = {28}, 20199 number = {125}, 20200 pages = {231--236}, 20201 doi = {10.2307/2005828}, 20202 year = {1974} 20203} 20204 20205@Article{ nemirovsky1991, 20206 title = {On optimality of Krylov's information when solving linear operator equations}, 20207 author = {A.S Nemirovsky}, 20208 journal = {Journal of Complexity}, 20209 volume = {7}, 20210 number = {2}, 20211 pages = {121--130}, 20212 doi = {10.1016/0885-064X(91)90001-E}, 20213 year = {1991} 20214} 20215 20216@Misc{ siamcseprize, 20217 title = {{SIAM/ACM} {P}rize in {C}omputational {S}cience and {E}ngineering}, 20218 key = {{SIAM/ACM} {P}rize in {C}omputational {S}cience and {E}ngineering}, 20219 url = {https://www.siam.org/prizes/sponsored/cse.php}, 20220 howpublished = {\url{https://www.siam.org/prizes/sponsored/cse.php}}, 20221 year = {2015} 20222} 20223 20224@Article{ rathgeber2017, 20225 title = {Firedrake: automating the finite element method by composing abstractions}, 20226 author = {Rathgeber, Florian and Ham, David A and Mitchell, Lawrence and Lange, Michael and 20227 Luporini, Fabio and McRae, Andrew TT and Bercea, Gheorghe-Teodor and Markall, 20228 Graham R and Kelly, Paul HJ}, 20229 archiveprefix = {arXiv}, 20230 journal = {ACM Transaction on Mathematical Software}, 20231 eprint = {1501.01809}, 20232 volume = {43}, 20233 issue = {3}, 20234 number = {24}, 20235 year = {2017}, 20236 url = {http://arxiv.org/abs/1501.01809} 20237} 20238 20239@Article{ kirby2006b, 20240 title = {Topological optimization of the evaluation of finite element matrices}, 20241 author = {Robert C Kirby and Anders Logg and L Ridgway Scott and Andy R. Terrel}, 20242 journal = {SIAM Journal on Scientific Computing}, 20243 volume = {28}, 20244 number = {1}, 20245 pages = {224--240}, 20246 year = {2006}, 20247 publisher = {SIAM} 20248} 20249 20250@Article{ luporini2015, 20251 author = {Luporini, Fabio and Varbanescu, Ana Lucia and Rathgeber, Florian and Bercea, 20252 Gheorghe-Teodor and Ramanujam, J. and Ham, David A. and Kelly, Paul H. J.}, 20253 title = {Cross-Loop Optimization of Arithmetic Intensity for Finite Element Local 20254 Assembly}, 20255 journal = {ACM Trans. Archit. Code Optim.}, 20256 issue_date = {January 2015}, 20257 volume = {11}, 20258 number = {4}, 20259 month = jan, 20260 year = {2015}, 20261 issn = {1544-3566}, 20262 pages = {57:1--57:25}, 20263 articleno = {57}, 20264 numpages = {25}, 20265 doi = {10.1145/2687415}, 20266 acmid = {2687415}, 20267 publisher = {ACM}, 20268 address = {New York, NY, USA}, 20269 keywords = {Finite element integration, SIMD vectorization, compilers, local assembly, 20270 optimizations} 20271} 20272 20273@Article{ markall2012, 20274 title = {Finite element assembly strategies on multi- and many-core architectures}, 20275 author = {Markall, G. R. and Slemmer, A. and Ham, D. A. and Kelly, P. H. J. and Cantwell, 20276 C. D. and Sherwin, S. J.}, 20277 journal = {International Journal for Numerical Methods in Fluids}, 20278 year = {2013}, 20279 volume = {71}, 20280 pages = {80--97}, 20281 doi = {10.1002/fld.3648} 20282} 20283 20284@Article{ markall2010, 20285 title = {Towards generating optimised finite element solvers for GPUs from high-level 20286 specifications}, 20287 author = {Graham R. Markall and David A. Ham and Paul H. J. Kelly}, 20288 journal = {Procedia Computer Science}, 20289 volume = {1}, 20290 number = {1}, 20291 pages = {1815--1823}, 20292 year = {2010}, 20293 note = {{ICCS} 2010}, 20294 doi = {10.1016/j.procs.2010.04.203} 20295} 20296 20297@Article{ longkirbywaanders2010, 20298 title = {Unified embedded parallel finite element computations via software-based 20299 Fr{\'e}chet differentiation}, 20300 author = {Kevin Long and Robert Kirby and Bart van Bloemen Waanders}, 20301 journal = {SIAM Journal on Scientific Computing}, 20302 volume = {32}, 20303 number = {6}, 20304 pages = {3323--3351}, 20305 year = {2010}, 20306 publisher = {SIAM} 20307} 20308 20309@Article{ kirby2010, 20310 title = {From functional analysis to iterative methods}, 20311 author = {Robert C Kirby}, 20312 journal = {SIAM review}, 20313 volume = {52}, 20314 number = {2}, 20315 pages = {269--293}, 20316 year = {2010}, 20317 publisher = {SIAM} 20318} 20319 20320@Article{ kirby2014, 20321 title = {Low-Complexity Finite Element Algorithms for the de Rham Complex on Simplices}, 20322 author = {Robert C Kirby}, 20323 journal = {SIAM Journal on Scientific Computing}, 20324 volume = {36}, 20325 number = {2}, 20326 pages = {A846--A868}, 20327 year = {2014}, 20328 publisher = {SIAM} 20329} 20330 20331@Article{ kirby2011, 20332 title = {Fast simplicial finite element algorithms using Bernstein polynomials}, 20333 author = {Robert C Kirby}, 20334 journal = {Numerische Mathematik}, 20335 volume = {117}, 20336 number = {4}, 20337 pages = {631--652}, 20338 year = {2011}, 20339 publisher = {Springer} 20340} 20341 20342@Article{ arnoldfalkwinther2006, 20343 title = {Finite element exterior calculus, homological techniques, and applications}, 20344 author = {Arnold, Douglas N and Falk, Richard S and Winther, Ragnar}, 20345 journal = {Acta numerica}, 20346 volume = {15}, 20347 pages = {1--155}, 20348 year = {2006}, 20349 publisher = {Cambridge Univ Press} 20350} 20351 20352@Article{ arnoldlogg2014, 20353 title = {Periodic table of the finite elements}, 20354 author = {Douglas Arnold and Anders Logg}, 20355 month = nov, 20356 journal = {SIAM News}, 20357 year = {2014} 20358} 20359 20360@Article{ janssonhoffmanjansson2012, 20361 title = {Framework for massively parallel adaptive finite element computational fluid 20362 dynamics on tetrahedral meshes}, 20363 author = {Jansson, Niclas and Hoffman, Johan and Jansson, Johan}, 20364 journal = {SIAM Journal on Scientific Computing}, 20365 volume = {34}, 20366 number = {1}, 20367 pages = {C24--C41}, 20368 year = {2012}, 20369 publisher = {SIAM} 20370} 20371 20372@Article{ rogneshamcottermcrae2013, 20373 title = {Automating the solution of PDEs on the sphere and other manifolds in FEniCS 1.2}, 20374 author = {Rognes, Marie E and Ham, David A and Cotter, Colin J and McRae, Andrew TT}, 20375 journal = {Geoscientific Model Development}, 20376 volume = {6}, 20377 number = {6}, 20378 pages = {2099--2119}, 20379 year = {2013}, 20380 publisher = {Copernicus GmbH} 20381} 20382 20383@Book{ loggmardalwells2012, 20384 title = {Automated solution of differential equations by the finite element method: The 20385 FEniCS book}, 20386 author = {Logg, Anders and Mardal, Kent-Andre and Wells, Garth}, 20387 volume = {84}, 20388 year = {2012}, 20389 publisher = {Springer Science \& Business Media} 20390} 20391 20392@Article{ cotterkirby2014, 20393 title = {Mixed finite elements for global tide models}, 20394 author = {Colin J Cotter and Robert C Kirby}, 20395 archiveprefix = {arXiv}, 20396 journal = {Submitted}, 20397 eprint = {1410.0045}, 20398 year = {2014}, 20399 url = {http://arxiv.org/abs/1410.0045} 20400} 20401 20402@Article{ kirbykieu2015, 20403 title = {Symplectic-mixed finite element approximation of linear acoustic wave equations}, 20404 author = {Robert C Kirby and Thinh Tri Kieu}, 20405 journal = {Numerische Mathematik}, 20406 volume = {130}, 20407 number = {2}, 20408 pages = {257--291}, 20409 year = {2015}, 20410 publisher = {Springer} 20411} 20412 20413@Article{ brennankirby2015, 20414 title = {Finite element approximation and preconditioners for a coupled thermo-acoustic 20415 model}, 20416 author = {Brian Brennan and Robert C Kirby}, 20417 journal = {Submitted to Computers and Mathematics with Applications}, 20418 year = {2015} 20419} 20420 20421@Article{ howlekirbydillon2013, 20422 title = {Block preconditioners for coupled physics problems}, 20423 author = {Victoria E Howle and Robert C Kirby and Geoffrey Dillon}, 20424 journal = {SIAM Journal on Scientific Computing}, 20425 volume = {35}, 20426 number = {5}, 20427 pages = {S368--S385}, 20428 year = {2013}, 20429 publisher = {SIAM} 20430} 20431 20432@Book{ malekstrakos2014, 20433 title = {Preconditioning and the conjugate gradient method in the context of solving 20434 PDEs}, 20435 author = {Josef M{\'a}lek and Zden\u{e}k Strako\u{s}}, 20436 volume = {1}, 20437 year = {2014}, 20438 publisher = {SIAM} 20439} 20440 20441@Article{ desturler1995, 20442 title = {Reducing the effect of global communication in GMRES(m) and \{CG\} on parallel 20443 distributed memory computers}, 20444 author = {E. de Sturler and H.A. van der Vorst}, 20445 journal = {Applied Numerical Mathematics}, 20446 volume = {18}, 20447 number = {4}, 20448 pages = {441--459}, 20449 year = {1995}, 20450 doi = {10.1016/0168-9274(95)00079-A} 20451} 20452 20453@Article{ velicmaymoresi2009, 20454 title = {A fast robust algorithm for computing discrete voronoi diagrams}, 20455 author = {Velic, Mirko and May, Dave and Moresi, Louis}, 20456 journal = {Journal of Mathematical Modelling and Algorithms}, 20457 volume = {8}, 20458 number = {3}, 20459 pages = {343--355}, 20460 year = {2009}, 20461 publisher = {Springer} 20462} 20463 20464@Article{ may2012, 20465 title = {Volume reconstruction of point cloud data sets derived from computational 20466 geodynamic simulations}, 20467 author = {May, DA}, 20468 journal = {Geochemistry, Geophysics, Geosystems}, 20469 volume = {13}, 20470 number = {5}, 20471 year = {2012}, 20472 publisher = {Wiley Online Library} 20473} 20474 20475@Article{ quenettehodkinson2010, 20476 title = {StgDomain--scalable parallel domain software components for particle-in-cell 20477 finite element methods}, 20478 author = {Quenette, Steve and Hodkinson, Luke}, 20479 journal = {Concurrency and Computation: Practice and Experience}, 20480 volume = {22}, 20481 number = {12}, 20482 pages = {1593--1603}, 20483 year = {2010}, 20484 publisher = {Wiley Online Library} 20485} 20486 20487@Book{ velic2005, 20488 title = {Gauge Invariant Integration and Perturbation of Petrov Type D Spacetimes}, 20489 author = {Velic, Mirko}, 20490 year = {2005}, 20491 publisher = {Monash University} 20492} 20493 20494@Article{ velicknepleymay2016, 20495 title = {Numerically Stable Exact Solutions for Variable-Viscosity Stokes Equations}, 20496 author = {Mirko Velic and Louis Moresi and Dave May and Matthew Knepley}, 20497 note = {in preparation}, 20498 year = {2016} 20499} 20500 20501@Article{ traubwozniakowski1979, 20502 title = {Convergence and complexity of Newton iteration for operator equations}, 20503 author = {Joseph Frederick Traub and H. Wo{\'z}niakowski}, 20504 journal = {Journal of the ACM (JACM)}, 20505 volume = {26}, 20506 number = {2}, 20507 pages = {250--258}, 20508 year = {1979}, 20509 publisher = {ACM} 20510} 20511 20512@Article{ sterck2013, 20513 title = {Steepest descent preconditioning for nonlinear {GMRES} optimization}, 20514 author = {Hans De Sterck}, 20515 journal = {Numerical Linear Algebra with Applications}, 20516 volume = {20}, 20517 number = {3}, 20518 pages = {453--471}, 20519 year = {2013} 20520} 20521 20522@Article{ sterckwinlaw2015, 20523 title = {A nonlinearly preconditioned conjugate gradient algorithm for {rank-R} canonical 20524 tensor approximation}, 20525 author = {Hans De Sterck and Manda Winlaw}, 20526 journal = {Numerical Linear Algebra with Applications}, 20527 volume = {22}, 20528 number = {3}, 20529 pages = {410--432}, 20530 year = {2015} 20531} 20532 20533@Article{ sterckhowse2015, 20534 title = {Nonlinearly preconditioned optimization on {Grassman} manifolds for computing 20535 approximate {Tucker} tensor decompositions}, 20536 author = {Hans De Sterck and Alexander Howse}, 20537 journal = {SIAM Journal on Scientific Computing}, 20538 note = {submitted}, 20539 year = {2015} 20540} 20541 20542@Book{ ladevezesimmonds1999, 20543 title = {Nonlinear computational structural mechanics: {N}ew approaches and 20544 non-incremental methods of calculation}, 20545 author = {P. Ladev{\`e}ze and J.G. Simmonds}, 20546 series = {{M}echanical {E}ngineering {S}eries}, 20547 url = {http://books.google.com/books?id=McZRAAAAMAAJ}, 20548 isbn = {9780387985947}, 20549 lccn = {98029990}, 20550 year = {1999}, 20551 publisher = {Springer} 20552} 20553 20554@InProceedings{ walkerwoodwardyang2010, 20555 title = {An accelerated fixed-point iteration for solution of variably saturated flow}, 20556 author = {Homer F Walker and Carol S Woodward and Ulrike M Yang}, 20557 booktitle = {Proc. XVIII International Conference on Water Resources, Barcelona}, 20558 year = {2010} 20559} 20560 20561@Article{ lottwalkerwoodwardyang2012, 20562 title = {An accelerated {P}icard method for nonlinear systems related to variably 20563 saturated flow}, 20564 author = {P. A. Lott and H. F. Walker and C. S. Woodward and U. M. Yang}, 20565 journal = {Advances in Water Resources}, 20566 volume = {38}, 20567 number = {0}, 20568 pages = {92--101}, 20569 doi = {10.1016/j.advwatres.2011.12.013}, 20570 year = {2012} 20571} 20572 20573@TechReport{ mohrrude1998, 20574 title = {Communication Reduced Parallel Multigrid: Analysis and Experiments}, 20575 author = {Marcus Mohr and Ulrich R\"ude}, 20576 type = {Technical Report}, 20577 number = {394}, 20578 institution = {University of Augsburg}, 20579 year = {1998} 20580} 20581 20582@InProceedings{ mohr2000, 20583 title = {Low Communication Parallel Multigrid}, 20584 author = {Mohr, Marcus}, 20585 booktitle = {Euro-Par 2000 Parallel Processing}, 20586 pages = {806--814}, 20587 year = {2000}, 20588 organization = {Springer} 20589} 20590 20591@Article{ brandtdiskin1994, 20592 title = {Multigrid solvers on decomposed domains}, 20593 author = {Achi Brandt and Boris Diskin}, 20594 journal = {Contemporary Mathematics}, 20595 volume = {157}, 20596 year = {1994}, 20597 publisher = {AMERICAN MATHEMATICAL SOCIETY} 20598} 20599 20600@InProceedings{ prabhuetal2011, 20601 title = {A Survey of the Practice of Computational Science}, 20602 author = {Prabhu, Prakash and Jablin, Thomas B. and Raman, Arun and Zhang, Yun and Huang, 20603 Jialu and Kim, Hanjun and Johnson, Nick P. and Liu, Feng and Ghosh, Soumyadeep and 20604 Beard, Stephen and Oh, Taewook and Zoufaly, Matthew and Walker, David and August, 20605 David I.}, 20606 booktitle = {State of the Practice Reports}, 20607 series = {SC '11}, 20608 year = {2011}, 20609 isbn = {978-1-4503-1139-7}, 20610 location = {Seattle, Washington}, 20611 pages = {19:1--19:12}, 20612 articleno = {19}, 20613 numpages = {12}, 20614 doi = {10.1145/2063348.2063374}, 20615 acmid = {2063374}, 20616 publisher = {ACM}, 20617 address = {New York, NY, USA} 20618} 20619 20620@PhDThesis{ dinarthesis1979, 20621 title = {Fast methods for the numerical solution of boundary value problems}, 20622 author = {N. Dinar}, 20623 school = {Weizmann Institute of Science}, 20624 year = {1979} 20625} 20626 20627@Article{ thomasdiskinbrandt2001, 20628 title = {Textbook multigrid efficiency for the incompressible Navier--Stokes equations: 20629 high Reynolds number wakes and boundary layers}, 20630 author = {James L Thomas and Boris Diskin and Achi Brandt}, 20631 journal = {Computers \& fluids}, 20632 volume = {30}, 20633 number = {7}, 20634 pages = {853--874}, 20635 year = {2001}, 20636 publisher = {Elsevier} 20637} 20638 20639@Article{ greenbaumptakstrakos1996, 20640 title = {Any nonincreasing convergence curve is possible for {GMRES}}, 20641 author = {Anne Greenbaum and Vlastimil Pt{\'a}k and Zden{\v{e}}k Strako{\v{s}}}, 20642 journal = {SIAM Journal on Matrix Analysis and Applications}, 20643 volume = {17}, 20644 number = {3}, 20645 pages = {465--469}, 20646 year = {1996}, 20647 publisher = {SIAM} 20648} 20649 20650@Article{ nangiapatankarbhalla2019, 20651 title = {A {DLM} immersed boundary method based wave-structure interaction solver for high 20652 density ratio multiphase flows}, 20653 author = {Nishant Nangia and Neelesh A Patankar and Amneet Pal Singh Bhalla}, 20654 journal = {Journal of Computational Physics}, 20655 volume = {398}, 20656 pages = {108804}, 20657 year = {2019} 20658} 20659 20660@Article{ bhallanangiadafnakisbraccomattiazzo2019, 20661 title = {Simulating water-entry/exit problems using {Eulerian}-{Lagrangian} and 20662 fully-{Eulerian} fictitious domain methods within the open-source {IBAMR} 20663 library}, 20664 author = {Amneet Pal Singh Bhalla and Nishant Nangia and Panagiotis Dafnakis and Giovanni 20665 Bracco and Giuliana Mattiazzo}, 20666 journal = {Applied Ocean Research}, 20667 note = {In press}, 20668 year = {2019} 20669} 20670 20671@Article{ bhallagriffithpatankardonev2013, 20672 title = {A minimally-resolved immersed boundary model for reaction-diffusion problems}, 20673 author = {Amneet Pal Singh Bhalla and Boyce E. Griffith and Neelesh A. Patankar and 20674 Alexander Donev}, 20675 journal = {Journal of Chemical Physics}, 20676 volume = {139}, 20677 number = {21}, 20678 pages = {214112}, 20679 year = {2013} 20680} 20681 20682@Article{ bhallabalegriffithpatankar2014, 20683 title = {Fully resolved immersed electrohydrodynamics for particle motion, 20684 electrolocation, and self-propulsion}, 20685 author = {Amneet Pal Singh Bhalla and R. Bale and Boyce E. Griffith and Neelesh A. 20686 Patankar}, 20687 journal = {Journal of Computational Physics}, 20688 volume = {256}, 20689 pages = {88--108}, 20690 year = {2014} 20691} 20692 20693@Article{ usabiagakallemovdelmottebhallagriffithdonev2016, 20694 title = {Hydrodynamics of suspensions of passive and active rigid particles: a rigid 20695 multiblob approach}, 20696 author = {F. Balboa Usabiaga and B. Kallemov and B. Delmotte and Amneet Pal Singh Bhalla 20697 and Boyce E. Griffith and Alexander Donev}, 20698 journal = {Communications in Applied Mathematics and Computational Science}, 20699 volume = {11}, 20700 number = {2}, 20701 pages = {217--296}, 20702 year = {2016} 20703} 20704 20705@Article{ koubhallagriffithpandolfinokahrilaspatankar2015, 20706 title = {A fully resolved active musculo-mechanical model for esophageal transport}, 20707 author = {W. Kou and Amneet Pal Singh Bhalla and Boyce E. Griffith and J.E. Pandolfino and 20708 P.J. Kahrilas and Neelesh A. Patankar}, 20709 journal = {Journal of Computational Physics}, 20710 volume = {298}, 20711 pages = {446--465}, 20712 year = {2015} 20713} 20714 20715@Article{ balenevelnbhallamaciverpatankar2015, 20716 title = {Convergent evolution of mechanically optimal locomotion in aquatic invertebrates 20717 and vertebrates}, 20718 author = {R. Bale and I. D. Neveln and Amneet Pal Singh Bhalla and M.A. MacIver and Neelesh 20719 A. Patankar}, 20720 journal = {PLoS Biology}, 20721 volume = {13}, 20722 number = {4}, 20723 pages = {1--22}, 20724 year = {2015} 20725} 20726 20727@Article{ balehaobhallapatankar2014, 20728 title = {Energy efficiency and allometry of movement of swimming and flying animals}, 20729 author = {Rahul Bale and Max Hao and Amneet Pal Singh Bhalla and Neelesh A Patankar}, 20730 journal = {Proceedings of the National Academy of Sciences}, 20731 volume = {111}, 20732 number = {21}, 20733 pages = {7517--7521}, 20734 year = {2014} 20735} 20736 20737@Article{ bhallabalegriffithpatankar2013, 20738 title = {A unified mathematical framework and an adaptive numerical method for 20739 fluid--structure interaction with rigid, deforming, and elastic bodies}, 20740 author = {Amneet Pal Singh Bhalla and Rahul Bale and Boyce E Griffith and Neelesh A 20741 Patankar}, 20742 journal = {Journal of Computational Physics}, 20743 volume = {250}, 20744 pages = {446--476}, 20745 year = {2013}, 20746 publisher = {Elsevier} 20747} 20748 20749@Article{ takeikatz2013, 20750 title = {Consequences of viscous anisotropy in a deforming, two-phase aggregate. Part 1. 20751 Governing equations and linearized analysis}, 20752 author = {Yasuko Takei and Richard F. Katz}, 20753 journal = {Journal of Fluid Mechanics}, 20754 volume = {734}, 20755 issn = {1469-7645}, 20756 pages = {424--455}, 20757 numpages = {32}, 20758 doi = {10.1017/jfm.2013.482}, 20759 month = nov, 20760 year = {2013} 20761} 20762 20763@Misc{ stewart2011, 20764 title = {Fredholm, Hilbert, Schmidt: Three Fundamental Papers on Integral Equations}, 20765 author = {G. W. Stewart}, 20766 note = {Translated with commentary by G. W. Stewart}, 20767 url = {http://www.cs.umd.edu/~stewart/FHS.pdf}, 20768 year = {2011} 20769} 20770 20771@Article{ douglisnirenberg1955, 20772 title = {nterior Estimates for Elliptic Systems of Partial Differential Equations}, 20773 author = {Avron Douglis and Louis Nirenberg}, 20774 journal = {Communications on Pure and Applied Mathematics}, 20775 volume = {8}, 20776 pages = {503--538}, 20777 year = {1955} 20778} 20779 20780@Article{ gorelickgalunsharonbasribrandt2006, 20781 title = {Shape Representation and Classification Using the Poisson Equation}, 20782 author = {Lena Gorelick and Meirav Galun and Eitan Sharon and Ronen Basri and Achi Brandt}, 20783 journal = {IEEE Transactions on Pattern Analysis and Machine Intelligence}, 20784 volume = {28}, 20785 number = {12}, 20786 pages = {1991--2005}, 20787 year = {2006} 20788} 20789 20790@Article{ salsbury2006, 20791 title = {Analysis of errors in {Still's} equation for macromolecular electrostatic 20792 solvation energies}, 20793 author = {Freddie R. Salsbury Jr.}, 20794 journal = {Molecular Physics}, 20795 volume = {104}, 20796 number = {08}, 20797 pages = {1299--1309}, 20798 year = {2006} 20799} 20800 20801@Article{ sigalov2006, 20802 title = {Analytical electrostatics for biomolecules: {Beyond} the generalized {Born} 20803 approximation}, 20804 author = {G. Sigalov and A. Fenley and A. Onufriev}, 20805 journal = {Journal of Chemical Physics}, 20806 volume = {124}, 20807 number = {124902}, 20808 year = {2006} 20809} 20810 20811@Article{ dennard1974, 20812 title = {Design of ion-implanted {MOSFET's} with very small physical dimensions}, 20813 author = {Robert H Dennard and Fritz H Gaensslen and V Leo Rideout and Ernest Bassous and 20814 Andre R LeBlanc}, 20815 journal = {IEEE Journal of Solid-State Circuits}, 20816 volume = {9}, 20817 number = {5}, 20818 pages = {256--268}, 20819 year = {1974} 20820} 20821 20822@Article{ zeegeijn2015, 20823 author = {Field G. {V}an~{Z}ee and Robert A. {v}an~{d}e~{G}eijn}, 20824 title = {{BLIS}: A Framework for Rapidly Instantiating {BLAS} Functionality}, 20825 journal = {ACM Transactions on Mathematical Software}, 20826 volume = {41}, 20827 number = {3}, 20828 pages = {14:1--14:33}, 20829 month = jun, 20830 year = {2015}, 20831 issue_date = {jun}, 20832 doi = {10.1145/2764454} 20833} 20834 20835@Article{ campbell1976, 20836 title = {Assessing the Impact of Planned Social Change}, 20837 author = {Donald T. Campbell}, 20838 journal = {Occasional Paper Series, The Public Affairs Center}, 20839 number = {8}, 20840 publisher = {Dartmouth College}, 20841 year = {1976} 20842} 20843 20844@Article{ smaldinomcelreath2016, 20845 title = {The natural selection of bad science}, 20846 author = {Paul E. Smaldino and Richard McElreath}, 20847 journal = {Royal Society Open Science}, 20848 volume = {3}, 20849 number = {9}, 20850 url = {http://rsos.royalsocietypublishing.org/content/3/9/160384}, 20851 eprint = {http://rsos.royalsocietypublishing.org/content/3/9/160384.full.pdf}, 20852 doi = {10.1098/rsos.160384}, 20853 year = {2016}, 20854 publisher = {The Royal Society} 20855} 20856 20857@Article{ harlowwelch1965, 20858 title = {Numerical calculation of time-dependent viscous incompressible flow of fluid with 20859 free surface}, 20860 author = {Francis H Harlow and J Eddie Welch}, 20861 journal = {Physics of fluids}, 20862 volume = {8}, 20863 number = {12}, 20864 pages = {2182--2189}, 20865 url = {http://www.cs.rpi.edu/~cutler/classes/advancedgraphics/S12/papers/harlow_welch.pdf}, 20866 year = {1965} 20867} 20868 20869@Article{ diskinthomasmineck2005, 20870 title = {{On Quantitative Analysis Methods for Multigrid Solutions}}, 20871 author = {Boris Diskin and James L. Thomas and Raymond E. Mineck}, 20872 journal = {SIAM Journal on Scientific Computing}, 20873 volume = {27}, 20874 number = {1}, 20875 pages = {108--129}, 20876 doi = {10.1137/030601521}, 20877 issn = {1064-8275}, 20878 year = {2005} 20879} 20880 20881@TechReport{ scott2012, 20882 title = {Fostering Interactions Between the Geosciences and Mathematics, Statistics, and 20883 Computer Science}, 20884 author = {L. Ridgway Scott and Jed Brown and George W. Bergantz and Dan Cooley and Clint 20885 Dawson and Maarten de Hoop and Donald Estep and Natasha Flyer and Efi 20886 Foufoula-Georgiou and Michael Ghil and Matthew G. Knepley and Randall J. LeVeque 20887 and Lek-Heng Lim and Serge Prudhomme and Adrian Sandu and Frederik J. Simons and 20888 Philip B. Stark and Michael Stein and Seth Stein and Toshiro Tanimoto and Daniel 20889 Tartakovsky and Jonathan Weare and Robert Weiss and Grady B. Wright and Dave 20890 Yuen}, 20891 institution = {University of Chicago}, 20892 number = {2012-02}, 20893 url = {http://cs.uchicago.edu/files/tr_authentic/TR-2012-02.pdf}, 20894 year = {2012} 20895} 20896 20897@Article{ paigesaunders1975, 20898 title = {Solution of Sparse Indefinite Systems of Linear Equations}, 20899 author = {C. C. Paige and M. A. Saunders}, 20900 journal = {SIAM Journal on Numerical Analysis}, 20901 volume = {12}, 20902 pages = {617--629}, 20903 year = {1975} 20904} 20905 20906@Article{ roth2010, 20907 title = {Fundamental measure theory for hard-sphere mixtures: a review}, 20908 author = {Roland Roth}, 20909 journal = {J. Phys. Cond. Mat.}, 20910 volume = {22}, 20911 pages = {063102}, 20912 year = {2010} 20913} 20914 20915@Article{ wu2008, 20916 title = {Density functional theory for liquid structure and thermodynamics}, 20917 author = {J. Z. Wu}, 20918 journal = {Struct. Bond.}, 20919 doi = {10.1007/430_2008_3}, 20920 year = {2008} 20921} 20922 20923@Article{ goel2008, 20924 title = {Molecular solvent model of cylindrical electric double layers: a systematic study 20925 by {Monte Carlo} simulations and density functional theory}, 20926 author = {T. Goel and C. N. Patra and S. K. Ghosh and T. Mukherjee}, 20927 journal = {J. Chem. Phys.}, 20928 volume = {129}, 20929 pages = {154707}, 20930 year = {2008} 20931} 20932 20933@Article{ marchxiaoyubiros2015, 20934 title = {{ASKIT:} An efficient, parallel library for high-dimensional kernel summations}, 20935 author = {William B March and Bo Xiao and Chenhan D Yu and George Biros}, 20936 journal = {SIAM Journal on Scientific Computing (to appear)}, 20937 year = {2015} 20938} 20939 20940@InProceedings{ yangduraiswamigumerovdavis2003, 20941 title = {Improved fast gauss transform and efficient kernel density estimation}, 20942 author = {Changjiang Yang and Ramani Duraiswami and Nail A Gumerov and Larry Davis}, 20943 booktitle = {Proceedings of the Ninth IEEE International Conference on Computer Vision}, 20944 pages = {664--671}, 20945 year = {2003}, 20946 organization = {IEEE} 20947} 20948 20949@Article{ fornberglarssonflyer2011, 20950 title = {Stable computations with Gaussian radial basis functions}, 20951 author = {Bengt Fornberg and Elisabeth Larsson and Natasha Flyer}, 20952 journal = {SIAM Journal on Scientific Computing}, 20953 volume = {33}, 20954 number = {2}, 20955 pages = {869--892}, 20956 year = {2011}, 20957 publisher = {SIAM} 20958} 20959 20960@InProceedings{ srinivasanqiduraiswami2010, 20961 title = {GPUML: Graphical processors for speeding up kernel machines}, 20962 author = {Balaji Vasan Srinivasan and H Qi and Ramani Duraiswami}, 20963 booktitle = {SIAM Conf. on Data Mining. Workshop on High Performance Analytics-Algorithms, 20964 Implementations, and Applications}, 20965 year = {2010} 20966} 20967 20968@Article{ jadamecbillen2010, 20969 title = {Reconciling surface plate motions with rapid three-dimensional mantle flow around 20970 a slab edge}, 20971 author = {Margarete A Jadamec and Magali I Billen}, 20972 journal = {Nature}, 20973 volume = {465}, 20974 number = {7296}, 20975 pages = {338--341}, 20976 year = {2010} 20977} 20978 20979@Article{ jadamecbillen2012, 20980 title = {The role of rheology and slab shape on rapid mantle flow: Three-dimensional 20981 numerical models of the Alaska slab edge}, 20982 author = {Margarete A Jadamec and Magali I Billen}, 20983 journal = {Journal of Geophysical Research: Solid Earth}, 20984 volume = {117}, 20985 number = {B2}, 20986 year = {2012} 20987} 20988 20989@Article{ jadamec2015, 20990 title = {Slab-driven Mantle Weakening and Rapid Mantle Flow}, 20991 author = {Margarete A Jadamec}, 20992 journal = {Subduction Dynamics: From Mantle Flow to Mega Disasters}, 20993 volume = {211}, 20994 pages = {135}, 20995 year = {2015} 20996} 20997 20998@Article{ durancejadamecfalloonnicholls2012, 20999 title = {Magmagenesis within the {H}unter {R}idge {R}ift {Z}one resolved from 21000 olivine-hosted melt inclusions and geochemical modelling with insights from 21001 geodynamic models}, 21002 author = {Patricia MJ Durance and Margarete A Jadamec and TJ Falloon and IA Nicholls}, 21003 journal = {Australian Journal of Earth Sciences}, 21004 volume = {59}, 21005 number = {6}, 21006 pages = {913--931}, 21007 year = {2012} 21008} 21009 21010@Article{ sharplesmoresijadamecrevote2015, 21011 title = {Styles of rifting and fault spacing in numerical models of crustal extension}, 21012 author = {Wendy Sharples and Louis N Moresi and Margarete A Jadamec and Jerico Revote}, 21013 journal = {Journal of Geophysical Research: Solid Earth}, 21014 volume = {120}, 21015 number = {6}, 21016 pages = {4379--4404}, 21017 year = {2015} 21018} 21019 21020@Article{ hayniejadamec2017, 21021 title = {Tectonic drivers of the {Wrangell}-block forearc sliver: Insights from 3D 21022 geodynamic models}, 21023 author = {Kirstie L Haynie and Margarete A Jadamec}, 21024 journal = {Tectonics}, 21025 note = {in review}, 21026 year = {2017} 21027} 21028 21029@Article{ cammaranoromanowiczstixrudelithgowbertellonixu2009, 21030 title = {Inferring the thermochemical structure of the upper mantle from seismic data}, 21031 author = {Fabio Cammarano and Barbara Romanowicz and Lars Stixrude and Carolina 21032 Lithgow-Bertelloni and Wenbo Xu}, 21033 journal = {Geophysical Journal International}, 21034 volume = {179}, 21035 number = {2}, 21036 pages = {1169--1185}, 21037 year = {2009} 21038} 21039 21040@Article{ zhong2006, 21041 title = {Constraints on thermochemical convection of the mantle from plume heat flux, 21042 plume excess temperature, and upper mantle temperature}, 21043 author = {Shijie Zhong}, 21044 journal = {Journal of Geophysical Research: Solid Earth}, 21045 volume = {111}, 21046 number = {B4}, 21047 year = {2006} 21048} 21049 21050@Article{ billenhirth2007, 21051 title = {Rheologic controls on slab dynamics}, 21052 author = {Magali I Billen and Greg Hirth}, 21053 journal = {Geochemistry, Geophysics, Geosystems}, 21054 volume = {8}, 21055 number = {8}, 21056 year = {2007} 21057} 21058 21059@Article{ hirthkohlstedt2003, 21060 title = {Rheology of the upper mantle and the mantle wedge: A view from the 21061 experimentalists}, 21062 author = {Greg Hirth and David Kohlstedt}, 21063 journal = {Inside the subduction Factory}, 21064 pages = {83--105}, 21065 year = {2003} 21066} 21067 21068@Article{ longsilver2008, 21069 title = {The subduction zone flow field from seismic anisotropy: A global view}, 21070 author = {Maureen D Long and Paul G Silver}, 21071 journal = {science}, 21072 volume = {319}, 21073 number = {5861}, 21074 pages = {315--318}, 21075 year = {2008} 21076} 21077 21078@Article{ karatowu1993, 21079 title = {Rheology of the upper mantle: A synthesis}, 21080 author = {Shun-ichiro Karato and Patrick Wu}, 21081 journal = {Science}, 21082 volume = {260}, 21083 number = {5109}, 21084 pages = {771--778}, 21085 year = {1993} 21086} 21087 21088@Article{ long2013mantle, 21089 title = {Mantle flow in subduction systems: The mantle wedge flow field and implications 21090 for wedge processes}, 21091 author = {Long, Maureen D and Wirth, Erin A}, 21092 journal = {Journal of Geophysical Research: Solid Earth}, 21093 volume = {118}, 21094 number = {2}, 21095 pages = {583--606}, 21096 year = {2013}, 21097 publisher = {Wiley Online Library} 21098} 21099 21100@Article{ hoernle2008arc, 21101 title = {Arc-parallel flow in the mantle wedge beneath Costa Rica and Nicaragua}, 21102 author = {Hoernle, Kaj and Abt, David L and Fischer, Karen M and Nichols, Holly and Hauff, 21103 Folkmar and Abers, Geoffrey A and van den Bogaard, Paul and Heydolph, Ken and 21104 Alvarado, Guillermo and Protti, Marino and others}, 21105 journal = {Nature}, 21106 volume = {451}, 21107 number = {7182}, 21108 pages = {1094--1097}, 21109 year = {2008}, 21110 publisher = {Nature Publishing Group} 21111} 21112 21113@Article{ savage1999, 21114 title = {Seismic anisotropy and mantle deformation: what have we learned from shear wave 21115 splitting?}, 21116 author = {MK Savage}, 21117 journal = {Reviews of Geophysics}, 21118 volume = {37}, 21119 number = {1}, 21120 pages = {65--106}, 21121 year = {1999} 21122} 21123 21124@InProceedings{ akcelikbirosdraganescuhillghattaswaanders2005, 21125 title = {Dynamic data-driven inversion for terascale simulations: Real-time identification 21126 of airborne contaminants}, 21127 author = {Volkan Ak{\c{c}}elik and George Biros and Andrei Draganescu and Judith Hill and 21128 Omar Ghattas and Bart Van Bloemen Waanders}, 21129 booktitle = {Proceedings of the 2005 ACM/IEEE conference on Supercomputing}, 21130 pages = {43}, 21131 year = {2005}, 21132 organization = {IEEE Computer Society} 21133} 21134 21135@Article{ draganescusoane2013, 21136 title = {Multigrid solution of a distributed optimal control problem constrained by the 21137 {Stokes} equations}, 21138 author = {Andrei Dr{\u{a}}g{\u{a}}nescu and Ana Maria Soane}, 21139 journal = {Applied Mathematics and Computation}, 21140 volume = {219}, 21141 number = {10}, 21142 pages = {5622--5634}, 21143 year = {2013} 21144} 21145 21146@Article{ zhonggurnis1995, 21147 title = {Mantle convection with plates and mobile, faulted plate margins}, 21148 author = {Shijie Zhong and Michael Gurnis}, 21149 journal = {Science}, 21150 volume = {267}, 21151 number = {5199}, 21152 pages = {838}, 21153 year = {1995} 21154} 21155 21156@Article{ studerbobinchahidmousavicandesdahan2012, 21157 title = {Compressive fluorescence microscopy for biological and hyperspectral imaging}, 21158 author = {Vincent Studer and J{\'e}rome Bobin and Makhlad Chahid and Hamed Shams Mousavi 21159 and Emmanuel Candes and Maxime Dahan}, 21160 journal = {Proceedings of the National Academy of Sciences}, 21161 volume = {109}, 21162 number = {26}, 21163 pages = {E1679--E1687}, 21164 year = {2012} 21165} 21166 21167@Article{ borsukhigdonstowreckhow2001, 21168 title = {A {Bayesian} hierarchical model to predict benthic oxygen demand from organic 21169 matter loading in estuaries and coastal zones}, 21170 author = {Mark E Borsuk and David Higdon and Craig A Stow and Kenneth H Reckhow}, 21171 journal = {Ecological Modelling}, 21172 volume = {143}, 21173 number = {3}, 21174 pages = {165--181}, 21175 year = {2001} 21176} 21177 21178@Article{ liebermanwillcox2012, 21179 title = {Goal-oriented inference: Approach, linear theory, and application to advection 21180 diffusion}, 21181 author = {Chad Lieberman and Karen Willcox}, 21182 journal = {SIAM Journal on Scientific Computing}, 21183 volume = {34}, 21184 number = {4}, 21185 pages = {A1880--A1904}, 21186 year = {2012} 21187} 21188 21189@Article{ chaillatbiros2012, 21190 title = {{FaIMS}: A fast algorithm for the inverse medium problem with multiple 21191 frequencies and multiple sources for the scalar {Helmholtz} equation}, 21192 author = {St{\'e}phanie Chaillat and George Biros}, 21193 journal = {Journal of Computational Physics}, 21194 volume = {231}, 21195 number = {12}, 21196 pages = {4403--4421}, 21197 year = {2012} 21198} 21199 21200@Article{ farhattezaurdjellouli2002, 21201 title = {On the solution of three-dimensional inverse obstacle acoustic scattering 21202 problems by a regularized {Newton} method}, 21203 author = {Charbel Farhat and Radek Tezaur and Rabia Djellouli}, 21204 journal = {Inverse problems}, 21205 volume = {18}, 21206 number = {5}, 21207 pages = {1229}, 21208 year = {2002} 21209} 21210 21211@Article{ orozcoghattas1992, 21212 title = {Massively parallel aerodynamic shape optimization}, 21213 author = {Orozco, Carlos E and Ghattas, ON}, 21214 journal = {Computing Systems in Engineering}, 21215 volume = {3}, 21216 number = {1-4}, 21217 pages = {311--320}, 21218 year = {1992} 21219} 21220 21221@Article{ reutheralonsorimlingerjameson1999, 21222 title = {Aerodynamic shape optimization of supersonic aircraft configurations via an 21223 adjoint formulation on distributed memory parallel computers}, 21224 author = {James Reuther and Juan Jose Alonso and Mark J Rimlinger and Antony Jameson}, 21225 journal = {Computers \& fluids}, 21226 volume = {28}, 21227 number = {4}, 21228 pages = {675--700}, 21229 year = {1999} 21230} 21231 21232@Article{ rudistadlerghattas2016, 21233 title = {Weighted {BFBT} Preconditioner for {Stokes} Flow Problems with Highly 21234 Heterogeneous Viscosity}, 21235 author = {Johan Rudi and Georg Stadler and Omar Ghattas}, 21236 journal = {ArXiv e-prints}, 21237 archiveprefix = {arXiv}, 21238 primaryclass = {math.NA}, 21239 eprint = {1607.03936}, 21240 month = jul, 21241 year = {2016} 21242} 21243 21244@Article{ borzikunisch2006, 21245 title = {A globalization strategy for the multigrid solution of elliptic optimal control 21246 problems}, 21247 author = {Borzi, A and Kunisch, K}, 21248 journal = {Optimisation Methods and Software}, 21249 volume = {21}, 21250 number = {3}, 21251 pages = {445--459}, 21252 year = {2006} 21253} 21254 21255@Article{ nash2000, 21256 title = {A multigrid approach to discretized optimization problems}, 21257 author = {Stephen G Nash}, 21258 journal = {Optimization Methods and Software}, 21259 volume = {14}, 21260 number = {1-2}, 21261 pages = {99--116}, 21262 year = {2000} 21263} 21264 21265@Article{ jameson1983, 21266 title = {Solution of the Euler equations for two dimensional transonic flow by a multigrid 21267 method}, 21268 author = {Antony Jameson}, 21269 journal = {Applied mathematics and computation}, 21270 volume = {13}, 21271 number = {3-4}, 21272 pages = {327--355}, 21273 year = {1983} 21274} 21275 21276@Article{ billen2008, 21277 title = {Modeling the dynamics of subducting slabs}, 21278 author = {Magali I Billen}, 21279 journal = {Annu. Rev. Earth Planet. Sci.}, 21280 volume = {36}, 21281 pages = {325--356}, 21282 year = {2008} 21283} 21284 21285@Article{ gerya2011, 21286 title = {Future directions in subduction modeling}, 21287 author = {Taras Gerya}, 21288 journal = {Journal of Geodynamics}, 21289 volume = {52}, 21290 number = {5}, 21291 pages = {344--378}, 21292 year = {2011} 21293} 21294 21295@Article{ tackley2000, 21296 title = {Mantle convection and plate tectonics: Toward an integrated physical and chemical 21297 theory}, 21298 author = {Paul J Tackley}, 21299 journal = {Science}, 21300 volume = {288}, 21301 number = {5473}, 21302 pages = {2002--2007}, 21303 year = {2000} 21304} 21305 21306@Article{ caseydewey1984, 21307 title = {Initiation of subduction zones along transform and accreting plate boundaries, 21308 triple-junction evolution, and forearc spreading centres—implications for 21309 ophiolitic geology and obduction}, 21310 author = {JF Casey and JF Dewey}, 21311 journal = {Geological Society, London, Special Publications}, 21312 volume = {13}, 21313 number = {1}, 21314 pages = {269--290}, 21315 year = {1984} 21316} 21317 21318@Article{ doughertyclayton2014, 21319 title = {Seismicity and structure in central {Mexico}: Evidence for a possible slab tear 21320 in the {South Cocos} plate}, 21321 author = {Sara L Dougherty and Robert W Clayton}, 21322 journal = {Journal of Geophysical Research: Solid Earth}, 21323 volume = {119}, 21324 number = {4}, 21325 pages = {3424--3447}, 21326 year = {2014} 21327} 21328 21329@Article{ syracusemaceiraprietozhangammon2016, 21330 title = {Multiple plates subducting beneath Colombia, as illuminated by seismicity and 21331 velocity from the joint inversion of seismic and gravity data}, 21332 author = {Ellen M Syracuse and Monica Maceira and German A Prieto and Haijiang Zhang and 21333 Charles J Ammon}, 21334 journal = {Earth and Planetary Science Letters}, 21335 volume = {444}, 21336 pages = {139--149}, 21337 year = {2016} 21338} 21339 21340@Article{ bowergurnisflament2015, 21341 title = {Assimilating lithosphere and slab history in 4-D Earth models}, 21342 author = {Dan J Bower and Michael Gurnis and Nicolas Flament}, 21343 journal = {Physics of the Earth and Planetary Interiors}, 21344 volume = {238}, 21345 pages = {8--22}, 21346 year = {2015} 21347} 21348 21349@Book{ ciarlet1976, 21350 title = {Numerical analysis of the finite element method}, 21351 author = {Philippe G Ciarlet}, 21352 volume = {59}, 21353 year = {1976}, 21354 publisher = {Presses de l'Universit{\'e} de Montr{\'e}al} 21355} 21356 21357@InProceedings{ liumellorcrummey2013, 21358 title = {A data-centric profiler for parallel programs}, 21359 author = {Xu Liu and John Mellor-Crummey}, 21360 booktitle = {2013 SC-International Conference for High Performance Computing, Networking, 21361 Storage and Analysis (SC)}, 21362 pages = {1--12}, 21363 year = {2013}, 21364 organization = {IEEE} 21365} 21366 21367@InCollection{ ernstgander2012, 21368 title = {Why it is difficult to solve Helmholtz problems with classical iterative 21369 methods}, 21370 author = {Oliver G Ernst and Martin J Gander}, 21371 booktitle = {Numerical analysis of multiscale problems}, 21372 pages = {325--363}, 21373 url = {http://www.mathe.tu-freiberg.de/~ernst/PubArchive/helmholtzDurham.pdf}, 21374 year = {2012} 21375} 21376 21377@Article{ warburtonkarniadakis1999, 21378 title = {A discontinuous Galerkin method for the viscous {MHD} equations}, 21379 author = {Timothy C Warburton and George E Karniadakis}, 21380 journal = {Journal of Computational Physics}, 21381 volume = {152}, 21382 number = {2}, 21383 pages = {608--641}, 21384 year = {1999} 21385} 21386 21387@Article{ salahsoulaimanihabashi2001, 21388 title = {A finite element method for magnetohydrodynamics}, 21389 author = {Nizar Ben Salah and Azzeddine Soulaimani and Wagdi G Habashi}, 21390 journal = {Computer Methods in Applied Mechanics and Engineering}, 21391 volume = {43}, 21392 number = {190}, 21393 pages = {5867--5892}, 21394 year = {2001} 21395} 21396 21397@Article{ nesliturktezersezgin2005, 21398 title = {The finite element method for {MHD} flow at high {Hartmann} numbers}, 21399 author = {Ali I Nesliturk and M Tezer-Sezgin}, 21400 journal = {Computer methods in applied mechanics and engineering}, 21401 volume = {194}, 21402 number = {9}, 21403 pages = {1201--1224}, 21404 year = {2005} 21405} 21406 21407@Article{ strakschellart2016, 21408 title = {Control of Slab Width on Subduction-Induced Upper Mantle Flow and Associated 21409 Upwellings: Insights from Analog Models}, 21410 author = {Vincent Strak and Wouter P Schellart}, 21411 journal = {Journal of Geophysical Research: Solid Earth}, 21412 year = {2016} 21413} 21414 21415@InBook{ kirbyloggrognesterrel2012, 21416 title = {Common and unusual finite elements}, 21417 author = {Robert C. Kirby and Anders Logg and Marie E. Rognes and Andy R. Terrel}, 21418 editor = {Anders Logg and Kent-Andre Mardal and Garth Wells}, 21419 booktitle = {Automated Solution of Differential Equations by the Finite Element Method: The 21420 FEniCS Book}, 21421 publisher = {Springer Berlin Heidelberg}, 21422 address = {Berlin, Heidelberg}, 21423 pages = {95--119}, 21424 isbn = {978-3-642-23099-8}, 21425 doi = {10.1007/978-3-642-23099-8_3}, 21426 year = {2012} 21427} 21428 21429@InBook{ kirbymardal2012, 21430 author = {Robert C. Kirby and Kent-Andre Mardal}, 21431 title = {Constructing general reference finite elements}, 21432 editor = {Anders Logg and Kent-Andre Mardal and Garth Wells}, 21433 booktitle = {Automated Solution of Differential Equations by the Finite Element Method: The 21434 FEniCS Book}, 21435 publisher = {Springer Berlin Heidelberg}, 21436 address = {Berlin, Heidelberg}, 21437 pages = {121--132}, 21438 isbn = {978-3-642-23099-8}, 21439 doi = {10.1007/978-3-642-23099-8_4}, 21440 year = {2012} 21441} 21442 21443@Book{ wriggers2008, 21444 title = {Nonlinear finite element methods}, 21445 author = {Peter Wriggers}, 21446 publisher = {Springer Science \& Business Media}, 21447 year = {2008} 21448} 21449 21450@Book{ zienkiewicztaylor1977, 21451 title = {The finite element method}, 21452 author = {Zienkiewicz, Olgierd Cecil and Taylor, Robert Leroy and Taylor, Robert Lee}, 21453 publisher = {McGraw-hill London}, 21454 volume = {3}, 21455 year = {1977} 21456} 21457 21458@Article{ rogneskirbylogg2009, 21459 title = {Efficient assembly of {H(div)} and {H(curl)} conforming finite elements}, 21460 author = {Marie E Rognes and Robert C Kirby and Anders Logg}, 21461 journal = {SIAM Journal on Scientific Computing}, 21462 volume = {31}, 21463 number = {6}, 21464 pages = {4130--4151}, 21465 year = {2009} 21466} 21467 21468@Book{ kelley03, 21469 title = {Solving nonlinear equations with Newton's method}, 21470 author = {Carl T. Kelley}, 21471 publisher = {SIAM}, 21472 year = {2003} 21473} 21474 21475@Article{ turing1937, 21476 title = {The Chemical Basis of Morphogenesis}, 21477 author = {A. M. Turing}, 21478 journal = {Philosophical Transactions of the Royal Society B: Biological Sciences}, 21479 volume = {237}, 21480 number = {641}, 21481 pages = {37--72}, 21482 doi = {10.1098/rstb.1952.0012}, 21483 issn = {0080-4622}, 21484 url = {http://rstb.royalsocietypublishing.org/content/237/641/37}, 21485 eprint = {http://rstb.royalsocietypublishing.org/content/237/641/37.full.pdf}, 21486 year = {1952} 21487} 21488 21489@Article{ fabienknepleymillsriviere2017, 21490 title = {Manycore parallel computing for a hybridizable discontinuous {Galerkin} nested 21491 multigrid method}, 21492 author = {Maurice S. Fabien and Matthew G. Knepley and Richard Mills and B\'eatrice M. 21493 Rivi\`ere}, 21494 journal = {SIAM Journal on Scientific Computing}, 21495 url = {https://arxiv.org/abs/1705.09907}, 21496 volume = {41}, 21497 number = {2}, 21498 pages = {C73--C96}, 21499 doi = {10.1137/17M1128903}, 21500 year = {2018} 21501} 21502 21503@Article{ fabienknepleyriviere2018, 21504 title = {A hybridizable discontinuous Galerkin method for two-phase flow in heterogeneous 21505 porous media}, 21506 author = {Maurice S. Fabien and Matthew G. Knepley and B\'eatrice M. Rivier\'e}, 21507 journal = {International Journal for Numerical Methods in Engineering}, 21508 doi = {10.1002/nme.5919}, 21509 year = {2018} 21510} 21511 21512@Article{ fabienknepleyriviere2020, 21513 title = {A high order hybridizable discontinuous Galerkin method for incompressible 21514 miscible displacement in heterogeneous media}, 21515 author = {Maurice S. Fabien and Matthew G. Knepley and B\'eatrice M. Rivi\`ere}, 21516 journal = {Results in Applied Mathematics}, 21517 url = {https://arxiv.org/abs/1809.00747}, 21518 volume = {8}, 21519 doi = {10.1016/j.rinam.2019.100089}, 21520 year = {2020} 21521} 21522 21523@Article{ fabienknepleyriviere2019b, 21524 title = {Families of Interior Penalty Hybridizable discontinuous Galerkin methods for 21525 second order elliptic problems}, 21526 author = {Maurice S. Fabien and Matthew G. Knepley and B\'eatrice M. Rivi\`ere}, 21527 journal = {Journal of Numerical Mathematics}, 21528 doi = {10.1515/jnma-2019-0027}, 21529 year = {2019} 21530} 21531 21532@Article{ fabien2019, 21533 title = {A {GPU}-Accelerated Hybridizable Discontinuous {Galerkin} Method for Linear 21534 Elasticity}, 21535 author = {Maurice S. Fabien}, 21536 journal = {Communications in Computational Physics}, 21537 volume = {27}, 21538 number = {2}, 21539 pages = {513--545}, 21540 issn = {1991-7120}, 21541 doi = {10.4208/cicp.OA-2018-0235}, 21542 year = {2019} 21543} 21544 21545@Unpublished{ awanoufabienguzmanstern2020, 21546 title = {Hybridization and postprocessing in finite element exterior calculus}, 21547 author = {Gerard Awanou and Maurice Fabien and Johnny Guzm\'an and Ari Stern}, 21548 eprint = {2008.00149}, 21549 note = {preprint}, 21550 primaryclass = {math.NA}, 21551 year = {2020} 21552} 21553 21554@Article{ chaabanegiraultrivierethompson2018, 21555 title = {A stable enriched Galerkin element for the Stokes problem}, 21556 author = {Nabil Chaabane and Vivette Girault and B\'eatrice Rivi\`ere and Travis Thompson}, 21557 journal = {Applied Numerical Mathematics}, 21558 volume = {132}, 21559 pages = {1--21}, 21560 issn = {0168-9274}, 21561 doi = {https://doi.org/10.1016/j.apnum.2018.04.008}, 21562 url = {http://www.sciencedirect.com/science/article/pii/S0168927418300977}, 21563 year = {2018} 21564} 21565 21566@Article{ thompsonriviereknepley2018, 21567 title = {An Implicit Discontinuous Galerkin Method For Modeling Acute Edema and 21568 Resuscitation In The Small Intestine}, 21569 author = {Travis Thompson and B\'eatrice M. Rivi\`ere and Matthew G. Knepley}, 21570 journal = {Mathematical Medicine and Biology}, 21571 doi = {10.1093/imammb/dqz00}, 21572 year = {2019} 21573} 21574 21575@Article{ kevrekidisthompsongoriely2020, 21576 title = {Anisotropic Diffusion and Traveling Waves of Toxic Proteins in Neurodegenerative 21577 Diseases}, 21578 author = {P. G. Kevrekidis and Travis Thompson and Alain Goriely}, 21579 journal = {Physics Letters A}, 21580 volume = {384}, 21581 number = {36}, 21582 pages = {126935}, 21583 year = {2020} 21584} 21585 21586@Article{ mardalrognesthompson2021, 21587 title = {Accurate Discretization Of Poroelasticity Without {Darcy} Stability -- 21588 {Stokes-Biot} Stability Revisited}, 21589 author = {Kent-Andre Mardal and Marie E. Rognes and Travis B. Thompson}, 21590 journal = {BIT Numerical Mathematics}, 21591 pages = {1--36}, 21592 year = {2021} 21593} 21594 21595@Article{ piersantileethompsonmardalrognes2021, 21596 title = {Parameter robust preconditioning by congruence for multiple-network 21597 poroelasticity}, 21598 author = {Piersanti, Eleonora and Lee, Jeonghun J and Thompson, Travis and Mardal, K-A and 21599 Rognes, Marie E}, 21600 journal = {SIAM Journal on Scientific Computing}, 21601 volume = {43}, 21602 number = {4}, 21603 pages = {B984--B1007}, 21604 year = {2021}, 21605 publisher = {SIAM} 21606} 21607 21608@InProceedings{ actorfuentesriviere2020b, 21609 title = {Identification of Kernels in a Convolutional Neural Network: Connections Between 21610 Level Set Equation and Deep Learning for Image Segmentation}, 21611 author = {Jonas A. Actor and David T. Fuentes and B\'eatrice M. Rivi\`ere}, 21612 booktitle = {Proceedings of the SPIE Medical Imaging Conference}, 21613 year = {2020} 21614} 21615 21616@Article{ actorfuentesriviere2020, 21617 title = {Robust Regularized Networks in the Presence of Noise}, 21618 author = {Jonas A. Actor and David T. Fuentes and B\'eatrice M. Rivi\`ere}, 21619 journal = {Medical Image Analysis}, 21620 note = {In revision}, 21621 year = {2020} 21622} 21623 21624@Book{ byerly1893, 21625 title = {An elementary treatise on Fourier's series: and spherical, cylindrical, and 21626 ellipsoidal harmonics, with applications to problems in mathematical physics}, 21627 author = {William Elwood Byerly}, 21628 publisher = {Dover}, 21629 year = {1893} 21630} 21631 21632@Book{ hobson1931, 21633 title = {The theory of spherical and ellipsoidal harmonics}, 21634 author = {Ernest William Hobson}, 21635 year = {1931}, 21636 publisher = {CUP Archive} 21637} 21638 21639@Book{ dassios2012, 21640 title = {Ellipsoidal harmonics: theory and applications}, 21641 author = {George Dassios}, 21642 volume = {146}, 21643 year = {2012}, 21644 publisher = {Cambridge University Press} 21645} 21646 21647@Book{ miller1977, 21648 title = {Symmetry and separation of variables}, 21649 author = {Miller, Jr, Willard}, 21650 year = {1977}, 21651 address = {Reading, MA}, 21652 publisher = {Addison-Wesley Publishing Co., Inc.} 21653} 21654 21655@TechReport{ epanet-users-manual, 21656 author = {Lewis A. Rossman}, 21657 title = {{EPANET 2} Users Manual}, 21658 institution = {Water Supply and Water Resources Division, National Risk Management Research 21659 Laboratory, Cincinnati, OH 45268}, 21660 year = {2000} 21661} 21662 21663@Article{ klocknerbarnettgreengardoneil2013, 21664 title = {Quadrature by expansion: A new method for the evaluation of layer potentials}, 21665 author = {Andreas Kl{\"o}ckner and Alexander Barnett and Leslie Greengard and Michael 21666 O'Neil}, 21667 journal = {Journal of Computational Physics}, 21668 volume = {252}, 21669 pages = {332--349}, 21670 year = {2013} 21671} 21672 21673@Article{ turcksinkronbichlerbangerth2016, 21674 title = {WorkStream--A Design Pattern for Multicore-Enabled Finite Element Computations}, 21675 author = {Bruno Turcksin and Martin Kronbichler and Wolfgang Bangerth}, 21676 journal = {ACM Transactions on Mathematical Software)}, 21677 volume = {43}, 21678 number = {1}, 21679 pages = {2}, 21680 year = {2016} 21681} 21682 21683@Article{ vitushkin1954, 21684 title = {On {Hilbert's} thirteenth problem}, 21685 author = {A. G. Vitushkin}, 21686 journal = {Dokl. Akad. Nauk SSSR}, 21687 volume = {95}, 21688 pages = {701--704}, 21689 year = {1954} 21690} 21691 21692@Article{ kolmogorov1957, 21693 title = {On the representation of continuous functions of several variables as 21694 superpositions of continuous functions of one variable and addition}, 21695 author = {Andrei N. Kolmogorov}, 21696 journal = {Dokl. Akad. Nauk SSSR}, 21697 pages = {953--956}, 21698 volume = {114:5}, 21699 note = {English transl. Amer. Math. Soc. Transl. (2) 28 (1963), 55}, 21700 year = {1957} 21701} 21702 21703@Article{ fridman1967, 21704 title = {Improvement in the smoothness of functions in the {Kolmogorov Superposition 21705 Theorem}}, 21706 author = {B. L. Fridman}, 21707 journal = {Dokl. Akad. Nauk SSR}, 21708 volume = {177:5}, 21709 pages = {1019--1022}, 21710 note = {English transl. Soviet Math. Dokl. 8, 6 (1967), 1550-1553}, 21711 year = {1967} 21712} 21713 21714@Article{ sprecher1972, 21715 title = {An improvement in The {Superposition Theorem of Kolmogorov}}, 21716 author = {David Sprecher}, 21717 journal = {Journal of Mathematical Analysis and Applications}, 21718 volume = {38}, 21719 pages = {208--213}, 21720 year = {1972} 21721} 21722 21723@Article{ diaconisshahshahani1984, 21724 title = {On nonlinear functions of linear combinations}, 21725 author = {Persi Diaconis and Mehrdad Shahshahani}, 21726 journal = {SIAM Journal on Scientific and Statistical Computing}, 21727 volume = {5}, 21728 number = {1}, 21729 pages = {175--191}, 21730 year = {1984}, 21731 publisher = {SIAM} 21732} 21733 21734@InProceedings{ hechtnielsen1987, 21735 title = {Kolmogorov's mapping neural network existence theorem}, 21736 author = {R. Hecht-Nielsen}, 21737 booktitle = {Proceedings of the International Conference on Neural Networks}, 21738 volume = {III}, 21739 pages = {11--14}, 21740 publisher = {IEEE Press}, 21741 year = {1987} 21742} 21743 21744@InProceedings{ hechtnielsen1989, 21745 title = {Theory of the back-propagation neural network}, 21746 author = {R. Hecht-Nielsen}, 21747 booktitle = {Proceedings of the International Joint Conference on Neural Networks}, 21748 volume = {I}, 21749 pages = {593--608}, 21750 publisher = {IEEE Press}, 21751 year = {1989} 21752} 21753 21754@Article{ girosipoggio1989, 21755 title = {Representation properties of networks: {Kolmogorov's} theorem is irrelevant}, 21756 author = {Federico Girosi and Tomaso Poggio}, 21757 journal = {Neural Computation}, 21758 volume = {1}, 21759 number = {4}, 21760 pages = {465--469}, 21761 year = {1989}, 21762 publisher = {MIT Press} 21763} 21764 21765@InBook{ koppen2002, 21766 title = {On the Training of a Kolmogorov Network}, 21767 author = {Mario K\"oppen}, 21768 pages = {474--9}, 21769 publisher = {ICANN 2002, LNCS 2415}, 21770 year = {2002} 21771} 21772 21773@PhDThesis{ bryant2008, 21774 title = {Analysis of {Kolmogorov's} superpostion theorem and its implementation in 21775 applications with low and high dimensional data}, 21776 author = {Donald W Bryant}, 21777 school = {University of Central Florida}, 21778 year = {2008} 21779} 21780 21781@InCollection{ griebel2006, 21782 title = {Sparse Grids for Higher Dimensional Problems}, 21783 author = {Michael Griebel}, 21784 booktitle = {Foundations of Computational Mathematics}, 21785 editor = {Luis M. Pardo and Allan Pinkus and Endre Suli and Michael J. Todd}, 21786 publisher = {Cambridge University Press}, 21787 pages = {106--161}, 21788 doi = {10.1017/CBO9780511721571.004}, 21789 url = {https://www.cambridge.org/core/books/foundations-of-computational-mathematics-santander-2005/sparse-grids-for-higher-dimensional-problems/C6E91FFE07DF5F6C069B80805B216B50}, 21790 month = jun, 21791 day = {29}, 21792 year = {2006} 21793} 21794 21795@Article{ braungriebel2009, 21796 title = {On a constructive proof of {Kolmogorov}'s superposition theorem}, 21797 author = {Jurgen Bra\"un and Michael Griebel}, 21798 journal = {Constructive Approximation}, 21799 pages = {653--675}, 21800 volume = {30}, 21801 year = {2009} 21802} 21803 21804@InProceedings{ lenifougerolletruchetet2009, 21805 title = {Kolmogorov superposition theorem and its application to wavelet image 21806 decompositions}, 21807 author = {Pierre-Emmanuel Leni and Yohan D Fougerolle and Fr{\'{e}}d{\'{e}}ric Truchetet}, 21808 booktitle = {Electronic Imaging-Wavelet Applications in Industrial Processing VI, Proceedings 21809 of the SPIE}, 21810 pages = {724804--724804}, 21811 doi = {10.1117/12.805916}, 21812 url = {http://le2i.cnrs.fr/IMG/publications/2228{\_}main.pdf{\%}5Cnhttp://proceedings.spiedigitallibrary.org/proceeding.aspx?articleid=1335035}, 21813 year = {2009} 21814} 21815 21816@Article{ oseledets2011, 21817 title = {Tensor-train decomposition}, 21818 author = {Ivan V Oseledets}, 21819 journal = {SIAM Journal on Scientific Computing}, 21820 volume = {33}, 21821 number = {5}, 21822 pages = {2295--2317}, 21823 year = {2011} 21824} 21825 21826@PhDThesis{ liu2015, 21827 title = {Kolmogorov superposition theorem and its applications}, 21828 author = {Xing Liu}, 21829 school = {Imperial College London}, 21830 year = {2015} 21831} 21832 21833@Article{ lecunbengiohinton2015, 21834 title = {Deep learning}, 21835 author = {Yann LeCun and Yoshua Bengio and Geoffrey Hinton}, 21836 journal = {Nature}, 21837 volume = {521}, 21838 number = {7553}, 21839 pages = {436--444}, 21840 year = {2015} 21841} 21842 21843@Book{ trefethen2013, 21844 title = {Approximation theory and approximation practice}, 21845 author = {Lloyd N Trefethen}, 21846 publisher = {SIAM}, 21847 year = {2013} 21848} 21849 21850@Article{ butlergrahammattiswalsh2017, 21851 title = {A measure-theoretic interpretation of sample based numerical integration with 21852 applications to inverse and prediction problems under uncertainty}, 21853 author = {Troy Butler and Lindsey Graham and S. Mattis and S. Walsh}, 21854 journal = {SIAM Journal on Scientific Computing}, 21855 volume = {39}, 21856 number = {5}, 21857 pages = {A2072--A2098}, 21858 year = {2017} 21859} 21860 21861@Article{ logg2009, 21862 title = {Efficient representation of computational meshes}, 21863 author = {Anders Logg}, 21864 journal = {International Journal of Computational Science and Engineering}, 21865 volume = {4}, 21866 number = {4}, 21867 pages = {283--295}, 21868 year = {2009} 21869} 21870 21871@Article{ agelekandersonbangerthbarth2017, 21872 title = {On orienting edges of unstructured two-and three-dimensional meshes}, 21873 author = {Rainer Agelek and Michael Anderson and Wolfgang Bangerth and William L Barth}, 21874 journal = {ACM Transactions on Mathematical Software (TOMS)}, 21875 volume = {44}, 21876 number = {1}, 21877 pages = {5}, 21878 year = {2017} 21879} 21880 21881@Article{ actorknepley2018, 21882 title = {An Algorithm for Computing {Lipschitz} Inner Functions in {Kolmogorov's 21883 Superposition Theorem}}, 21884 author = {Jonas Actor and Matthew G. Knepley}, 21885 journal = {SIAM Journal on Numerical Analysis}, 21886 note = {In review}, 21887 url = {}, 21888 year = {2018} 21889} 21890 21891@Book{ driscollhaletrefethen2014, 21892 title = {Chebfun guide}, 21893 author = {Tobin A Driscoll and Nicholas Hale and Lloyd N Trefethen}, 21894 publisher = {Pafnuty Publications, Oxford}, 21895 year = {2014} 21896} 21897 21898@Article{ johntobiska2000, 21899 title = {Numerical performance of smoothers in coupled multigrid methods for the parallel 21900 solution of the incompressible Navier-Stokes equations}, 21901 author = {Volker John and Lutz Tobiska}, 21902 journal = {International Journal for Numerical Methods in Fluids}, 21903 volume = {33}, 21904 number = {4}, 21905 pages = {453--473}, 21906 year = {2000} 21907} 21908 21909@Article{ vanka1986, 21910 title = {Block-implicit multigrid calculation of two-dimensional recirculating flows}, 21911 author = {S. P. Vanka}, 21912 journal = {Computer Methods in Applied Mechanics and Engineering}, 21913 volume = {59}, 21914 number = {1}, 21915 pages = {29--48}, 21916 year = {1986} 21917} 21918 21919@Article{ bartelgunther2018, 21920 author = {Andreas Bartel and Michael G\"unther}, 21921 title = {{PDAEs} in refined electrical network modeling}, 21922 journal = {SIAM Review}, 21923 volume = {60}, 21924 number = {1}, 21925 pages = {56--91}, 21926 doi = {10.1137/17M1113643}, 21927 year = {2018} 21928} 21929 21930@Article{ matpower, 21931 author = {Ray D. Zimmerman and Carlos E. Murillo-S{\'a}nchez and Robert J. Thomas}, 21932 title = {{MATPOWER}: Steady-state operations, planning and analysis tools for power 21933 systems research and education}, 21934 journal = {IEEE Transactions on Power Systems}, 21935 volume = {26}, 21936 number = {1}, 21937 pages = {12--19}, 21938 year = {2011}, 21939 doi = {10.1109/TPWRS.2010.2051168} 21940} 21941 21942@Article{ betrieyan2018, 21943 author = {G. Betrie and E. Yan}, 21944 title = {Development and Verification of Thermoelectric Power Plant Model for Assessing 21945 Energy and Water Nexus}, 21946 journal = {Applied Energy, Submitted}, 21947 volume = {}, 21948 number = {}, 21949 pages = {}, 21950 doi = {}, 21951 year = {2018} 21952} 21953 21954@Article{ faeth2012, 21955 author = {P. Faeth}, 21956 title = {{U.S.} Energy Security and Water: The Challenges We Face}, 21957 journal = {Environment: Science and Policy for Sustainable Development}, 21958 volume = {54(1)}, 21959 number = {1}, 21960 pages = {4--19}, 21961 year = {2012}, 21962 doi = {10.1080/00139157.2012.639595} 21963} 21964 21965@InProceedings{ hagberg2008, 21966 title = {Exploring network structure, dynamics, and function using {NetworkX}}, 21967 author = {Hagberg, Aric A. and Schult, Daniel A. and Swart, Pieter J.}, 21968 booktitle = {Proceedings of the 7th Python in Science Conference (SciPy2008), Ga\"{e}l 21969 Varoquaux, Travis Vaught, and Jarrod Millman (Eds), (Pasadena, CA USA)}, 21970 year = {2008}, 21971 pages = {11--15} 21972} 21973 21974@Misc{ simulink-web-page, 21975 author = {Mathworks}, 21976 title = {{SIMULINK} web page}, 21977 note = {\url{https://www.mathworks.com/products/simulink.html}}, 21978 year = {2017} 21979} 21980 21981@Misc{ labview-web-page, 21982 author = {National Instruments}, 21983 title = {{LabVIEW} web page}, 21984 note = {\url{http://www.ni.com/labview/}}, 21985 key = {labview}, 21986 year = {2017} 21987} 21988 21989@Misc{ modelica-web-page, 21990 author = {Modelica Association}, 21991 title = {Modelica web page}, 21992 note = {\url{https://www.modelica.org/}}, 21993 year = {2017} 21994} 21995 21996@InProceedings{ yangsc16, 21997 author = {C. Yang and W. Xue and H. Fu and H. You and X. Wang and Y. Ao and F. Liu and L. 21998 Gan and P. Xu and L. Wang and G. Yang and W. Zheng}, 21999 booktitle = {{SC '16}: Proceedings of the International Conference for High Performance 22000 Computing, Networking, Storage and Analysis}, 22001 title = {{10M-Core} Scalable Fully-Implicit Solver for Nonhydrostatic Atmospheric 22002 Dynamics}, 22003 note = {Gordon Bell Award}, 22004 year = {2016} 22005} 22006 22007@InProceedings{ bekassc15, 22008 author = {C. Bekas and A. Curioni and O. Ghattas and M. Gurnis and Y. Ineichen and T. Isaac 22009 and C. Malossi and J. Rudi and G. Stadler and P.W.J. Staar}, 22010 booktitle = {{SC '15}: Proceedings of the International Conference for High Performance 22011 Computing, Networking, Storage and Analysis}, 22012 title = {An Extreme-Scale Implicit Solver for Complex {PDEs}: Highly Heterogeneous Flow in 22013 Earth's Mantle}, 22014 note = {Gordon Bell Award}, 22015 year = {2015} 22016} 22017 22018@Misc{ improving-software-whitepaper2017, 22019 author = {M. Heroux and L.C. McInnes}, 22020 title = {Improving and accelerating scientific discovery through better software}, 22021 note = {whitepaper for 2017 ASCR Applied Mathematics PI Meeting}, 22022 doi = {10.6084/m9.figshare.5339692}, 22023 year = {2017} 22024} 22025 22026@Misc{ doe:40thanniversarycollection, 22027 title = {{DOE Office of Science} 40th anniversary collection of 40 major papers that have 22028 changed the face of science}, 22029 key = {Department of Energy, Office of Science}, 22030 howpublished = {\url{https://science.energy.gov/news/doe-science-at-40}}, 22031 year = {2017} 22032} 22033 22034@Misc{ siam:fellowsprogram, 22035 title = {{Society for Industrial and Applied Mathematics, Fellows Program}}, 22036 key = {SIAM}, 22037 howpublished = {\url{http://www.siam.org/prizes/fellows}} 22038} 22039 22040@Misc{ r-and-d100:awards2009, 22041 title = {{R\&D100 Award Winners 2009}}, 22042 key = {{R\&D100 Award Winners 2009}}, 22043 howpublished = {\url{https://www.rdmag.com/2009/08/2009-r-d-100-award-winners}} 22044} 22045 22046@Misc{ xsdk:website, 22047 title = {{xSDK: Extreme-scale Scientific Software Development Kit}}, 22048 key = {xSDK: Extreme-scale Scientific Software Development Kit}, 22049 howpublished = {\url{https://xsdk.info}} 22050} 22051 22052@Misc{ xsdk-community-installation-policies2017, 22053 title = {{xSDK} Community Installation Policies: {GNU Autoconf} and {CMake} Options}, 22054 author = {R. Bartlett and J. Sarich and B. Smith and T. Gamblin and {xSDK developers}}, 22055 note = {version 0.3, November 7, 2017}, 22056 doi = {10.6084/m9.figshare.4495133}, 22057 year = {2017} 22058} 22059 22060@Misc{ xsdk-community-package-policies2017, 22061 title = {{xSDK} Community Package Policies}, 22062 author = {B. Smith and R. Bartlett and {xSDK developers}}, 22063 note = {version 0.3, November 7, 2017}, 22064 doi = {10.6084/m9.figshare.4495136}, 22065 year = {2017} 22066} 22067 22068@Misc{ ideas-what-are-interoperable-libraries, 22069 title = {What Are Interoperable Software Libraries: Introducing the {xSDK}}, 22070 author = {Lois Curfman McInnes and Michael A. Heroux and Xiaoye Li and Barry Smith and 22071 Ulrike Yang and {all xSDK developers}}, 22072 note = {IDEAS {\em WhatIs} document, version 0.2, April 25, 2016, available via 22073 \url{https://ideas-productivity.org/resources/howtos/}}, 22074 year = {2016} 22075} 22076 22077@Misc{ ideas-productivity:website, 22078 title = {{IDEAS Scientific Software Productivity Project}}, 22079 key = {IDEAS Scientific Software Productivity Project}, 22080 howpublished = {\url{https://ideas-productivity.org}} 22081} 22082 22083@Misc{ ecp:website, 22084 key = {{U.S. DOE Exascale Computing Project (ECP)}}, 22085 title = {{U.S. DOE Exascale Computing Project (ECP)}}, 22086 note = {\url{https://exascaleproject.org}}, 22087 year = {2018} 22088} 22089 22090@Misc{ siam-cse-jan2018, 22091 author = {Ulrich R\"{u}de and Karen Willcox and Lois Curfman McInnes and Hans {De Sterck} 22092 and George Biros and Hans Bungartz and James Corones and Evin Cramer and James 22093 Crowley and Omar Ghattas and Max Gunzburger and Michael Hanke and Robert Harrison 22094 and Michael Heroux and Jan Hesthaven and Peter Jimack and Chris Johnson and Kirk 22095 E. Jordan and David E. Keyes and Rolf Krause and Vipin Kumar and Stefan Mayer and 22096 Juan Meza and Knut Martin M{\o}rken and J. Tinsley Oden and Linda Petzold and 22097 Padma Raghavan and Suzanne M. Shontz and Anne Trefethen and Peter Turner and 22098 Vladimir Voevodin and Barbara Wohlmuth and Carol S. Woodward}, 22099 title = {Research and Education in Computational Science and Engineering}, 22100 note = {available via \url{https://arxiv.org/abs/1610.02608}, to appear in {\em SIAM 22101 Review}}, 22102 year = {2018} 22103} 22104 22105@Misc{ doe-appliedmathpimeeting2017, 22106 author = {Jeff Hittinger and Lois Curfman McInnes and Abani Patra and Nathan Baker and 22107 Miranda Holmes-Cerfon and Barney Maccabe and Esmong Ng and Pieter Swart and Karen 22108 Willcox and Steven Lee}, 22109 title = {{Report on the 2017 ASCR Applied Mathematics Principal Investigators Meeting}}, 22110 note = {\url{http://www.orau.gov/ascr-appliedmath-pi2017}}, 22111 year = {2017} 22112} 22113 22114@Misc{ doe-fusionintegratedsimulationsworkshopreport2015, 22115 author = {P. Bonoli and L. C. {McInnes (Chairs)}}, 22116 title = {{Report on the DOE Workshop on Integrated Simulations for Magnetic Fusion Energy 22117 Sciences}}, 22118 note = {available via 22119 \url{http://science.energy.gov/~/media/fes/pdf/workshop-reports/2016/ISFusionWorkshopReport_11-12-2015.pdf}}, 22120 year = {2015} 22121} 22122 22123@Misc{ sisc-specialissueintro, 22124 title = {Introduction to {SISC} Special section associated with {CSE15} on {'CSE 22125 Software'} and {'Big Data in CSE'}}, 22126 author = {H. {De Sterck} and C. Johnson and L.C. McInnes}, 22127 month = nov, 22128 year = {2016}, 22129 journal = {SIAM J. Sci. Comput.}, 22130 doi = {10.1137/16N974188} 22131} 22132 22133@Article{ xsdk-foundations2017, 22134 title = {{xSDK} Foundations: Toward an Extreme-scale Scientific Software Development Kit}, 22135 author = {R. Bartlett and I. Demeshko and T. Gamblin and G. Hammond and M. Heroux and J. 22136 Johnson and A. Klinvex and X. Li and L.C. McInnes and J.D. Moulton and D. 22137 Osei-Kuffuor and J. Sarich and B. Smith and J. Willenbring and U.M. Yang}, 22138 journal = {Supercomputing Frontiers and Innovations}, 22139 month = feb, 22140 year = {2017}, 22141 note = {available via \url{https://arxiv.org/abs/1702.08425}} 22142} 22143 22144@Misc{ deal.ii:website, 22145 title = {{{deal.II}: An open-source finite element library}}, 22146 author = {Wolfgang Bangerth and others}, 22147 howpublished = {\url{http://www.dealii.org}}, 22148 year = {2018} 22149} 22150 22151@Misc{ fission-gas-scidac:website, 22152 title = {{Simulation of Fission Gas in Uranium Oxide Nuclear Fuel}}, 22153 author = {A. David {Andersson (PI)}}, 22154 howpublished = {SciDAC project, \url{https://collab.cels.anl.gov/display/FissionGasSciDAC2}}, 22155 year = {2018} 22156} 22157 22158@Misc{ tokamak-disruption-scidac:project, 22159 title = {{Tokamak Disruption Simulation}}, 22160 author = {Xianzhu {Tang (PI)}}, 22161 howpublished = {SciDAC project}, 22162 year = {2018} 22163} 22164 22165@InProceedings{ duplyakin2018memory, 22166 title = {Evaluating Active Learning with Cost and Memory Awareness}, 22167 author = {Duplyakin, Dmitry and Brown, Jed and Calhoun, Donna}, 22168 booktitle = {2018 IEEE International Parallel and Distributed Processing Symposium (IPDPS)}, 22169 pages = {214--223}, 22170 year = {2018}, 22171 organization = {IEEE}, 22172 pdf = {https://jedbrown.org/files/DuplyakinBrownCalhoun-ActiveLearningCostMemoryAware-2018.pdf} 22173} 22174 22175@InProceedings{ duplyakin2016active, 22176 author = {Dmitry Duplyakin and Jed Brown and Robert Ricci}, 22177 title = {Active Learning in Performance Analysis}, 22178 booktitle = {Proceedings of the IEEE Cluster Conference}, 22179 year = {2016}, 22180 month = sep, 22181 url = {http://www.flux.utah.edu/paper/duplyakin-cluster16}, 22182 pdf = {https://jedbrown.org/files/DuplyakinBrownRicci-ActiveLearningPerformanceAnalysis-2016.pdf} 22183} 22184 22185@Misc{ xgc1:website, 22186 title = {{XGC1 project website}}, 22187 author = {C. S. Chang and others}, 22188 howpublished = {\url{https://epsi.pppl.gov/computing/xgc-1}}, 22189 year = {2018} 22190} 22191 22192@Misc{ wdmapp-bhattacharjee-ecp:website, 22193 title = {{WDMApp: High-Fidelity Whole Device Modeling of Magnetically Confined Fusion 22194 Plasmas}}, 22195 author = {A. Bhattacharjee and others}, 22196 note = {ECP application project}, 22197 howpublished = {\url{https://www.exascaleproject.org/activity/energy-applications}}, 22198 year = {2018} 22199} 22200 22201@Misc{ subsurface-steefel-ecp:website, 22202 title = {{Subsurface: Exascale Subsurface Simulator of Coupled Flow, Transport, Reactions, 22203 and Mechanics}}, 22204 note = {ECP application project}, 22205 author = {C. Steefel and others}, 22206 howpublished = {\url{https://www.exascaleproject.org/activity/earth-space-science-applications}}, 22207 year = {2018} 22208} 22209 22210@Article{ chombo-crunch:2014, 22211 title = {High-Resolution Simulation of Pore-Scale Reactive Transport Processes Associated 22212 with Carbon Sequestration}, 22213 author = {D. Trebotich and M. F. Adams and S. Molins and C. Steefel and C. Shen}, 22214 journal = {Computing in Science and Engineering}, 22215 volume = {16}, 22216 issue = {6}, 22217 year = {2014}, 22218 pages = {22--31}, 22219 doi = {10.1109/MCSE.2014.77} 22220} 22221 22222@Article{ courantfriedrichslewy1967, 22223 title = {On the partial difference equations of mathematical physics}, 22224 author = {Richard Courant and Kurt Friedrichs and Hans Lewy}, 22225 journal = {IBM journal of Research and Development}, 22226 volume = {11}, 22227 number = {2}, 22228 pages = {215--234}, 22229 year = {1967}, 22230 publisher = {IBM} 22231} 22232 22233@Article{ erway2017solving, 22234 title = {On solving large-scale limited-memory quasi-Newton equations}, 22235 author = {Erway, Jennifer B and Marcia, Roummel F}, 22236 journal = {Linear Algebra and its Applications}, 22237 volume = {515}, 22238 pages = {196--225}, 22239 year = {2017}, 22240 publisher = {Elsevier} 22241} 22242 22243@Article{ griewank2012broyden, 22244 title = {Broyden updating, the good and the bad!}, 22245 author = {Griewank, Andreas}, 22246 journal = {Optimization Stories, Documenta Mathematica. Extra Volume: Optimization Stories}, 22247 pages = {301--315}, 22248 year = {2012} 22249} 22250 22251@Book{ tarantola2005, 22252 title = {Inverse problem theory and methods for model parameter estimation}, 22253 author = {Albert Tarantola}, 22254 volume = {89}, 22255 year = {2005}, 22256 publisher = {SIAM} 22257} 22258 22259@Article{ rutkaikristof2010, 22260 title = {Dynamic Monte Carlo simulation in mixtures}, 22261 author = {G{\'a}bor Rutkai and Tam{\'a}s Krist{\'o}f}, 22262 journal = {The Journal of Chemical Physics}, 22263 volume = {132}, 22264 number = {10}, 22265 pages = {104107}, 22266 year = {2010}, 22267 publisher = {AIP} 22268} 22269 22270@Book{ vogel2002, 22271 title = {Computational methods for inverse problems}, 22272 author = {Curtis R Vogel}, 22273 volume = {23}, 22274 year = {2002}, 22275 publisher = {SIAM} 22276} 22277 22278@Article{ malqvistpeterseim2014, 22279 title = {Localization of elliptic multiscale problems}, 22280 author = {Axel M{\aa}lqvist and Daniel Peterseim}, 22281 journal = {Mathematics of Computation}, 22282 volume = {83}, 22283 number = {290}, 22284 pages = {2583--2603}, 22285 year = {2014} 22286} 22287 22288@Article{ brandtbrannickkahllivshits2011, 22289 title = {Bootstrap {AMG}}, 22290 author = {Achi Brandt and James Brannick and Karsten Kahl and Irene Livshits}, 22291 journal = {SIAM Journal on Scientific Computing}, 22292 volume = {33}, 22293 number = {2}, 22294 pages = {612--632}, 22295 year = {2011} 22296} 22297 22298@InProceedings{ barralalauzet2014, 22299 title = {Large displacement body-fitted {FSI} simulations using a mesh-connectivity-change 22300 moving mesh strategy}, 22301 author = {Nicolas Barral and Fr{\'e}d{\'e}ric Alauzet}, 22302 booktitle = {44th AIAA Fluid Dynamics Conference}, 22303 pages = {2773}, 22304 year = {2014} 22305} 22306 22307@InProceedings{ barralalauzetloseille2015, 22308 title = {Metric-based anisotropic mesh adaptation for three-dimensional time-dependent 22309 problems involving moving geometries}, 22310 author = {Nicolas Barral and Fr{\'e}d{\'e}ric Alauzet and Adrien Loseille}, 22311 booktitle = {53rd AIAA Aerospace Sciences Meeting}, 22312 pages = {2039}, 22313 year = {2015} 22314} 22315 22316@Article{ barralolivieralauzet2017, 22317 title = {Time-accurate anisotropic mesh adaptation for three-dimensional time-dependent 22318 problems with body-fitted moving geometries}, 22319 author = {Nicolas Barral and G{\'e}raldine Olivier and Fr{\'e}d{\'e}ric Alauzet}, 22320 journal = {Journal of Computational Physics}, 22321 volume = {331}, 22322 pages = {157--187}, 22323 year = {2017} 22324} 22325 22326@Article{ ibanezbarralkrakosloseillemichalpark2017, 22327 title = {First Benchmark of the Unstructured Grid Adaptation Working Group}, 22328 author = {Daniel Ibanez and Nicolas Barral and Joshua Krakos and Adrien Loseille and Todd 22329 Michal and Mike Park}, 22330 journal = {Procedia engineering}, 22331 volume = {203}, 22332 pages = {154--166}, 22333 year = {2017} 22334} 22335 22336@InProceedings{ parkbarralibanezkamenetskiykrakosmichalloseille2018, 22337 title = {Unstructured Grid Adaptation and Solver Technology for Turbulent Flows}, 22338 author = {Michael A Park and Nicolas Barral and Daniel Ibanez and Dmitry S Kamenetskiy and 22339 Joshua A Krakos and Todd R Michal and Adrien Loseille}, 22340 booktitle = {2018 AIAA Aerospace Sciences Meeting}, 22341 pages = {1103}, 22342 year = {2018} 22343} 22344 22345@InProceedings{ barralangeloudiskramergormanpiggott2018, 22346 title = {An anisotropic mesh adaptation approach for regional tidal energy hydrodynamics 22347 modelling}, 22348 author = {Nicolas Barral and Athanasios Angeloudis and Stephan C Kramer and Gerard J Gorman 22349 and Matthew D Piggott}, 22350 booktitle = {EGU General Assembly Conference Abstracts}, 22351 volume = {20}, 22352 pages = {19168}, 22353 year = {2018} 22354} 22355 22356@Article{ principe2009, 22357 title = {{Mathematical models for thermally coupled low speed flows}}, 22358 author = {Javier Principe and Ramon Codina}, 22359 journal = {Advances in Theoretical and Applied Mechanics}, 22360 volume = {2}, 22361 number = {1-4}, 22362 pages = {93--112}, 22363 url = {http://www.m-hikari.com/atam/atam2009/atam1-4-2009/principeATAM1-4-2009.pdf}, 22364 year = {2009} 22365} 22366 22367@Book{ vandervorst2003, 22368 title = {Iterative {K}rylov Methods for Large Linear Systems}, 22369 author = {van der Vorst, H.}, 22370 isbn = {9780521818285}, 22371 publisher = {Cambridge University Press}, 22372 year = {2003} 22373} 22374 22375@Book{ peres2006, 22376 author = {Asher Peres}, 22377 title = {Quantum theory: concepts and methods}, 22378 volume = {57}, 22379 publisher = {Springer Science \& Business Media}, 22380 year = {2006} 22381} 22382 22383@Book{ kuttler2012, 22384 title = {Linear algebra: theory and applications}, 22385 author = {Kenneth Kuttler}, 22386 url = {http://www.math.byu.edu/~klkuttle/Linearalgebra.pdf}, 22387 year = {2012} 22388} 22389 22390@Book{ elman_silvester_wathen_2014, 22391 place = {Oxford}, 22392 title = {Finite elements and fast iterative solvers: with applications in incompressible 22393 fluid dynamics}, 22394 publisher = {Oxford University Press}, 22395 author = {Elman, Howard C. and Silvester, David J. and Wathen, Andrew J.}, 22396 url = {https://global.oup.com/academic/product/finite-elements-and-fast-iterative-solvers-9780199678792?cc=us&lang=en&}, 22397 year = {2014} 22398} 22399 22400@Article{ alametal2007, 22401 title = {An evaluation of the ORNL Cray XT3}, 22402 author = {S. R. Alam and R. F. Barrett and M. R. Fahey and J. A. Kuehn and O. E. B. Messer 22403 and R. T. Mills and P. C. Roth and J. S. Vetter and P. H. Worley}, 22404 journal = {International Journal of High Performance Computing Applications}, 22405 volume = {22}, 22406 number = {1}, 22407 pages = {52--80}, 22408 doi = {10.1177/1094342007085019}, 22409 year = {2007} 22410} 22411 22412@Article{ plazacarey2000, 22413 title = {Local refinement of simplicial grids based on the skeleton}, 22414 author = {Plaza, A. and Carey, Graham F.}, 22415 journal = {Applied Numerical Mathematics}, 22416 doi = {10.1016/S0168-9274(99)00022-7}, 22417 issn = {01689274}, 22418 volume = {32}, 22419 number = {2}, 22420 pages = {195--218}, 22421 year = {2000} 22422} 22423 22424@Article{ carsonstrakos2020, 22425 title = {On the cost of iterative computations}, 22426 author = {Eric Carson and Zden\v{e}k Strako\v{s}}, 22427 journal = {Phil. Trans. R. Soc. A}, 22428 volume = {378}, 22429 number = {20190050}, 22430 doi = {10.1098/rsta.2019.0050}, 22431 url = {https://royalsocietypublishing.org/doi/full/10.1098/rsta.2019.0050}, 22432 year = {2020} 22433} 22434 22435@Article{ schoberl1999, 22436 title = {Multigrid methods for a parameter dependent problem in primal variables}, 22437 author = {Joachim Sch{\"o}berl}, 22438 journal = {Numerische Mathematik}, 22439 volume = {84}, 22440 number = {1}, 22441 pages = {97--119}, 22442 year = {1999} 22443} 22444 22445@Article{ wuleexuzikatanov2008, 22446 title = {Convergence analysis on iterative methods for semidefinite systems}, 22447 author = {Jinbiao Wu and Young-Ju Lee and Jinchao Xu and Ludmil Zikatanov}, 22448 journal = {Journal of Computational Mathematics}, 22449 pages = {797--815}, 22450 year = {2008} 22451} 22452 22453@Article{ maierrannacher2016, 22454 title = {Duality-based adaptivity in finite element discretization of heterogeneous 22455 multiscale problems}, 22456 author = {Maier, Matthias and Rannacher, Rolf}, 22457 journal = {Journal of Numerical Mathematics}, 22458 volume = {24}, 22459 number = {3}, 22460 pages = {167--187}, 22461 year = {2016} 22462} 22463 22464@Article{ maierrannacher2018, 22465 title = {A duality-based optimization approach for model adaptivity in heterogeneous 22466 multiscale problems}, 22467 author = {Maier, Matthias and Rannacher, Rolf}, 22468 journal = {Multiscale Modeling \& Simulation}, 22469 volume = {16}, 22470 number = {1}, 22471 pages = {412--428}, 22472 year = {2018} 22473} 22474 22475@Article{ margetismaierluskin2017, 22476 title = {On the Wiener--Hopf method for surface plasmons: Diffraction from semiinfinite 22477 metamaterial sheet}, 22478 author = {Margetis, Dionisios and Maier, Matthias and Luskin, Mitchell}, 22479 journal = {Studies in Applied Mathematics}, 22480 volume = {139}, 22481 number = {4}, 22482 pages = {599--625}, 22483 year = {2017} 22484} 22485 22486@Article{ maiermargetisluskin2017b, 22487 title = {Dipole excitation of surface plasmon on a conducting sheet: Finite element 22488 approximation and validation}, 22489 author = {Maier, Matthias and Margetis, Dionisios and Luskin, Mitchell}, 22490 journal = {Journal of Computational Physics}, 22491 volume = {339}, 22492 pages = {126--145}, 22493 year = {2017} 22494} 22495 22496@Article{ maiermargetisluskin2018, 22497 title = {Generation of surface plasmon-polaritons by edge effects}, 22498 author = {Matthias Maier and Dionisios Margetis and Mitchell Luskin}, 22499 journal = {Communications in Mathematical Sciences}, 22500 volume = {16}, 22501 number = {1}, 22502 pages = {77--95}, 22503 url = {http://arxiv.org/abs/1702.00848}, 22504 year = {2018} 22505} 22506 22507@Article{ maiermattheakiskaxirasluskinmargetis2018, 22508 title = {Universal behavior of a dispersive Dirac cone in gradient-index plasmonic 22509 metamaterials}, 22510 author = {Maier, Matthias and Mattheakis, Marios and Kaxiras, Efthimios and Luskin, 22511 Mitchell and Margetis, Dionisios}, 22512 journal = {Physical Review B}, 22513 volume = {97}, 22514 number = {3}, 22515 pages = {035307}, 22516 year = {2018} 22517} 22518 22519@Article{ maiermattheakiskaxirasluskinmargetis2019, 22520 title = {Homogenization of plasmonic crystals: seeking the epsilon-near-zero effect}, 22521 author = {Maier, Matthias and Mattheakis, Marios and Kaxiras, Efthimios and Luskin, 22522 Mitchell and Margetis, Dionisios}, 22523 journal = {Proceedings of the Royal Society A}, 22524 volume = {475}, 22525 number = {2230}, 22526 pages = {20190220}, 22527 year = {2019} 22528} 22529 22530@Article{ maiermargetisluskin2020, 22531 title = {Finite-size effects in wave transmission through plasmonic crystals: A tale of 22532 two scales}, 22533 author = {Maier, Matthias and Luskin, Mitchell and Margetis, Dionisios}, 22534 journal = {Physical Review B}, 22535 volume = {102}, 22536 number = {7}, 22537 pages = {075308}, 22538 year = {2020} 22539} 22540 22541@Article{ margetismaierstauberlowluskin2020, 22542 title = {Nonretarded edge plasmon-polaritons in anisotropic two-dimensional materials}, 22543 author = {Margetis, Dionisios and Maier, Matthias and Stauber, Tobias and Low, Tony and 22544 Luskin, Mitchell}, 22545 journal = {Journal of Physics A: Mathematical and Theoretical}, 22546 volume = {53}, 22547 number = {5}, 22548 pages = {055201}, 22549 year = {2020} 22550} 22551 22552@Article{ maiermargetismellet2020, 22553 title = {Homogenization of time-harmonic Maxwell’s equations in nonhomogeneous plasmonic 22554 structures}, 22555 author = {Maier, Matthias and Margetis, Dionisios and Mellet, Antoine}, 22556 journal = {Journal of Computational and Applied Mathematics}, 22557 volume = {377}, 22558 pages = {112909}, 22559 year = {2020} 22560} 22561 22562@Article{ maierkronbichler2021, 22563 title = {Efficient parallel 3D computation of the compressible Euler equations with an 22564 invariant-domain preserving second-order finite-element scheme}, 22565 author = {Maier, Matthias and Kronbichler, Martin}, 22566 journal = {ACM Transactions on Parallel Computing}, 22567 volume = {8}, 22568 number = {3}, 22569 pages = {1--30}, 22570 year = {2021} 22571} 22572 22573@Article{ guermondmaierpopovtomas2021, 22574 title = {Second-order invariant domain preserving approximation of the compressible 22575 Navier--Stokes equations}, 22576 author = {Guermond, Jean-Luc and Maier, Matthias and Popov, Bojan and Tomas, Ignacio}, 22577 journal = {Computer Methods in Applied Mechanics and Engineering}, 22578 volume = {375}, 22579 pages = {113608}, 22580 year = {2021} 22581} 22582 22583@Article{ liliptonmaier2021, 22584 title = {Lorentz Resonance in the Homogenization of Plasmonic Crystals}, 22585 author = {Li, Wei and Lipton, Robert and Maier, Matthias}, 22586 eprint = {2009.12166}, 22587 archiveprefix = {arXiv}, 22588 primaryclass = {phys.optics}, 22589 year = {2021} 22590} 22591 22592@Article{ songmaierluskin2020, 22593 title = {Nonlinear eigenvalue problems for coupled Helmholtz equations modeling 22594 gradient-index graphene waveguides}, 22595 author = {Song, Jung Heon and Maier, Matthias and Luskin, Mitchell}, 22596 journal = {Journal of Computational Physics}, 22597 volume = {423}, 22598 pages = {109871}, 22599 year = {2020} 22600} 22601 22602@Article{ songmaierluskin2019, 22603 title = {Adaptive finite element simulations of waveguide configurations involving 22604 parallel 2D material sheets}, 22605 author = {Song, Jung Heon and Maier, Matthias and Luskin, Mitchell}, 22606 journal = {Computer Methods in Applied Mechanics and Engineering}, 22607 volume = {351}, 22608 pages = {20--34}, 22609 year = {2019} 22610} 22611 22612% 22613% <a name="consults"></a><H3><center>Users Who have Visited ANL for Consulting on PETSc</center></H3> 22614% 22615% 22616@Unpublished{ rob1, 22617 author = {Rob Kunz}, 22618 institution = {Computational Mechanics Division, Applied Research Laboratory, The Pennsylvania 22619 State University}, 22620 url = {http://www.arl.psu.edu/areas/compmech/compmech.html}, 22621 sponsors = {U.S. Navy, NRC}, 22622 note = {Using the PETSc and hypre linear solvers to solve pressure equations in CFD 22623 simulations, including lake warming by power plants}, 22624 dates = {Oct 3 and 4, 2002}, 22625 email = {rfk@wt.arl.psu.edu} 22626} 22627 22628@Unpublished{ au1, 22629 author = {Feng Wang and William Appelbe}, 22630 institution = {VPAC, Victorian Partnership for Advanced Computing, Melbourne, Australia}, 22631 url = {http://www.vpac.org}, 22632 sponsors = { }, 22633 note = {Using PETSc for a Variety of Geophysical Simulations}, 22634 dates = {Nov 22, 2002} 22635} 22636 22637@Unpublished{ carl1, 22638 author = {Carl Sovinec}, 22639 institution = {Applied Physics, University of Wisconsin}, 22640 url = {http://nimrodteam.org}, 22641 sponsors = {DOE Office of Fusion Research}, 22642 note = {Investigating using PETSc for NIMROD}, 22643 dates = {Nov 21, 2002}, 22644 email = {sovinec@engr.wisc.edu} 22645} 22646 22647@Unpublished{ au1b, 22648 author = {Pablo Carrica and Robert Wilson}, 22649 institution = {INSTITUTE HYDRAULIC RESEARCH, University of Iowa}, 22650 url = {http://}, 22651 sponsors = {Office of Naval Research}, 22652 note = {Using PETSc for a hydrodynamics of ships and submarines}, 22653 dates = {Sept, 2002}, 22654 email = {pablo-carrica@uiowa.edu and robert-wilson@uiowa.edu} 22655} 22656 22657% ------------------- TAO References ---------------------- 22658@Article{ benson:2001:csp, 22659 author = {Steven J. Benson and Lois Curfman McInnes and Jorge J. More'}, 22660 title = {A Case Study in the Performance and Scalability of Optimization Algorithms}, 22661 journal = {{ACM} Transactions on Mathematical Software}, 22662 volume = {27}, 22663 number = {3}, 22664 month = sep, 22665 year = {2001}, 22666 pages = {361--376} 22667} 22668 22669@TechReport{ tao-user-ref-2000, 22670 author = {Steve Benson and Lois Curfman McInnes and Jorge Mor\'{e}}, 22671 title = {{TAO} Users Manual}, 22672 year = {2000}, 22673 institution = {Mathematics and Computer Science Division, Argonne National Laboratory}, 22674 number = {ANL/MCS-TM-242}, 22675 note = {See \url{http://www.mcs.anl.gov/tao}} 22676} 22677 22678% ------------------- Optimization References ---------------------- 22679@Book{ optguide93, 22680 title = {Optimization Software Guide}, 22681 author = {Jorge J. Mor\'{e} and Stephen J. Wright}, 22682 publisher = {SIAM Publications}, 22683 address = {Philadelphia}, 22684 year = {1993} 22685} 22686 22687@InProceedings{ more84, 22688 author = {Jorge J. Mor\'{e} and Danny C. Sorenson and Burton S. Garbow and Kenneth E. 22689 Hillstrom}, 22690 title = {The {MINPACK} Project}, 22691 booktitle = {Sources and Development of Mathematical Software}, 22692 editor = {Wayne R. Cowell}, 22693 year = {1984}, 22694 pages = {88--111} 22695} 22696 22697@Article{ steihaug:83, 22698 author = {Trond Steihaug}, 22699 title = {The Conjugate Gradient Method and Trust Regions in Large Scale Optimization}, 22700 journal = {SIAM J. Numer. Anal.}, 22701 volume = {20}, 22702 year = {1983}, 22703 pages = {626--637}, 22704 key = {steihaug92 ! trust_region} 22705} 22706 22707@TechReport{ minpack2test, 22708 author = {Brett M. Averick and Richard G. Carter and Jorge J. Mor\'{e}}, 22709 title = {The {MINPACK-2} Test Problem Collection}, 22710 institution = {Argonne National Laboratory}, 22711 year = {1991}, 22712 number = {ANL/MCS-TM-150}, 22713 key = {more91 ! MINPACK-2} 22714} 22715 22716@TechReport{ hohmann:94, 22717 author = {Andreas Hohmann}, 22718 title = {Object Oriented Design of Multilevel {N}ewton and Continuation Methods}, 22719 institution = {Konrad-Zuse-Zentrum fur Informationstechnik Berlin}, 22720 year = {1994}, 22721 number = {SC-94-4}, 22722 key = {Hohmann94} 22723} 22724 22725@TechReport{ meza:94, 22726 author = {Juan C. Meza}, 22727 title = {{OPT}++: An Object-Oriented Class Library for Nonlinear Optimization}, 22728 institution = {Sandia National Laboratory}, 22729 year = {1994}, 22730 number = {SAND94-8225}, 22731 key = {Meza94} 22732} 22733 22734@Book{ nw99, 22735 author = {Jorge Nocedal and Stephen J. Wright}, 22736 title = {Numerical Optimization}, 22737 year = {1999}, 22738 publisher = {Springer-Verlag}, 22739 address = {New York} 22740} 22741 22742@Book{ dennis:83, 22743 author = {J. E. {Dennis Jr.} and Robert B. Schnabel}, 22744 title = {Numerical Methods for Unconstrained Optimization and Nonlinear Equations}, 22745 publisher = {Prentice-Hall, Inc.}, 22746 address = {Englewood Cliffs, NJ}, 22747 year = {1983} 22748} 22749 22750@TechReport{ more:92, 22751 author = {Jorge J. Mor\'{e} and David Thuente}, 22752 title = {Line search algorithms with guaranteed sufficient decrease}, 22753 institution = {Mathematics and Computer Science Division, Argonne National Laboratory}, 22754 year = {1992}, 22755 number = {MCS-P330-1092} 22756} 22757 22758@Article{ more-toraldo, 22759 author = {Jorge J. Mor\'e and G. Toraldo}, 22760 journal = {SIOPT}, 22761 pages = {93--113}, 22762 title = {On the solution of large quadratic programming problems with bound constraints}, 22763 volume = {1}, 22764 year = {1991} 22765} 22766 22767@Article{ byrd:1995:lma, 22768 author = {Richard H. Byrd and Peihuang Lu and Jorge Nocedal and Ci You Zhu}, 22769 title = {A Limited Memory Algorithm for Bound Constrained Optimization}, 22770 journal = {SIAM Journal on Scientific Computing}, 22771 volume = {16}, 22772 number = {5}, 22773 pages = {1190--1208}, 22774 month = sep, 22775 year = {1995}, 22776 coden = {SJOCE3}, 22777 issn = {1064-8275 (print), 1095-7197 (electronic)}, 22778 mrclass = {90C30 (65K05)}, 22779 mrnumber = {96e:90039}, 22780 mrreviewer = {Henry Wolkowicz}, 22781 bibdate = {Fri Dec 4 16:17:35 MST 1998} 22782} 22783 22784@Article{ lin_c3, 22785 author = {C.-J. Lin and J. J. Mor\'e}, 22786 title = {Newton's method for large bound-constrained optimization problems}, 22787 year = {1999}, 22788 journal = {SIOPT}, 22789 volume = {9(4)}, 22790 pages = {1100--1127}, 22791 url = {http://www.mcs.anl.gov/home/more/papers/nb.ps.gz} 22792} 22793 22794@TechReport{ dolan2, 22795 author = {E. Dolan and J. J. Mor\'{e}}, 22796 title = {Benchmarking Optimization Software with Performance Profiles}, 22797 year = {2001}, 22798 month = jan, 22799 number = {ANL/MCS-P861-1200}, 22800 institution = {Mathematics and Computer Science Division, Argonne National Laboratory}, 22801 address = {Argonne, IL}, 22802 url = {http://www.mcs.anl.gov/~more/cops/} 22803} 22804 22805@InProceedings{ owlqn, 22806 author = {Galen Andrew and Jianfeng Gao}, 22807 title = {Scalable training of L1-regularized log-linear models}, 22808 booktitle = {Proceedings of the 24th international conference on Machine learning (ICML)}, 22809 pages = {33--40}, 22810 year = {2007} 22811} 22812 22813@Article{ bmrm, 22814 author = {Choon Hue Teo and S.V.N. Vishwanathan and Alex J. Smola and Quoc V. Le}, 22815 title = {Bundle methods for regularized risk minimization}, 22816 year = {2010}, 22817 journal = {Journal of Machine Learning Research}, 22818 volume = {11}, 22819 pages = {311--365} 22820} 22821 22822% ------------------- Component Software References ---------------------- 22823@InProceedings{ cca99, 22824 author = {R. Armstrong and D. Gannon and A. Geist and K. Keahey and S. Kohn and L. C. 22825 McInnes and S. Parker and B. Smolinski}, 22826 title = {Toward a Common Component Architecture for High-Performance Scientific 22827 Computing}, 22828 booktitle = {Proceedings of {High Performance Distributed Computing}}, 22829 pages = {115--124}, 22830 year = {1999}, 22831 note = {See \url{http://cca-forum.org}} 22832} 22833 22834@Book{ szyperski98, 22835 author = {Clemens Szyperski}, 22836 title = {Component Software: Beyond Object-Oriented Programming}, 22837 publisher = {ACM Press}, 22838 address = {New York}, 22839 year = {1998} 22840} 22841 22842@Article{ broy98, 22843 author = {Manfred Broy and Anton Deimel and Juergen Henn and Kai Koskimies and 22844 Franti\v{s}ek Pl\'{a}\v{s}il and Gustave Pomberger and Wolfgang Pree and Michael 22845 Stal and Clemens Szyperski}, 22846 title = {What Characterizes a (Software) Component?}, 22847 journal = {Software -- Concepts and Tools}, 22848 publisher = {Springer-Verlag}, 22849 year = {1998}, 22850 volume = {19}, 22851 pages = {49--56} 22852} 22853 22854@Article{ componentware:94, 22855 author = {Jon Udell}, 22856 title = {Componentware}, 22857 journal = {Byte}, 22858 volume = {may}, 22859 pages = {46--56}, 22860 year = {1994}, 22861 key = {Udell94 ! componentware} 22862} 22863 22864@Misc{ cca-web-page, 22865 author = {{Common Component Architecture Forum}}, 22866 note = {See \url{http://cca-forum.org}} 22867} 22868 22869% --------------- References for Tools Used by TAO Developers ----------------- 22870 22871% 22872% tohtml: Used to generate on-line TAO users manual and manual pages 22873% 22874@TechReport{ tohtml, 22875 author = {William Gropp}, 22876 title = {Users Manual for tohtml: Producing true hypertext documents from {LaTeX}}, 22877 institution = {Argonne National Laboratory}, 22878 number = {ANL/MCS-TM-00}, 22879 month = jan, 22880 year = {1995}, 22881 key = {tohtml} 22882} 22883 22884% 22885% doctext: Used to generate tex version of TAO manual pages 22886% 22887@TechReport{ doctext, 22888 author = {William Gropp}, 22889 title = {Users Manual for doctext: Producing documentation from {C} source code}, 22890 institution = {Argonne National Laboratory}, 22891 number = {ANL/MCS-TM-00}, 22892 month = jan, 22893 year = {1995}, 22894 key = {doctext} 22895} 22896 22897% 22898% bfort: Used to generate TAO Fortran interface 22899% 22900@TechReport{ bfort, 22901 author = {William Gropp}, 22902 title = {Users Manual for bfort: Producing {F}ortran interfaces to {C} source code}, 22903 institution = {Argonne National Laboratory}, 22904 number = {ANL/MCS-TM-208}, 22905 month = mar, 22906 year = {1995}, 22907 key = {doctext} 22908} 22909 22910% ------------------------- PETSc References ------------------------------ 22911@InProceedings{ petsc, 22912 author = {Satish Balay and William D. Gropp and Lois Curfman McInnes and Barry F. Smith}, 22913 title = {Efficient Management of Parallelism in Object Oriented Numerical Software 22914 Libraries}, 22915 booktitle = {Modern Software Tools in Scientific Computing}, 22916 editor = {E. Arge and A. M. Bruaset and H. P. Langtangen}, 22917 publisher = {Birkhauser Press}, 22918 pages = {163--202}, 22919 year = {1997} 22920} 22921 22922% ------------------------- Misc Other References ------------------------------ 22923@Misc{ indeps-web-page, 22924 title = {{InDEPS} {W}eb page}, 22925 note = {http://z.ca.sandia.gov/\~{ }indeps/}, 22926 author = {et al. Robert Armstrong}, 22927 institution = {Sandia National Laboratory}, 22928 key = {{InDEPS} {W}eb page} 22929} 22930 22931@Misc{ pooma, 22932 title = {{POOMA}: {A} FrameWork for scientific computing applications on parallel ar 22933 chitectures}, 22934 year = {1996}, 22935 author = {J. V. W. Reynders and J. C. Cummings and P. J. Hinker and M. Tholburn a nd M. S. 22936 S. Banerjee and S. Karmesin and S. Atlas and K. Keahey and W. F. Humphr ey} 22937} 22938 22939@Misc{ isis++-web-page, 22940 title = {{ISIS++} {W}eb Page}, 22941 note = {See \url{http://ca.sandia.gov/isis}}, 22942 author = {Robert L. Clay and Kyran Mish and Alan B. Williams}, 22943 institution = {Sandia National Laboratories} 22944} 22945 22946@Misc{ trilinos-web-page, 22947 title = {{Trilinos} {W}eb Page}, 22948 note = {See 22949 \url{http://www.cs.sandia.gov/\~mheroux/Trilinos/doc/TrilinosIntroduction.htm}}, 22950 author = {Mike Heroux et al.}, 22951 institution = {Sandia National Laboratories} 22952} 22953 22954@Misc{ alice-web-page, 22955 title = {{ALICE} {W}eb page}, 22956 note = {http://www.mcs.anl.gov/\-alice, Mathematics and Computer Science Division, 22957 Argonne National Laboratory}, 22958 key = {{ALICE} {W}eb page} 22959} 22960 22961@Misc{ autodiff-webpage, 22962 author = {{Computational Differentiation Project}}, 22963 note = {See \url{http://www.mcs.anl.gov/autodiff}} 22964} 22965 22966@Misc{ coool-home-page, 22967 author = {Lydia Deng and Wences Gouveia and John Scales}, 22968 title = {{The CWP Object-Oriented Optimization Library}}, 22969 note = {See \url{http://www.cwp.mines.edu/cwpcodes/coool}} 22970} 22971 22972@Misc{ rice-inversion-home-page, 22973 author = {Mark S. Gokenbach and William W. Symes}, 22974 title = {{The Hilbert Class Library}}, 22975 note = {See \url{http://www.trip.caam.rice.edu/}} 22976} 22977 22978@Misc{ opt++-home-page, 22979 author = {{OPT++: An Object-Oriented Nonlinear Optimization Library}}, 22980 note = {See \url{http://csmr.ca.sandia.gov/projects/opt/opt++.html}} 22981} 22982 22983@Article{ gockenbach:1999:ccl, 22984 author = {Mark S. Gockenbach and Matthew J. Petro and William W. Symes}, 22985 title = {C++ Classes for Linking Optimization with Complex Simulations}, 22986 journal = {{ACM} Transactions on Mathematical Software}, 22987 volume = {25}, 22988 number = {2}, 22989 month = jun, 22990 year = {1999}, 22991 pages = {191-212}, 22992 abstract = {The object-oriented programming paradigm can be used to overcome the 22993 incompatibilities between off-the-shelf optimization software and application 22994 software. The Hilbert Class Library (HCL) defines the fundamental mathematical 22995 objects arising in optimization problems, such as vectors, linear operators, and 22996 so forth, as C++ classes, making it possible to write optimization code in a 22997 natural fashion, while allowing application software such as simulators to use the 22998 most convenient data structures and programming style. In spite of the poor 22999 reputation C++ has for runtime performance, the use of mixed-language programming 23000 allows performance equal to that achieved by standard Fortran packages, as 23001 comparisons with the popular code LBFGS and ARPACK demonstrate.}, 23002 accepted = {April 1999}, 23003 url = {http://www.acm.org/pubs/citations/journals/toms/1999-25-2/p191-gockenbach/} 23004} 23005 23006@Misc{ neos-guide, 23007 author = {{The Optimization Software Guide}}, 23008 note = {See \url{http://www.mcs.anl.gov/otc/Guide/}} 23009} 23010 23011@Article{ boyd, 23012 title = {Distributed optimization and statistical learning via the alternating direction 23013 method of multipliers}, 23014 author = {Boyd, Stephen and Parikh, Neal and Chu, Eric and Peleato, Borja and Eckstein, 23015 Jonathan and others}, 23016 journal = {Foundations and Trends{\textregistered} in Machine learning}, 23017 volume = {3}, 23018 number = {1}, 23019 pages = {1-122}, 23020 year = {2011}, 23021 publisher = {Now Publishers, Inc.} 23022} 23023 23024@Misc{ :alertsys, 23025 title = {page{ALERT}}, 23026 organization = {Alert Systems, Inc}, 23027 address = {Madison, Wisconsin}, 23028 note = {http://www.alertsys.com/} 23029} 23030 23031@Manual{ :cmfortran, 23032 title = {{CM} {F}ortran Language Reference Manual}, 23033 organization = {Thinking Machines Corporation}, 23034 year = {1994}, 23035 address = {Cambridge, MA} 23036} 23037 23038@Manual{ :cmmd, 23039 title = {{CMMD} Reference Manual, Version 3.0}, 23040 organization = {Thinking Machines Corporation}, 23041 year = {1993}, 23042 address = {Cambridge, MA} 23043} 23044 23045@Manual{ :cmssl, 23046 title = {{CMSSL} for {CM} {F}ortran}, 23047 volume = {I}, 23048 organization = {Thinking Machines Corporation}, 23049 year = {1994}, 23050 address = {Cambridge, MA} 23051} 23052 23053@Misc{ :condor, 23054 author = {M. Livny}, 23055 title = {{PI}, The {Condor} Project, High Throughput Computing}, 23056 howpublished = {www.cs.wisc.edu/condor} 23057} 23058 23059@Manual{ :connection, 23060 title = {Connection Machine {CM}--5 Technical Summary}, 23061 organization = {Thinking Machines Corporation}, 23062 year = {1993}, 23063 address = {Cambridge, MA} 23064} 23065 23066@Manual{ :cplex, 23067 title = {{CPLEX} Optimizer}, 23068 organization = {ILOG CPLEX Division}, 23069 address = {889 Alder Avenue, Incline Village, Nevada}, 23070 note = {http://www.cplex.com/} 23071} 23072 23073@Manual{ :cplextm, 23074 title = {Using the {CPLEX(TM)} Linear Optimizer and {CPLEX(TM)} Mixed Integer Optimizer 23075 (Version 2.0)}, 23076 organization = {CPLEX Optimization Inc.}, 23077 year = {1992}, 23078 address = {Incline Village, Nevada} 23079} 23080 23081@Misc{ :fatcop, 23082 author = {M. C. Ferris}, 23083 title = {{PI}, {FATCOP}: {A} Fault Tolerant {Condor} {PVM} Mixed Integer Programming 23084 Solver}, 23085 howpublished = {www.cs.wisc.edu/math-prog/fatcop} 23086} 23087 23088@Misc{ :metaneos, 23089 author = {S. J. Wright}, 23090 title = {{metaNEOS}: Metacomputing Environments for Optimization}, 23091 howpublished = {www-unix.mcs.anl.gov/metaneos} 23092} 23093 23094@InCollection{ gropp.more:optimization, 23095 author = {W. Gropp and J. J. Mor\'e}, 23096 title = {Optimization environments and the {NEOS} Server}, 23097 booktitle = {Approximation Theory and Optimization}, 23098 pages = {167--182}, 23099 publisher = {Cambridge University Press}, 23100 year = {1997}, 23101 editor = {M. D. Buhmann and A. Iserles} 23102} 23103 23104@Article{ czyzyk.mesnier.ea:neos, 23105 author = {J. Czyzyk and M. P. Mesnier and J. J. Mor\'e}, 23106 title = {The {NEOS} Server}, 23107 journal = {IEEE Journal on Computational Science and Engineering}, 23108 volume = {5}, 23109 year = {1998}, 23110 pages = {68--75} 23111} 23112 23113@Book{ :osl, 23114 title = {Handbook for {IBM OSL}}, 23115 author = {M. S. Hung and W. O. Rom and A. D. Warren}, 23116 year = {1994}, 23117 publisher = {Boyd and Fraser}, 23118 address = {Danvers, Massachusetts} 23119} 23120 23121@Manual{ :pro-matlab, 23122 title = {{PRO}--{MATLAB} User's Guide}, 23123 organization = {The MathWorks, Inc.}, 23124 year = {1989}, 23125 address = {21 Eliot Street, South Natick, MA 01760} 23126} 23127 23128@Misc{ :prostate, 23129 key = {Biomedical}, 23130 title = {Biomedical Business International Newsletter}, 23131 howpublished = {pp. 72--75}, 23132 year = {1996} 23133} 23134 23135@Misc{ :sipcase, 23136 key = {Natural}, 23137 title = {Natural Gas Planning: An Application of Stochastic Linear Programming}, 23138 howpublished = {http://www-fp.mcs.anl.gov/otc/Guide/CaseStudies/slp/index.html} 23139} 23140 23141@Book{ aarts.korst:simulated, 23142 author = {E. Aarts and J. Korst}, 23143 title = {Simulated Annealing and Boltzman Machines}, 23144 year = {1990}, 23145 publisher = {John Wiley \& Sons}, 23146 address = {Chichester} 23147} 23148 23149@TechReport{ aarts.laarhoven.ea:local-search-based, 23150 author = {E. H. L. Aarts and P. J. M. van Laarhoven and N. L. J. Ulder}, 23151 title = {Local-Search-Based Algorithms for Job Shop Scheduling}, 23152 institution = {Centre for Quantitative Methods}, 23153 year = {1991}, 23154 address = {Nederlandse Philips Bedrijven B.V., P.O. Box 218, NL-5600 MD Eindhoven}, 23155 number = {106}, 23156 type = {CQM-Not} 23157} 23158 23159@Article{ aashtiani.magnanti:equilibria, 23160 author = {H. Z. Aashtiani and T. L. Magnanti}, 23161 title = {Equilibria on a congested transportation network}, 23162 journal = {SIAM Journal on Algebraic and Discrete Methods}, 23163 volume = {2}, 23164 year = {1981}, 23165 pages = {213--226} 23166} 23167 23168@Article{ ablow.brigham:analog, 23169 author = {C. M. Ablow and G. Brigham}, 23170 title = {An Analog Solution of Programming Problems}, 23171 journal = {Operations Research}, 23172 year = {1955}, 23173 volume = {3}, 23174 pages = {388--394} 23175} 23176 23177@Article{ achuthan.grabowski.ea:optimal, 23178 author = {N. R. Achuthan and J. Grabowski and J. B. Sidney}, 23179 title = {Optimal Flow--Shop Scheduling with Earliness and Tardiness Penalties}, 23180 journal = {Opsearch}, 23181 year = {1981}, 23182 volume = {18}, 23183 pages = {117--138} 23184} 23185 23186@Book{ adelman.robinson:income, 23187 author = {I. Adelman and S. Robinson}, 23188 title = {Income Distribution Policy in Developing Countries}, 23189 publisher = {Stanford University Press}, 23190 year = {1978}, 23191 address = {Stanford, California} 23192} 23193 23194@Article{ adler.resende.ea:implementation, 23195 author = {I. Adler and M. G. C. Resende and G. Veiga and N. K. Karmarkar}, 23196 title = {An Implementation of {K}armarkar's Algorithm for Linear Programming}, 23197 journal = {Mathematical Programming}, 23198 year = {1989}, 23199 volume = {44}, 23200 pages = {297--336} 23201} 23202 23203@TechReport{ aeberhard.coomans.ea:comparison, 23204 author = {S. Aeberhard and D. Coomans and O. de Vel}, 23205 title = {Comparison of Classifiers in High Dimensional Settings}, 23206 institution = {Departments of Computer Science and of Mathematics and Statistics, James Cook 23207 University of North Queensland}, 23208 year = {1992}, 23209 number = {92-02}, 23210 type = {Technical Report} 23211} 23212 23213@Article{ aganagic.cottle:constructive, 23214 author = {M. Aganagi\'{c} and R. W. Cottle}, 23215 title = {A Constructive Characterization of ${Q}_0$ Matrices with Nonnegative Principal 23216 Minors}, 23217 journal = {Mathematical Programming}, 23218 year = {1987}, 23219 volume = {37}, 23220 pages = {223--231} 23221} 23222 23223@TechReport{ aganagic:iterative, 23224 author = {M. Aganagi\'{c}}, 23225 title = {Iterative Methods for the Linear Complementarity Problem}, 23226 institution = {Systems Optimization Laboratory, Department of Operations Research, Stanford 23227 University}, 23228 year = {1978}, 23229 type = {SOL}, 23230 number = {78-10}, 23231 address = {Stanford, California} 23232} 23233 23234@Book{ ahlfors:complex, 23235 author = {L. V. Ahlfors}, 23236 title = {Complex Analysis}, 23237 publisher = {McGraw--Hill Book Company}, 23238 address = {New York}, 23239 series = {International Series in Pure and Applied Mathematics}, 23240 edition = {Second}, 23241 year = {1966} 23242} 23243 23244@Article{ ahn:solution, 23245 author = {B--H. Ahn}, 23246 title = {Solution of Non--Symmetric Linear Complementarity Problems by Iterative Methods}, 23247 journal = {Journal of Optimization Theory and Applications}, 23248 year = {1981}, 23249 volume = {33}, 23250 pages = {175--185} 23251} 23252 23253@Article{ al-fahed.stavroulakis.ea:hard, 23254 author = {A. M. Al-Fahed and G. E. Stavroulakis and P. D. Panagiotopoulos}, 23255 title = {Hard and soft fingered robot grippers. The linear complementarity approach}, 23256 journal = {Zeitschrift f{\"{u}}r Angewandte Mathematik und Mechanik}, 23257 volume = {71}, 23258 year = {1991}, 23259 pages = {257--265} 23260} 23261 23262@Article{ al-fahed.stavroulakis.ea:linear, 23263 author = {A. M. Al-Fahed and G. E. Stavroulakis and P. D. Panagiotopoulos}, 23264 title = {A linear complementarity approach to the frictionless gripper}, 23265 journal = {International Journal of Robotic Research}, 23266 volume = {11}, 23267 year = {1992}, 23268 pages = {112--122} 23269} 23270 23271@Article{ al-khayyal.falk:jointly, 23272 author = {F. A. Al--Khayyal and J. E. Falk}, 23273 title = {Jointly Constrained Biconvex Programming}, 23274 journal = {Mathematics of Operations Research}, 23275 year = {1983}, 23276 volume = {8}, 23277 pages = {273--286} 23278} 23279 23280@Article{ al-khayyal.kyparisis:finite, 23281 author = {F. A. Al--Khayyal and J. Kyparisis}, 23282 title = {Finite Convergence of Algorithms for Nonlinear Programs and Variational 23283 Inequalities}, 23284 journal = {Journal of Optimization Theory and Applications}, 23285 year = {1991}, 23286 volume = {70}, 23287 pages = {319--332} 23288} 23289 23290@PhDThesis{ al-khayyal:biconvex, 23291 author = {F. A. Al--Khayyal}, 23292 title = {Biconvex Programming and Biconcave Minimization}, 23293 year = {1977}, 23294 school = {The George Washington University} 23295} 23296 23297@Article{ alart.curnier:mixed, 23298 author = {P. Alart and A. Curnier}, 23299 title = {A mixed formulation for frictional contact problems prone to {N}ewton like 23300 solution methods}, 23301 journal = {Computer Methods in Applied Mechanics and Engineering}, 23302 volume = {92}, 23303 year = {1991}, 23304 pages = {353--375} 23305} 23306 23307@Misc{ alexander.kellog.ea:piecewise, 23308 author = {J.~C. Alexander and R.~B. Kellog and T.-Y. Li and J~.A. Yorke}, 23309 title = {Piecewise smooth continuation}, 23310 howpublished = {Manuscript}, 23311 year = {1979} 23312} 23313 23314@InCollection{ alexander.li.ea:piecewise, 23315 author = {J.~C. Alexander and T.-Y. Li and J~.A. Yorke}, 23316 title = {Piecewise smooth homotopies}, 23317 booktitle = {Homotopy Methods and Global Convergence}, 23318 pages = {1--14}, 23319 publisher = {Plenum Press}, 23320 year = {1983}, 23321 editor = {B.~C. Eaves and F.~J. Gould and H.-O. Peitgen and M.~J. Todd}, 23322 address = {New York} 23323} 23324 23325@InCollection{ alexander:topological, 23326 author = {J.~C. Alexander}, 23327 title = {The topological theory of an embedding method}, 23328 booktitle = {Continuation Methods}, 23329 pages = {37--68}, 23330 publisher = {Academic Press}, 23331 year = {1978}, 23332 editor = {H. Wacker}, 23333 address = {New York} 23334} 23335 23336@Book{ allen:probability, 23337 author = {A. O. Allen}, 23338 title = {Probability, Statistics and Queueing Theory}, 23339 publisher = {Academic Press}, 23340 year = {1990}, 23341 address = {London}, 23342 edition = {Second} 23343} 23344 23345@Book{ allgower.georg:numerical, 23346 author = {E. L. Allgower and K. Georg}, 23347 title = {Numerical Continuation Methods, An Introduction}, 23348 publisher = {Springer-Verlag}, 23349 year = {1990}, 23350 address = {Berlin} 23351} 23352 23353@InProceedings{ allgower.georg:predictor-corrector, 23354 crossref = {bachem.grotschel.ea:mathematical}, 23355 author = {E. L. Allgower and K. Georg}, 23356 title = {Predictor--Corrector and Simplicial Methods for Approximating Fixed Points and 23357 Zero Points of Nonlinear Mappings}, 23358 pages = {15--56} 23359} 23360 23361@Article{ aluffi-pentini.parisi.ea:algorithm, 23362 author = {F. Aluffi-Pentini and V. Parisi and F. Zirilli}, 23363 title = {Algorithm 667: {SIGMA}- {A} Stochastic-Integration Global Minimization 23364 Algorithm}, 23365 journal = {ACM Transactions on Mathematical Software}, 23366 year = {1988}, 23367 volume = {14}, 23368 pages = {366--380} 23369} 23370 23371@Article{ anandalingam.friesz:hierarchical, 23372 author = {G. Anandalingam and T. L. Friesz}, 23373 title = {Hierarchical Optimization: An Introduction}, 23374 journal = {Annals of Operations Research}, 23375 year = {1992}, 23376 volume = {34}, 23377 pages = {1--11} 23378} 23379 23380@Article{ anandalingam.white:solution, 23381 author = {G. Anandalingam and D. J. White}, 23382 title = {A Solution Method for the Linear Static Stackelberg Problem Using Penalty 23383 Functions}, 23384 journal = {IEEE Transactions on Automatic Control}, 23385 year = {1990}, 23386 volume = {35}, 23387 number = {10}, 23388 pages = {1170--1173} 23389} 23390 23391@Article{ andersen.andersen:presolving, 23392 author = {E. Andersen and K. Andersen}, 23393 title = {Presolving in Linear Programming}, 23394 year = {1995}, 23395 journal = {Mathematical Programming}, 23396 volume = {71}, 23397 pages = {221--245} 23398} 23399 23400@InProceedings{ andersen.ye:homogeneous, 23401 author = {E. Andersen and Y. Ye}, 23402 title = {On a Homogeneous Algorithm for a Monotone Complementarity Problem with Nonlinear 23403 Equality Constraints}, 23404 crossref = {ferris.pang:complementarity}, 23405 pages = {1--11} 23406} 23407 23408@Book{ anderson.bai.ea:lapack, 23409 author = {E. Anderson and Z. Bai and C. Bischof and J. Demmel and J. Dongarra and J. Du 23410 Cros and A. Greenbaum and S. Hammarling and A. McKenney and S. Ostrouchov and D. 23411 Sorensen}, 23412 title = {{LAPACK} User's Guide}, 23413 publisher = {SIAM}, 23414 year = {1995}, 23415 address = {Philadelphia, Pennsylvania}, 23416 edition = {Second} 23417} 23418 23419@Article{ anderson.ferris:direct, 23420 author = {E. J. Anderson and M. C. Ferris}, 23421 title = {A Direct Search Algorithm for Optimization with Noisy Function Evaluations}, 23422 year = {2001}, 23423 journal = {SIAM Journal on Optimization, forthcoming}, 23424 url = {ftp://ftp.cs.wisc.edu/math-prog/tech-reports/96-11.ps}, 23425 key = {55} 23426} 23427 23428@InProceedings{ anderson.ferris:genetic, 23429 author = {E. J. Anderson and M. C. Ferris}, 23430 title = {A Genetic Algorithm for the Assembly Line Balancing Problem}, 23431 booktitle = {Proceedings of the Integer Programming / Combinatorial Optimization Conference, 23432 Waterloo, Ontario, Canada, May 28--30}, 23433 publisher = {University of Waterloo Press}, 23434 key = {14}, 23435 year = {1990} 23436} 23437 23438@Article{ anderson.ferris:genetic*1, 23439 author = {E. J. Anderson and M. C. Ferris}, 23440 title = {Genetic Algorithms for Combinatorial Optimization: The Assembly Line Balancing 23441 Problem}, 23442 journal = {ORSA Journal on Computing}, 23443 year = {1994}, 23444 url = {ftp: //ftp.cs.wisc.edu/math-prog/tech-reports/93-ga.ps}, 23445 volume = {6}, 23446 pages = {161--173}, 23447 key = {22} 23448} 23449 23450@InProceedings{ anderson.ferris:parallel, 23451 author = {E. J. Anderson and M. C. Ferris}, 23452 title = {Parallel Genetic Algorithms in Optimization}, 23453 booktitle = {Proceedings of the Fourth SIAM conference on Parallel Processing for Scientific 23454 Computing, Chicago, Illinois, December 11-13}, 23455 year = {1989}, 23456 key = {12} 23457} 23458 23459@Unpublished{ anderson.lewis:primal, 23460 author = {E. J. Anderson and A. S. Lewis}, 23461 title = {A New Primal Algorithm for Semi-Infinite Linear Programming}, 23462 note = {In preparation} 23463} 23464 23465@Book{ anderson.nash:linear, 23466 author = {E. J. Anderson and P. Nash}, 23467 title = {Linear Programming in Infinite--Dimensional Spaces}, 23468 year = {1987}, 23469 publisher = {John Wiley \& Sons}, 23470 address = {Chichester} 23471} 23472 23473@InProceedings{ anderson:primal, 23474 author = {E. J. Anderson}, 23475 title = {A New Primal Algorithm for Semi-Infinite Linear Programming}, 23476 booktitle = {Proceedings of an International Symposium on Infinite Dimensional Linear 23477 Programming, Cambridge, September 1984}, 23478 year = {1985}, 23479 editor = {E. J. Anderson and A. B. Philpott}, 23480 publisher = {Springer-Verlag}, 23481 address = {Berlin} 23482} 23483 23484@Article{ andradottir:method, 23485 author = {S. Andrad\'{o}ttir}, 23486 title = {A Method of Discrete Stochastic Optimization}, 23487 journal = {Management Science}, 23488 year = {1995}, 23489 volume = {41}, 23490 pages = {1946--1961} 23491} 23492 23493@Article{ andradottir:global, 23494 author = {S. Andrad\'{o}ttir}, 23495 title = {A Global Search Method for Discrete Stochastic Optimization}, 23496 journal = {SIAM Journal on Optimization}, 23497 year = {1996}, 23498 volume = {6}, 23499 pages = {513--530} 23500} 23501 23502@TechReport{ anitescu.lesaja.ea:infeasible-interior-point, 23503 author = {M. Anitescu and G. Lesaja and F. A. Potra}, 23504 title = {An infeasible--interior--point predictor--corrector algorithm for the 23505 {P}$_x$--geometric {LCP}}, 23506 institution = {Department of Mathematics, The University of Iowa}, 23507 address = {Iowa City, Iowa}, 23508 year = {1994}, 23509 number = {62}, 23510 type = {Reports on Computational Mathematics} 23511} 23512 23513@TechReport{ anitescu.potra:formulating, 23514 author = {M. Anitescu and F. A. Potra}, 23515 title = {Formulating Dynamic Multi-Rigid-Body Contact Problems with Friction as Solvable 23516 Linear Complementarity Problems}, 23517 institution = {Department of Mathematics, The University of Iowa}, 23518 year = {1996}, 23519 type = {Report}, 23520 number = {93}, 23521 address = {Iowa City, Iowa} 23522} 23523 23524@Article{ anstreicher.lee.ea:crashing, 23525 author = {K. M. Anstreicher and J. Lee and T. F. Rutherford}, 23526 title = {Crashing a Maximum-Weight Complementarity Basis}, 23527 journal = {Mathematical Programming}, 23528 year = {1992}, 23529 volume = {54}, 23530 pages = {281--294} 23531} 23532 23533@Article{ anstreicher:combined, 23534 author = {K. M. Anstreicher}, 23535 title = {A combined phase {I}--phase {II} scaled potential algorithm for linear 23536 programming}, 23537 journal = {Mathematical Programming}, 23538 year = {1991}, 23539 volume = {52}, 23540 pages = {429--440} 23541} 23542 23543@Article{ anstreicher:combined*1, 23544 author = {K. M. Anstreicher}, 23545 title = {A combined phase {I}--phase {II} projective algorithm for linear programming}, 23546 journal = {Mathematical Programming}, 23547 year = {1989}, 23548 volume = {43}, 23549 pages = {209--223} 23550} 23551 23552@InCollection{ arbenz.gander.ea:remote, 23553 author = {P. Arbenz and W. Gander and M. Oettli}, 23554 title = {The Remote Computational System}, 23555 booktitle = {High-Performance Computation and Networks}, 23556 publisher = {Springer-Verlag}, 23557 year = {1996}, 23558 volume = {1067}, 23559 series = {Lecture Notes in Computer Science}, 23560 pages = {662--667} 23561} 23562 23563@InCollection{ arcus:comsoal, 23564 author = {A. L. Arcus}, 23565 title = {{COMSOAL}: {A} Computer Method of Sequencing Operations for Assembly Lines}, 23566 booktitle = {Readings in Production and Operations Management}, 23567 year = {1966}, 23568 editor = {E. S. Buffa}, 23569 publisher = {John Wiley \& Sons}, 23570 address = {New York} 23571} 23572 23573@TechReport{ arioli.chan.ea:computing, 23574 author = {M. Arioli and T. F. Chan and I. S. Duff and N. I. M. Gould and J. K. Reid}, 23575 title = {Computing a Search Direction for Large-Scale Linearly-Constrained Nonlinear 23576 Optimization Calculations}, 23577 institution = {CERFACS}, 23578 year = {1993}, 23579 number = {TR/PA/93/34} 23580} 23581 23582@Article{ armijo:minimization, 23583 author = {L. Armijo}, 23584 title = {Minimization of Functions having {L}ipschitz-continuous First Partial 23585 Derivatives}, 23586 journal = {Pacific Journal of Mathematics}, 23587 year = {1966}, 23588 volume = {16}, 23589 pages = {1--3} 23590} 23591 23592@Article{ arrow.debreu:existence, 23593 author = {K. Arrow and G. Debreu}, 23594 title = {Existence of Equilibrium for a Competitive Economy}, 23595 journal = {Econometrica}, 23596 year = {1954}, 23597 volume = {22}, 23598 pages = {265--290} 23599} 23600 23601@InCollection{ arrow.solow:gradient, 23602 author = {K. J. Arrow and R. M. Solow}, 23603 title = {Gradient Methods for Constrained Maxima with Weakened Assumptions}, 23604 booktitle = {Studies in Linear and Nonlinear Programming}, 23605 year = {1958}, 23606 editor = {K. J. Arrow and L. Hurwicz and H. Uzawa}, 23607 publisher = {Stanford University Press}, 23608 address = {Stanford, California}, 23609 pages = {166--176} 23610} 23611 23612@Book{ aubin.ekeland:nonlinear, 23613 author = {J.-P. Aubin and I. Ekeland}, 23614 title = {Applied nonlinear analysis}, 23615 publisher = {John Wiley \& Sons}, 23616 address = {New York}, 23617 year = {1984} 23618} 23619 23620@Article{ auchmuty:variational, 23621 author = {G. Auchmuty}, 23622 title = {Variational Principles for Variational Inequalities}, 23623 journal = {Numerical Functional Analysis and Optimization}, 23624 year = {1989}, 23625 volume = {10}, 23626 pages = {863--874} 23627} 23628 23629@Book{ auerbach.kotlikoff:dynamic, 23630 author = {A. J. Auerbach and L. J. Kotlikoff}, 23631 title = {Dynamic Fiscal Policy}, 23632 publisher = {Cambridge University Press}, 23633 address = {Cambridge, England}, 23634 year = {1987} 23635} 23636 23637@InProceedings{ ault.deutsch.ea:interpolating, 23638 author = {D. A. Ault and F. R. Deutsch and P. D. Morris and J. E. Olson}, 23639 title = {Interpolating Subspaces in Approximation Theory}, 23640 booktitle = {Approximation Theory}, 23641 year = {1970}, 23642 editor = {A. Talbot}, 23643 publisher = {Academic Press}, 23644 address = {London} 23645} 23646 23647@Article{ auslender.crouzeix:global, 23648 author = {A. A. Auslender and J.--P. Crouzeix}, 23649 title = {Global Regularity Theorems}, 23650 journal = {Mathematics of Operations Research}, 23651 year = {1988}, 23652 volume = {13}, 23653 pages = {243--253} 23654} 23655 23656@Article{ auslender.haddou:interior-proximal, 23657 author = {A. Auslender and M. Haddou}, 23658 title = {An interior-proximal method for convex linearly constrained problems and its 23659 extension to variational inequalities}, 23660 year = {1995}, 23661 journal = {Mathematical Programming}, 23662 pages = {77--100}, 23663 volume = {71} 23664} 23665 23666@Article{ auslender:convergence, 23667 author = {A. Auslender}, 23668 title = {Convergence of stationary sequences for variational inequalities with maximal 23669 monotone operators}, 23670 journal = {Applied Mathematics and Optimization}, 23671 volume = {28}, 23672 year = {1993}, 23673 pages = {161--172} 23674} 23675 23676@Book{ auslender:optimization, 23677 author = {A. Auslender}, 23678 title = {Optimization {M}\'{e}thodes Num\'{e}riques}, 23679 year = {1976}, 23680 publisher = {Masson}, 23681 address = {Paris} 23682} 23683 23684@TechReport{ averick.carter.ea:minpack-2, 23685 author = {B. M. Averick and R. G. Carter and J. J. Mor\'e and G. -L. Xue}, 23686 title = {The {MINPACK-2} Test Problem Collection}, 23687 institution = {Argonne National Laboratory}, 23688 year = {1992}, 23689 address = {Argonne, Illinois}, 23690 number = {MCS-P153-0692} 23691} 23692 23693@TechReport{ axline.billups.ea:guidelines, 23694 author = {R. A. Axline and S. C. Billups and M. F. Grady}, 23695 title = {Guidelines for Software Security ({U})}, 23696 institution = {SNL}, 23697 year = {1989}, 23698 month = oct, 23699 address = {Albuquerque, New Mexico}, 23700 number = {SAND88-2955} 23701} 23702 23703@Article{ ayres.walter:greenhouse, 23704 author = {R. U. Ayres and J. Walter}, 23705 title = {The Greenhouse Effect: Damages, Costs and Abatement}, 23706 journal = {Environmental and Resource Economics}, 23707 year = {1991}, 23708 volume = {1}, 23709 pages = {237--270} 23710} 23711 23712@PhDThesis{ bagley:behaviour, 23713 author = {J. D. Bagley}, 23714 title = {The Behaviour of Adaptive Systems which employ Genetic and Correlation 23715 Algorithms}, 23716 year = {1967}, 23717 school = {University of Michigan} 23718} 23719 23720@Article{ bain.stewart:application, 23721 author = {R. S. Bain and W. E. Stewart}, 23722 title = {Application of Robust Nonmonotonic Descent Criteria to the Solution of Nonlinear 23723 Algebraic Equation Systems}, 23724 journal = {Computers in Chemical Engineering}, 23725 year = {1991}, 23726 volume = {15}, 23727 pages = {203--208} 23728} 23729 23730@Article{ baker.lasdon:successive, 23731 author = {T. E. Baker and L. S. Lasdon}, 23732 title = {Successive Linear Programming at {E}xxon}, 23733 journal = {Management Science}, 23734 year = {1985}, 23735 volume = {31}, 23736 pages = {264--274} 23737} 23738 23739@InProceedings{ baker:reducing, 23740 crossref = {grefenstette:genetic}, 23741 author = {J. E. Baker}, 23742 title = {Reducing Bias and Inefficiency in the Selection Algorithm}, 23743 pages = {14--21} 23744} 23745 23746@Article{ balas.zemel:algorithm, 23747 author = {E. Balas and E. Zemel}, 23748 title = {An Algorithm for Large Zero--One Knapsack Problems}, 23749 journal = {Operations Research}, 23750 year = {1980}, 23751 volume = {28}, 23752 pages = {1132--1154} 23753} 23754 23755@Book{ ballard.fullerton.ea:general, 23756 author = {C. Ballard and D. Fullerton and J. B. Shoven and J. Whalley}, 23757 title = {A General Equilibrium Model for Tax Policy Evaluation}, 23758 publisher = {The University of Chicago Press}, 23759 year = {1985}, 23760 series = {National Bureau of Economic Research Monograph} 23761} 23762 23763@InProceedings{ balog.angelos.ea:dose, 23764 author = {J. Balog and L. Angelos and T. R. Mackie and P. Reckwerdt}, 23765 title = {Dose Computation for a One-Dimensional Multileaf Collimator}, 23766 booktitle = {Proceedings of the XII International Conference on the Use of Computers in 23767 Radiation Therapy, Salt Lake City}, 23768 year = {1997}, 23769 editor = {D. D. Leavitt and G. Starkshall}, 23770 publisher = {Medical Physics Publishing}, 23771 address = {St. Louis, Missouri}, 23772 pages = {323--326} 23773} 23774 23775@Article{ baraff:fast, 23776 author = {D. Baraff}, 23777 title = {Fast contact force computation for nonpenetrating rigid bodies}, 23778 journal = {Computer Graphics (Proceedings SIGRAPH)}, 23779 year = {1994}, 23780 pages = {23--34}, 23781 volume = {28} 23782} 23783 23784@Article{ baraff:issues, 23785 author = {D. Baraff}, 23786 title = {Issues in computing contact forces for nonpenetrating rigid bodies}, 23787 journal = {Algorithmica}, 23788 volume = {10}, 23789 year = {1993}, 23790 pages = {292--352} 23791} 23792 23793@Book{ barrett.berry.ea:templates, 23794 title = {Templates for the Solution of Linear Systems: Building Blocks for Iterative 23795 Methods}, 23796 author = {R. Barrett and M. Berry and T. F. Chan and J. Demmel and J. Donato and J. 23797 Dongarra and V. Eijkhout and R. Pozo and C. Romine and H. van der Vorst}, 23798 year = {1994}, 23799 publisher = {SIAM}, 23800 address = {Philadelphia, Pennsylvania} 23801} 23802 23803@Article{ bard:algorithm, 23804 author = {J. F. Bard}, 23805 title = {An Algorithm for Solving the General Bi--Level Programming Problem}, 23806 journal = {Mathematics of Operations Research}, 23807 year = {1983}, 23808 volume = {8}, 23809 pages = {260--272} 23810} 23811 23812@Article{ bard:convex, 23813 author = {J. F. Bard}, 23814 title = {Convex Two-Level Optimization}, 23815 journal = {Mathematical Programming}, 23816 year = {1988}, 23817 volume = {40}, 23818 pages = {15--27} 23819} 23820 23821@InCollection{ bard:eclectic, 23822 author = {Y. Bard}, 23823 title = {An Eclectic Approach to Nonlinear Programming}, 23824 booktitle = {Optimization}, 23825 publisher = {University of Queensland Press}, 23826 editor = {R. S. Anderson and L. S. Jennings and D. M. Ryan}, 23827 year = {1972}, 23828 address = {St. Lucia, Queensland, Australia}, 23829 pages = {116--128} 23830} 23831 23832@Article{ barnes:variation, 23833 author = {E. R. Barnes}, 23834 title = {A Variation on {K}armarkar's Algorithm for Solving Linear Programming Problems}, 23835 journal = {Mathematical Programming}, 23836 year = {1986}, 23837 volume = {36}, 23838 pages = {174--182} 23839} 23840 23841@Article{ bartels.golub:simplex, 23842 author = {R. H. Bartels and G. H. Golub}, 23843 title = {The Simplex Method of Linear Programming using {LU} Decomposition}, 23844 journal = {Communications of the Asociation for Computing Machinery}, 23845 year = {1969}, 23846 volume = {12}, 23847 pages = {266--268} 23848} 23849 23850@Article{ barton.ivey:nelder, 23851 author = {R. Barton and J. S. Ivey}, 23852 title = {{N}elder {M}ead Simplex Modifications for Simulation Optimization}, 23853 journal = {Management Science}, 23854 year = {1996}, 23855 volume = {42}, 23856 number = {7}, 23857 pages = {954--973} 23858} 23859 23860@Article{ battiti:first-, 23861 author = {R. Battiti}, 23862 title = {First- and Second-Order Methods for Learning: Between Steepest Descent and 23863 {N}ewton's Method}, 23864 journal = {Neural Computation}, 23865 year = {1992}, 23866 volume = {4}, 23867 pages = {141--166} 23868} 23869 23870@Article{ baudet:asynchronous, 23871 author = {G. M. Baudet}, 23872 title = {Asynchronous iterative methods for multiprocesors}, 23873 journal = {Journal of the Association for Computing Machinery}, 23874 year = {1978}, 23875 volume = {25}, 23876 pages = {226--244} 23877} 23878 23879@InProceedings{ baum.haussler:what, 23880 author = {E. B. Baum and D. Haussler}, 23881 title = {What Size Net Gives Valid Generalization}, 23882 booktitle = {Advances in Neural Information Processing Systems I}, 23883 year = {1989}, 23884 editor = {D. S. Touretzky}, 23885 publisher = {Morgan Kaufmann}, 23886 address = {San Mateo, California}, 23887 pages = {81--90} 23888} 23889 23890@Misc{ baum:private, 23891 author = {E. B. Baum}, 23892 title = {Private Communication}, 23893 year = {1992}, 23894 address = {NEC Research Institute, Princeton, New Jersey} 23895} 23896 23897@Book{ bazaraa.sherali.ea:nonlinear, 23898 author = {M. S. Bazaraa and H. D. Sherali and C. M. Shetty}, 23899 title = {Nonlinear Programming}, 23900 edition = {Second}, 23901 publisher = {John Wiley and Sons}, 23902 address = {New York}, 23903 year = {1993} 23904} 23905 23906@Book{ bazaraa.shetty:nonlinear, 23907 author = {M. S. Bazaraa and C. M. Shetty}, 23908 title = {Nonlinear Programming: Theory and Algorithms}, 23909 publisher = {John Wiley \& Sons}, 23910 year = {1979}, 23911 address = {New York, New York} 23912} 23913 23914@Article{ beale:cycling, 23915 author = {E. M. L. Beale}, 23916 title = {Cycling in the Dual Simplex Method}, 23917 journal = {Naval Research Logistics Quarterly}, 23918 year = {1955}, 23919 volume = {2}, 23920 pages = {103--107} 23921} 23922 23923@InProceedings{ becker.cun:improving, 23924 author = {S. Becker and Y. le Cun}, 23925 title = {Improving the Convergence of Backpropagation Learning with Second Order Methods}, 23926 booktitle = {Proceedings of 1988 Connectionist Models Summer School}, 23927 year = {1988}, 23928 editor = {D. S. Touretzky}, 23929 publisher = {Morgan Kaufmann}, 23930 address = {San Mateo, California}, 23931 pages = {29--37} 23932} 23933 23934@Book{ ben-israel.ben-tal.ea:optimality, 23935 author = {A. Ben--Israel and A. Ben--Tal and S. Zlobec}, 23936 title = {Optimality in Nonlinear Programming: {A} Feasible Directions Approach}, 23937 year = {1981}, 23938 publisher = {John Wiley \& Sons}, 23939 address = {New York} 23940} 23941 23942@Article{ ben-israel:newton-raphson, 23943 author = {A. Ben--Israel}, 23944 title = {A {N}ewton--{R}aphson Method for the Solution of Systems of Equations}, 23945 journal = {Journal of Mathematical Analysis and its Applications}, 23946 year = {1966}, 23947 volume = {15}, 23948 pages = {243--252} 23949} 23950 23951@Article{ ben-tal.melman.ea:curved, 23952 author = {A. Ben--Tal and A. Melman and J. Zowe}, 23953 title = {Curved Search Methods for Unconstrained Optimization}, 23954 journal = {Optimization}, 23955 year = {1990}, 23956 volume = {21}, 23957 pages = {669--695}, 23958 publisher = {John Wiley \& Sons}, 23959 address = {New York} 23960} 23961 23962@InProceedings{ bennett.ferris.ea:genetic, 23963 crossref = {belew.booker:fourth}, 23964 author = {K. Bennett and M. C. Ferris and Y. E. Ioannidis}, 23965 title = {A Genetic Algorithm for Database Query Optimization}, 23966 pages = {400--407}, 23967 url = {ftp: //ftp.cs.wisc.edu/tech-reports/reports/1991/tr1004.ps}, 23968 key = {19} 23969} 23970 23971@Article{ bennett.mangasarian:bilinear, 23972 author = {K. P. Bennett and O. L. Mangasarian}, 23973 title = {Bilinear Separation of Two Sets in n-Space}, 23974 journal = {Computational Optimization and Applications}, 23975 year = {1993}, 23976 volume = {2}, 23977 pages = {207--227} 23978} 23979 23980@Article{ bennett.mangasarian:multicategory, 23981 author = {K. P. Bennett and O. L. Mangasarian}, 23982 title = {Multicategory Separation via Linear Programming}, 23983 journal = {Optimization Methods and Software}, 23984 year = {1993}, 23985 volume = {3}, 23986 pages = {27--39} 23987} 23988 23989@InProceedings{ bennett.mangasarian:neural, 23990 author = {K. P. Bennett and O. L. Mangasarian}, 23991 title = {Neural Network Training via Linear Programming}, 23992 booktitle = {Advances in Optimization and Parallel Computing}, 23993 year = {1992}, 23994 editor = {P. M. Pardalos}, 23995 publisher = {North Holland}, 23996 address = {Amsterdam}, 23997 pages = {56--67} 23998} 23999 24000@Article{ bennett.mangasarian:robust, 24001 author = {K. P. Bennett and O. L. Mangasarian}, 24002 title = {Robust Linear Programming Discrimination of Two Linearly Inseparable Sets}, 24003 journal = {Optimization Methods and Software}, 24004 year = {1992}, 24005 volume = {1}, 24006 pages = {23--34} 24007} 24008 24009@Article{ bennett.mangasarian:serial, 24010 author = {K. P. Bennett and O. L. Mangasarian}, 24011 title = {Serial and Parallel Multicategory Separation}, 24012 journal = {SIAM Journal on Optimization}, 24013 year = {1994}, 24014 volume = {4}, 24015 pages = {722--734} 24016} 24017 24018@TechReport{ bennett.wu.ea:support, 24019 author = {K. P. Bennett and D. Wu and L. Auslender}, 24020 title = {On Support Vector Decision Trees for Database Marketing}, 24021 institution = {Department of Mathematical Sciences, Rensselaer Polytechnic Institute}, 24022 year = {1998}, 24023 optkey = {}, 24024 opttype = {RPI Math Report}, 24025 optnumber = {98-100}, 24026 optaddress = {Troy, New York}, 24027 optmonth = {}, 24028 optnote = {}, 24029 optannote = {} 24030} 24031 24032@InProceedings{ bennett:decision, 24033 author = {K. P. Bennett}, 24034 title = {Decision Tree Construction Via Linear Programming}, 24035 booktitle = {Proceedings of the 4th Midwest Artificial Intelligence and Cognitive Science 24036 Society Conference}, 24037 year = {1992}, 24038 editor = {M. Evans}, 24039 address = {Utica, Illinois}, 24040 pages = {97--101} 24041} 24042 24043@Book{ berge.ghouila-houri:programming, 24044 author = {C. Berge and A. Ghouila-Houri}, 24045 title = {Programming, Games and Transportation Networks}, 24046 year = {1965}, 24047 publisher = {John Wiley \& Sons}, 24048 address = {New York} 24049} 24050 24051@Book{ berge:topological, 24052 author = {C. Berge}, 24053 title = {Topological Spaces}, 24054 year = {1963}, 24055 publisher = {McMillan}, 24056 address = {New York} 24057} 24058 24059@TechReport{ berkelaar.jansen.ea:basis, 24060 author = {A. B. Berkelaar and B. Jansen and C. Roos and T. Terlaky}, 24061 title = {Basis and Tripartition Identification for Quadratic Programming and Linear 24062 Complementarity Problems}, 24063 institution = {Department of Econometrics and Operations Research}, 24064 year = {1996}, 24065 address = {Erasmus University, Rotterdam, The Netherlands} 24066} 24067 24068@Article{ bertsekas.baz:distributed, 24069 author = {D. P. Bertsekas and D. El Baz}, 24070 title = {Distributed Asynchronous Relaxation Methods for the Convex Network Flow Problem}, 24071 journal = {SIAM Journal on Control and Optimization}, 24072 year = {1987}, 24073 volume = {25}, 24074 pages = {74--85} 24075} 24076 24077@Article{ bertsekas.gafni:projection, 24078 author = {D. P. Bertsekas and E. M. Gafni}, 24079 title = {Projection Methods for Variational Inequalities with Application to the Traffic 24080 Assignment Problem}, 24081 journal = {Mathematical Programming Study}, 24082 year = {1982}, 24083 volume = {17}, 24084 pages = {139--159} 24085} 24086 24087@Article{ bertsekas.hossein.ea:relaxation, 24088 author = {D. P. Bertsekas and P. Hossein and P. Tseng}, 24089 title = {Relaxation Methods for Network Flow Problems with Convex Arc Costs}, 24090 journal = {SIAM Journal on Control and Optimization}, 24091 year = {1987}, 24092 volume = {25}, 24093 pages = {1219--1243} 24094} 24095 24096@Unpublished{ bertsekas.tseng:partial, 24097 author = {D. P. Bertsekas and P. Tseng}, 24098 title = {Partial Proximal Minimization for Convex Programming}, 24099 year = {1991}, 24100 note = {Manuscript} 24101} 24102 24103@Article{ bertsekas.tsitsiklis:analysis, 24104 author = {D. P. Bertsekas and J. N. Tsitsiklis}, 24105 title = {An Analysis of Stochastic Shortest Path Problems}, 24106 journal = {Mathematics of Operations Research}, 24107 year = {1991}, 24108 volume = {16}, 24109 pages = {580--595} 24110} 24111 24112@Book{ bertsekas.tsitsiklis:parallel, 24113 author = {D. P. Bertsekas and J. N. Tsitsiklis}, 24114 title = {Parallel and Distributed Computation: Numerical Methods}, 24115 publisher = {Prentice-Hall, Inc}, 24116 year = {1989}, 24117 address = {Englewood Cliffs, New Jersey} 24118} 24119 24120@Book{ bertsekas:constrained, 24121 author = {D. P. Bertsekas}, 24122 title = {Constrained Optimization and Lagrange Multiplier Methods}, 24123 year = {1982}, 24124 publisher = {Academic Press}, 24125 address = {New York} 24126} 24127 24128@Book{ bertsekas:dynamic, 24129 author = {D. P. Bertsekas}, 24130 title = {Dynamic Programming and Optimal Control}, 24131 publisher = {Athena Scientific}, 24132 year = {1995}, 24133 address = {Belmont MA} 24134} 24135 24136@Article{ bertsekas:enlarging, 24137 author = {D. P. Bertsekas}, 24138 title = {Enlarging the Region of Convergence of {N}ewton's Method for Constrained 24139 Optimization}, 24140 journal = {Journal of Optimization Theory and Applications}, 24141 year = {1982}, 24142 volume = {36}, 24143 pages = {221--252} 24144} 24145 24146@Article{ bertsekas:goldstein-levitin-poljak, 24147 author = {D. P. Bertsekas}, 24148 title = {On the {G}oldstein-{L}evitin-{P}oljak Gradient Projection Algorithm}, 24149 journal = {IEEE Transactions on Automatic Control}, 24150 year = {1976}, 24151 volume = {AC-21}, 24152 pages = {174--184} 24153} 24154 24155@Article{ bertsekas:multiplier, 24156 author = {D. P. Bertsekas}, 24157 title = {Multiplier Methods: {A} Survey}, 24158 journal = {Automatica}, 24159 year = {1976}, 24160 volume = {12}, 24161 pages = {133--145} 24162} 24163 24164@Article{ bertsekas:necessary, 24165 author = {D. P. Bertsekas}, 24166 title = {Necessary and Sufficient Conditions for a Penalty Method to be Exact}, 24167 journal = {Mathematical Programming}, 24168 year = {1975}, 24169 volume = {9}, 24170 pages = {87--99} 24171} 24172 24173@Book{ bertsekas:nonlinear, 24174 author = {D. P. Bertsekas}, 24175 title = {Nonlinear Programming}, 24176 publisher = {Athena Scientific}, 24177 year = {1995}, 24178 address = {Belmont, Massachusetts} 24179} 24180 24181@Article{ bertsekas:projected, 24182 author = {Dimitri P. Bertsekas}, 24183 title = {Projected {N}ewton Methods for Optimization Problems with Simple Constraints}, 24184 journal = {SIAM Journal on Control and Optimization}, 24185 year = {1982}, 24186 volume = {20}, 24187 pages = {221--246} 24188} 24189 24190@Article{ billups.dirkse.ea:comparison, 24191 author = {S. C. Billups and S. P. Dirkse and M. C. Ferris}, 24192 title = {A Comparison of Large Scale Mixed Complementarity Problem Solvers}, 24193 journal = {Computational Optimization and Applications}, 24194 year = {1997}, 24195 pages = {3--25}, 24196 volume = {7}, 24197 url = {ftp: //ftp.cs.wisc.edu/math-prog/tech-reports/95-16.ps}, 24198 key = {51} 24199} 24200 24201@Article{ billups.ferris:convergence, 24202 author = {S. C. Billups and M. C. Ferris}, 24203 title = {Convergence of an Infeasible Interior--Point Algorithm from Arbitrary Positive 24204 Starting Points}, 24205 journal = {SIAM Journal on Optimization}, 24206 year = {1996}, 24207 volume = {6}, 24208 pages = {316--325}, 24209 url = {ftp: //ftp.cs.wisc.edu/tech-reports/reports/1993/tr1180.ps}, 24210 key = {34} 24211} 24212 24213@TechReport{ billups.ferris:convergence*1, 24214 author = {S. C. Billups and M. C. Ferris}, 24215 title = {Convergence of Infeasible Interior--Point Algorithms from Arbitrary Starting 24216 Points}, 24217 institution = {Computer Sciences Department, University of Wisconsin}, 24218 year = {1993}, 24219 address = {Madison, Wisconsin}, 24220 number = {1180}, 24221 note = {Revised version in SIAM Journal on Optimization.} 24222} 24223 24224@Article{ billups.ferris:qpcomp, 24225 author = {S. C. Billups and M. C. Ferris}, 24226 title = {{QPCOMP}: {A} Quadratic Program Based Solver for Mixed Complementarity Problems}, 24227 year = {1997}, 24228 journal = {Mathematical Programming}, 24229 pages = {533--562}, 24230 volume = {76}, 24231 url = {ftp: //ftp.cs.wisc.edu/math-prog/tech-reports/95-09.ps}, 24232 key = {47} 24233} 24234 24235@Article{ billups.ferris:solutions, 24236 author = {S. C. Billups and M. C. Ferris}, 24237 title = {Solutions to Affine Generalized Equations Using Proximal Mappings}, 24238 journal = {Mathematics of Operations Research}, 24239 volume = {24}, 24240 pages = {219--236}, 24241 year = {1999}, 24242 url = {ftp://ftp.cs.wisc.edu/math-prog/tech-reports/94-15.ps}, 24243 key = {42}, 24244 institution = {Computer Sciences Department, University of Wisconsin}, 24245 address = {Madison, Wisconsin}, 24246 type = {Mathematical Programming Technical Report}, 24247 number = {94--15} 24248} 24249 24250@TechReport{ billups.murata.ea:users, 24251 author = {S. C. Billups and K. K. Murata and K. E. Washington and D. L. Y. Louie}, 24252 title = {User's manual for {CONTAIN--HWR/0}, Rev. 1: {A} Computer Code for the Analysis of 24253 Heavy Water Nuclear Reactor Containments Under Accident Conditions}, 24254 institution = {SNL}, 24255 year = {1994}, 24256 month = jan, 24257 address = {Albuquerque, New Mexico}, 24258 number = {SAND91--1482} 24259} 24260 24261@TechReport{ billups.speight.ea:nonmonotone, 24262 author = {S. C. Billups and A. L. Speight and L. T. Watson}, 24263 title = {Nonmonotone Path Following Methods for Nonsmooth Equations and Complementarity 24264 Problems}, 24265 institution = {Department of Mathematics, University of Colorado}, 24266 year = {1999}, 24267 address = {Denver, Colorado} 24268} 24269 24270@PhDThesis{ billups:algorithms, 24271 author = {S. C. Billups}, 24272 title = {Algorithms for Complementarity Problems and Generalized Equations}, 24273 school = {University of Wisconsin--Madison}, 24274 year = {1995}, 24275 address = {Madison, Wisconsin}, 24276 month = aug 24277} 24278 24279@MastersThesis{ billups:augmented, 24280 author = {S. C. Billups}, 24281 title = {An Augmented Jacobian Matrix Algorithm for Tracking Homotopy Zero Curves}, 24282 school = {Virginia Tech}, 24283 year = {1985}, 24284 address = {Blacksburg, Virginia} 24285} 24286 24287@TechReport{ billups:homotopy, 24288 author = {S. C. Billups}, 24289 title = {A Homotopy Based Algorithm for Mixed Complementarity Problems}, 24290 institution = {Department of Mathematics, University of Colorado}, 24291 year = {1998}, 24292 address = {Denver, Colorado} 24293} 24294 24295@Article{ billups:improving, 24296 author = {S. C. Billups}, 24297 title = {Improving the Robustness of Descent-Based Methods for Semi-Smooth Equations Using 24298 Proximal Perturbations}, 24299 year = {2000}, 24300 journal = {Mathematical Programming}, 24301 volume = {87}, 24302 pages = {153--176} 24303} 24304 24305@Book{ birge.louveaux:introduction, 24306 author = {J. R. Birge and R. Louveaux}, 24307 title = {Introduction to Stochastic Programming}, 24308 publisher = {Springer}, 24309 address = {New York}, 24310 year = {1997} 24311} 24312 24313@TechReport{ bischof.carle.ea:adifor, 24314 author = {C. Bischof and A. Carle and P. Khademi and A. Mauer and P. Hovland}, 24315 title = {{ADIFOR} 2.0 User's Guide}, 24316 institution = {Argonne National Laboratory}, 24317 year = {1995}, 24318 address = {Argonne, Illinois}, 24319 number = {ANL/MCS--TM--192}, 24320 type = {Mathematics and Computer Science Division Report} 24321} 24322 24323@Book{ bisschop.entriken:aimms, 24324 author = {J. Bisschop and R. Entriken}, 24325 title = {{AIMMS} -- The Modeling System}, 24326 year = {1993}, 24327 publisher = {Paragon Decision Technology}, 24328 address = {Haarlem, The Netherlands} 24329} 24330 24331@Article{ bisschop.meeraus:development, 24332 author = {J. Bisschop and A. Meeraus}, 24333 title = {On the Development of a General Algebraic Modeling System in a Strategic Planning 24334 Environment}, 24335 journal = {Mathematical Programming Study}, 24336 year = {1982}, 24337 volume = {20}, 24338 pages = {1--29} 24339} 24340 24341@Misc{ bixby.ceria.ea:miplib, 24342 author = {R. E. Bixby and S. Ceria and C. M. McZeal and M. W. P. Savelsbergh}, 24343 title = {{MIPLIB} 3.0}, 24344 howpublished = {http://www.caam.rice.edu/\~bixby/miplib/miplib.html} 24345} 24346 24347@InProceedings{ bjorkman.klarbring.ea:sequential, 24348 author = {G. Bj{\"{o}}rkman and A. Klarbring and T. Larsson and M. R{\"{o}}nnqvist and B. 24349 Sj{\"{o}}din}, 24350 title = {Sequential quadratic programming for non-linear elastic contact problems}, 24351 editor = {J. Herskovits}, 24352 booktitle = {Structural Optimization 93, The World Congress on Optimal Design of Structural 24353 Systems}, 24354 volume = {2}, 24355 year = {1993}, 24356 pages = {301--308} 24357} 24358 24359@Article{ bjorkman:path, 24360 author = {G. Bj{\"o}rkman}, 24361 title = {Path Following and Critical Points for Contact Problems}, 24362 journal = {Computational Mechanics}, 24363 volume = {10}, 24364 pages = {231--246}, 24365 year = {1992} 24366} 24367 24368@Article{ bjorkman:solution, 24369 author = {G. Bj{\"o}rkman}, 24370 title = {The Solution of Large Displacement Frictionless Contact Problems using a Sequence 24371 of Linear Complementarity Problems}, 24372 journal = {International Journal for Numerical Methods in Engineering}, 24373 volume = {31}, 24374 pages = {1553--1566}, 24375 year = {1991} 24376} 24377 24378@Article{ bland:pivot, 24379 author = {R. G. Bland}, 24380 title = {New Pivot Rules for the Simplex Method}, 24381 journal = {Mathematics of Operations Research}, 24382 year = {1977}, 24383 volume = {2}, 24384 pages = {103--107} 24385} 24386 24387@Article{ block.levin:boundedness, 24388 author = {H. D. Block and S. A. Levin}, 24389 title = {On the Boundedness of an Iterative Procedure for Solving a System of Linear 24390 Inequalities}, 24391 journal = {Proceedings of the American Mathematical Society}, 24392 year = {1970}, 24393 volume = {26}, 24394 pages = {229--235} 24395} 24396 24397@Book{ bloomer:power, 24398 author = {J. Bloomer}, 24399 title = {Power Programming with {RPC}}, 24400 publisher = {O'Reilly and Associates, Inc.}, 24401 address = {Sebastopol, CA}, 24402 year = {1992} 24403} 24404 24405@InProceedings{ blum.rivest:training, 24406 author = {A. Blum and R. L. Rivest}, 24407 title = {Training a 3-Node Neural Network is {NP}-Complete}, 24408 booktitle = {Advances in Neural Information Processing Systems I}, 24409 year = {1989}, 24410 editor = {D. S. Touretzky}, 24411 publisher = {Morgan Kaufmann}, 24412 address = {San Mateo, California}, 24413 pages = {494--501} 24414} 24415 24416@InProceedings{ boehringer.ferris.ea:exemptions, 24417 author = {C. B{\"{o}}ehringer and M. C. Ferris and T. F. Rutherford}, 24418 title = {Exemptions, Grandfathered Permits and the Costs of Emission Restrictions: Results 24419 from a General Equilibrium Model for Six {EU} Countries}, 24420 key = {49}, 24421 booktitle = {Economic Aspects of Environmental Policy Making in a Federal System}, 24422 year = {1995} 24423} 24424 24425@Article{ boender.kan:bayesian, 24426 author = {C. G. E. Boender and A. H. G. Rinooy Kan}, 24427 title = {Bayesian Stopping Rules for Global Optimization}, 24428 journal = {Mathematical Programming}, 24429 year = {1987}, 24430 volume = {37}, 24431 pages = {59--80} 24432} 24433 24434@Article{ boggs:convergence, 24435 author = {P. T. Boggs}, 24436 title = {The Convergence of the {B}en--{I}srael Iteration for Nonlinear Least Squares 24437 Problems}, 24438 journal = {Mathematics of Computation}, 24439 year = {1976}, 24440 volume = {30}, 24441 pages = {512--522} 24442} 24443 24444@InProceedings{ bolzon.cochetti.ea:computing, 24445 author = {G. Bolzon and G. Cochetti and G. Maier and F. Tin-Loi}, 24446 title = {On computing all solutions in decohesion}, 24447 booktitle = {IUTAM (International Union of Theoretical and Applied Mechanics), 19th 24448 International Congress of Theoretical and Applied Mechanics}, 24449 year = {1996}, 24450 address = {Kyoto} 24451} 24452 24453@InProceedings{ bolzon.maier.ea:holonomic, 24454 author = {G. Bolzon and G. Maier and F. Tin-Loi}, 24455 title = {Holonomic and nonholonomic simulations of quasi-brittle fracture: a comparative 24456 study of mathematical programming approaches}, 24457 booktitle = {Fracture Mechanics of Concrete Structures}, 24458 editor = {F. H. Wittmann}, 24459 series = {Second International Conference on Fracture Mechanics of Concrete Structures 24460 (FRAMCOS 2)}, 24461 year = {1995}, 24462 publisher = {Aedificatio Publishers}, 24463 pages = {885--898} 24464} 24465 24466@InProceedings{ bolzon.maier.ea:holonomic*1, 24467 author = {G. Bolzon and G. Maier and F. Tin-Loi}, 24468 title = {On holonomic structural analysis as a complementarity problem}, 24469 booktitle = {APCOM96, Seoul}, 24470 year = {1996} 24471} 24472 24473@Article{ bolzon.maier.ea:multiplicity, 24474 author = {G. Bolzon and G. Maier and F. Tin-Loi}, 24475 title = {On the Multiplicity of Solutions in Quasi-Brittle Fracture Computations}, 24476 journal = {Computational Mechanics}, 24477 year = {1997}, 24478 volume = {19}, 24479 pages = {511--516} 24480} 24481 24482@Article{ bongartz.conn.ea:cute, 24483 author = {I. Bongartz and A. R. Conn and N. Gould and Ph. L. Toint}, 24484 title = {{CUTE}: Constrained and Unconstrained Testing Environment}, 24485 year = {1995}, 24486 journal = {{ACM} Transactions on Mathematical Software}, 24487 volume = {21}, 24488 pages = {123--160} 24489} 24490 24491@Article{ boppana:eigenvalues, 24492 author = {R. Boppana}, 24493 title = {Eigenvalues and Graph Bisection: An Average Case Analysis}, 24494 journal = {Proc. 28th Annual Symposium on Foundations of Computer Science}, 24495 pages = {280--285}, 24496 year = {1987} 24497} 24498 24499@Article{ bortfeld.kahler.ea:x-ray, 24500 author = {T. R. Bortfeld and D. L. Kahler and T. J. Waldron and A. L. Boyer}, 24501 title = {{X}-ray field compensation with multileaf collimators}, 24502 journal = {International Journal of Radiation Oncology, Biology and Physics}, 24503 year = {1994}, 24504 volume = {28}, 24505 number = {3}, 24506 pages = {723--730} 24507} 24508 24509@Article{ bortfeld.schlegel:optimization, 24510 author = {T. Bortfeld and W. Schlegel}, 24511 title = {Optimization of beam orientations in radiation therapy: some theoretical 24512 considerations}, 24513 journal = {Physics in Medicine and Biology}, 24514 year = {1993}, 24515 volume = {38}, 24516 number = {2}, 24517 pages = {291--304} 24518} 24519 24520@Article{ borwein:stability, 24521 author = {J. M. Borwein}, 24522 title = {Stability and regular points of inequality systems}, 24523 journal = {Journal of Optimization Theory and Applications}, 24524 year = {1986}, 24525 volume = {48}, 24526 pages = {9--52} 24527} 24528 24529@Article{ boyer:present, 24530 author = {A. L. Boyer}, 24531 title = {Present and Future Developments in Radiotherapy Treatment Units}, 24532 journal = {Seminars in Radiation Oncology}, 24533 year = {1995}, 24534 volume = {5}, 24535 number = {2}, 24536 pages = {146--155} 24537} 24538 24539@Article{ bracken.mcgill:mathematical, 24540 author = {J. Bracken and J. T. McGill}, 24541 title = {Mathematical programs with optimization problems in the constraints}, 24542 journal = {Operations Research}, 24543 volume = {21}, 24544 year = {1973}, 24545 pages = {37--44} 24546} 24547 24548@Article{ bradley.fayyad.ea:mathematical, 24549 author = {P. S. Bradley and U. M. Fayyad and O. L. Mangasarian}, 24550 title = {Mathematical Programming for Data Mining: Formulations and Challenges}, 24551 journal = {INFORMS Journal on Computing}, 24552 year = {1999}, 24553 volume = {11}, 24554 pages = {217--238} 24555} 24556 24557@TechReport{ bradley.mangasarian.ea:clustering, 24558 author = {P. S. Bradley and O. L. Mangasarian and W. N. Street}, 24559 title = {Clustering via Concave Minimization}, 24560 institution = {Computer Sciences Department, University of Wisconsin}, 24561 year = {1996}, 24562 type = {Mathematical Programming Technical Report}, 24563 number = {96-03}, 24564 address = {Madison, Wisconsin} 24565} 24566 24567@TechReport{ bradley.mangasarian.ea:feature, 24568 author = {P. S. Bradley and O. L. Mangasarian and W. N. Street}, 24569 title = {Feature Selection via Mathematical Programming}, 24570 institution = {Computer Sciences Department, University of Wisconsin}, 24571 year = {1995}, 24572 type = {Mathematical Programming Technical Report}, 24573 number = {95-21}, 24574 address = {Madison, Wisconsin} 24575} 24576 24577@Article{ bradley.mangasarian:massive, 24578 author = {P. S. Bradley and O. L. Mangasarian}, 24579 title = {Massive Data Discrimination via Linear Support Vector Machines}, 24580 year = {2000}, 24581 journal = {Optimization Methods and Software}, 24582 volume = {13}, 24583 pages = {1-10} 24584} 24585 24586@PhDThesis{ brady:condition, 24587 author = {L. Brady}, 24588 title = {Condition Constants for Solutions of Convex Inequalities}, 24589 year = {1988}, 24590 address = {Madison, Wisconsin}, 24591 school = {Computer Sciences Department, University of Wisconsin} 24592} 24593 24594@Article{ braess:uber, 24595 author = {D. Braess}, 24596 title = {{\"{U}}ber ein {P}aradoxon aus der {V}erkehrsplanung}, 24597 journal = {Unternehmensforschung}, 24598 year = {1968}, 24599 volume = {12}, 24600 pages = {258--268} 24601} 24602 24603@Article{ brahme:optimization, 24604 author = {A. Brahme}, 24605 title = {Optimization of Radiation Therapy and the Development of Multileaf Collimation}, 24606 journal = {International Journal of Radiation Oncology, Biology and Physics}, 24607 year = {1993}, 24608 volume = {25}, 24609 pages = {373--375} 24610} 24611 24612@Article{ brahme:stationary, 24613 author = {A. Brahme}, 24614 title = {Optimization of stationary and moving beam radiation therapy techniques}, 24615 journal = {Radiother. Oncol.}, 24616 year = {1988}, 24617 volume = {12}, 24618 pages = {129--140} 24619} 24620 24621@InCollection{ brahme:treatment, 24622 author = {A. Brahme}, 24623 title = {Treatment Optimization: Using Physical and Radiobiological Objective Functions}, 24624 booktitle = {Radiation Therapy Physics}, 24625 publisher = {Springer-Verlag}, 24626 year = {1995}, 24627 editor = {A. R. Smith}, 24628 address = {Berlin}, 24629 pages = {209--246} 24630} 24631 24632@TechReport{ branch:getting, 24633 author = {M. A. Branch}, 24634 title = {Getting {CUTE} with {M}atlab}, 24635 institution = {Cornell University}, 24636 year = {1994}, 24637 type = {Cornell Theory Center Report}, 24638 number = {CTC94TR194}, 24639 address = {Ithaca, New York} 24640} 24641 24642@Article{ brearley.mitra.ea:analysis, 24643 author = {A. Brearley and G. Mitra and H. Williams}, 24644 title = {Analysis of Mathematical Programming Problems Prior to Applying the Simplex 24645 Algorithm}, 24646 journal = {Mathematical Programming}, 24647 year = {1975}, 24648 volume = {8}, 24649 pages = {54--83} 24650} 24651 24652@Article{ bredensteiner.bennett:feature, 24653 author = {E. Bredensteiner and K. Bennett}, 24654 title = {Feature Minimization within Decision Trees}, 24655 journal = {Computational Optimization and Applications}, 24656 year = {1998}, 24657 volume = {10}, 24658 pages = {111--126} 24659} 24660 24661@Article{ bregman:relaxation, 24662 author = {L. M. Bregman}, 24663 title = {The Relaxation Method of Finding the Common Point of Convex Sets and its 24664 Application to the Solution of Problems in Convex Programming}, 24665 journal = {USSR Computational Mathematics and Mathematical Physics}, 24666 year = {1967}, 24667 volume = {7}, 24668 pages = {200--217} 24669} 24670 24671@Book{ brenner.hall:making, 24672 author = {D. J. Brenner and E. J. Hall}, 24673 title = {Making the Radiation Therapy Decision}, 24674 publisher = {Contemporary Books}, 24675 year = {1996}, 24676 address = {Chicago, IL} 24677} 24678 24679@Book{ brent:algorithms, 24680 author = {R. P. Brent}, 24681 title = {Algorithms for Minimization without Derivatives}, 24682 publisher = {Prentice-Hall, Inc}, 24683 year = {1973}, 24684 address = {Englewood Cliffs, New Jersey} 24685} 24686 24687@Article{ brewster.mohan.ea:three, 24688 author = {L. Brewster and R. Mohan and G. Mageras and C. Burman and S. Leibel and Z. Fuks}, 24689 title = {Three dimensional conformal treatment planning with multileaf collimators}, 24690 journal = {International Journal of Radiation Oncology, Biology and Physics}, 24691 year = {1995}, 24692 volume = {33}, 24693 number = {5}, 24694 pages = {1081--1089} 24695} 24696 24697@Article{ brezis.lions:produits, 24698 author = {H. Br\'{e}zis and P.--L. Lions}, 24699 title = {Produits Infinis de Resolvantes}, 24700 journal = {Israel Journal of Mathematics}, 24701 year = {1978}, 24702 volume = {29}, 24703 pages = {329--345} 24704} 24705 24706@Book{ brezis:operateurs, 24707 author = {H. Br\'{e}zis}, 24708 title = {Op\'{e}rateurs Maximaux Monotones et Semi-Groupes de Contractions dans les 24709 Espaces de Hilbert}, 24710 publisher = {North-Holland}, 24711 address = {Amsterdam}, 24712 year = {1973} 24713} 24714 24715@Book{ brooke.kendrick.ea:gams, 24716 author = {A. Brooke and D. Kendrick and A. Meeraus}, 24717 title = {{GAMS}: {A} User's Guide}, 24718 year = {1988}, 24719 publisher = {The Scientific Press}, 24720 address = {South San Francisco, CA} 24721} 24722 24723@Article{ brown.demarzo.ea:computing, 24724 author = {D. J. Brown and P. M. DeMarzo and B. C. Eaves}, 24725 title = {Computing Equilibria when Asset Markets Are Incomplete}, 24726 journal = {Econometrica}, 24727 year = {1996}, 24728 volume = {64}, 24729 pages = {1--28} 24730} 24731 24732@Article{ bruck:iterative, 24733 author = {R. E. Bruck}, 24734 title = {An Iterative Solution of a Variational Inequality for Certain Monotone Operators 24735 in {H}ilbert Space}, 24736 journal = {Bulletin of the American Mathematical Society}, 24737 year = {1975}, 24738 volume = {81}, 24739 pages = {890--892} 24740} 24741 24742@Article{ bunch.parlett:direct, 24743 author = {J. R. Bunch and B. N. Parlett}, 24744 title = {Direct Methods for Solving Symmetric Indefinite Systems of Linear Equations}, 24745 journal = {SIAM Journal on Numerical Analysis}, 24746 year = {1971}, 24747 volume = {8}, 24748 pages = {639--655} 24749} 24750 24751@Article{ burachik.iusem.ea:enlargement, 24752 author = {R. S. Burachik and A. N. Iusem and B. F. Svaiter}, 24753 title = {Enlargement of Monotone Operators with Applications to Variational Inequalities}, 24754 year = {1997}, 24755 journal = {Set-Valued Analysis, forthcoming} 24756} 24757 24758@TechReport{ burachik.iusem:generalized, 24759 author = {R. S. Burachik and A. N. Iusem}, 24760 title = {A Generalized Proximal Point Algorithm for the Nonlinear Complementarity 24761 Problem}, 24762 institution = {Instituto de Matem\'{a}tica Pura e Aplicada}, 24763 year = {1995}, 24764 type = {Working Paper}, 24765 address = {Rio de Janeiro} 24766} 24767 24768@Article{ burachik.iusem:generalized*1, 24769 author = {R. S. Burachik and A. N. Iusem}, 24770 title = {A Generalized Proximal Point Algorithm for the Variational Inequality Problem in 24771 {A} {H}ilbert Space}, 24772 year = {1998}, 24773 journal = {SIAM Journal on Optimization}, 24774 volume = {8}, 24775 pages = {197--216} 24776} 24777 24778@Article{ burdakov:globally, 24779 author = {O. P. Burdakov}, 24780 title = {Some Globally Convergent Modifications of {N}ewton's Method for Solving Systems 24781 of Nonlinear Equations}, 24782 journal = {Soviet Mathematics Doklady}, 24783 year = {1980}, 24784 volume = {22}, 24785 pages = {376--379} 24786} 24787 24788@Article{ burges:tutorial, 24789 author = {C. J. C. Burges}, 24790 title = {A Tutorial on Support Vector Machines for Pattern Recognition}, 24791 journal = {Data Mining and Knowledge Discovery}, 24792 volume = {2}, 24793 number = {2}, 24794 pages = {121-167}, 24795 year = {1998} 24796} 24797 24798@Article{ burke.ferris.ea:clarke, 24799 author = {J. V. Burke and M. C. Ferris and M. Qian}, 24800 title = {On the {C}larke Subdifferential of the Distance Function to a Closed Set}, 24801 journal = {Journal of Mathematical Analysis and its Applications}, 24802 year = {1992}, 24803 volume = {166}, 24804 pages = {199--213}, 24805 key = {16} 24806} 24807 24808@Unpublished{ burke.ferris.ea:least, 24809 author = {J. V. Burke and M. C. Ferris and L. Qi}, 24810 title = {A Least Squares Algorithm for Nonlinear Complementarity Problems}, 24811 year = {1994}, 24812 month = mar, 24813 note = {Manuscript}, 24814 key = {999} 24815} 24816 24817@Article{ burke.ferris:characterization, 24818 author = {J. V. Burke and M. C. Ferris}, 24819 title = {Characterization of Solution Sets of Convex Programs}, 24820 journal = {Operations Research Letters}, 24821 year = {1991}, 24822 volume = {10}, 24823 pages = {57--60}, 24824 key = {10} 24825} 24826 24827@Article{ burke.ferris:gauss-newton, 24828 author = {J. V. Burke and M. C. Ferris}, 24829 title = {A {G}auss--{N}ewton Method for Convex Composite Optimization}, 24830 journal = {Mathematical Programming}, 24831 year = {1995}, 24832 volume = {71}, 24833 pages = {179--194}, 24834 url = {ftp: //ftp.cs.wisc.edu/tech-reports/reports/1993/tr1176.ps}, 24835 key = {32} 24836} 24837 24838@Article{ burke.ferris:weak, 24839 author = {J. V. Burke and M. C. Ferris}, 24840 title = {Weak Sharp Minima in Mathematical Programming}, 24841 journal = {SIAM Journal on Control and Optimization}, 24842 year = {1993}, 24843 volume = {31}, 24844 pages = {1340--1359}, 24845 url = {ftp: //ftp.cs.wisc.edu/tech-reports/reports/1991/tr1050a.ps}, 24846 key = {23} 24847} 24848 24849@Article{ burke.more.ea:convergence, 24850 author = {J. V. Burke and J. J. Mor\'{e} and G. Toraldo}, 24851 title = {Convergence Properties of Trust Region Methods for Linear and Convex 24852 Constraints}, 24853 journal = {Mathematical Programming}, 24854 year = {1990}, 24855 volume = {47}, 24856 pages = {305--336} 24857} 24858 24859@Article{ burke.more:exposing, 24860 author = {J. V. Burke and J. J. Mor\'{e}}, 24861 title = {Exposing Constraints}, 24862 journal = {SIAM Journal on Optimization}, 24863 year = {1994}, 24864 volume = {4}, 24865 pages = {573--595} 24866} 24867 24868@Article{ burke.more:identification, 24869 author = {J. V. Burke and J. J. Mor\'{e}}, 24870 title = {On the Identification of Active Constraints}, 24871 journal = {SIAM Journal on Numerical Analysis}, 24872 year = {1988}, 24873 volume = {25}, 24874 pages = {1197--1211} 24875} 24876 24877@Article{ burke.poliquin:optimality, 24878 author = {J. V. Burke and R. A. Poliquin}, 24879 title = {Optimality Conditions for Non Finite--Valued Convex Composite Functions}, 24880 journal = {Mathematical Programming}, 24881 year = {1992}, 24882 volume = {57}, 24883 pages = {103--120} 24884} 24885 24886@Article{ burke.tseng:unified, 24887 author = {J. V. Burke and P. Tseng}, 24888 title = {A Unified Analysis of {H}offman's Bound via {F}enchel Duality}, 24889 journal = {SIAM Journal on Optimization}, 24890 year = {1996}, 24891 volume = {6}, 24892 pages = {265--282} 24893} 24894 24895@Article{ burke.xu:global, 24896 author = {J. V. Burke and S. Xu}, 24897 title = {The Global Linear Convergence of a Non-Interior Path-Following Algorithm for 24898 Linear Complementarity Problems}, 24899 year = {1998}, 24900 journal = {Mathematics of Operations Research}, 24901 volume = {23}, 24902 pages = {719--735} 24903} 24904 24905@TechReport{ burke:algorithms, 24906 author = {J. V. Burke}, 24907 title = {Algorithms for Solving Finite Dimensional Systems of Nonlinear Equations and 24908 Inequalities that have both Global and Quadratic Convergence Properties}, 24909 institution = {Argonne National Laboratory}, 24910 year = {1985}, 24911 address = {Argonne, Illinois}, 24912 number = {ANL/MCS--TM--54}, 24913 type = {Mathematics and Computer Science Division Report} 24914} 24915 24916@Article{ burke:descent, 24917 author = {J. V. Burke}, 24918 title = {Descent Methods for Composite Nondifferentiable Optimization Problems}, 24919 journal = {Mathematical Programming}, 24920 year = {1985}, 24921 volume = {33}, 24922 pages = {260--279} 24923} 24924 24925@Article{ burke:exact, 24926 author = {J. V. Burke}, 24927 title = {An Exact Penalization Viewpoint of Constrained Optimization}, 24928 journal = {SIAM Journal on Control and Optimization}, 24929 year = {1991}, 24930 volume = {29}, 24931 pages = {968--998} 24932} 24933 24934@Article{ burke:identification, 24935 author = {J. V. Burke}, 24936 title = {On the Identification of Active Constraints {II}: The Nonconvex Case}, 24937 journal = {SIAM Journal on Numerical Analysis}, 24938 year = {1990}, 24939 volume = {27}, 24940 pages = {1081--1102} 24941} 24942 24943@Article{ burke:robust, 24944 author = {J. V. Burke}, 24945 title = {A Robust Trust Region Method for Constrained Nonlinear Programming Problem}, 24946 journal = {SIAM Journal on Optimization}, 24947 year = {1992}, 24948 volume = {2}, 24949 pages = {325--347} 24950} 24951 24952@Article{ burke:second, 24953 author = {J. V. Burke}, 24954 title = {Second Order Necessary and Sufficient Conditions for Convex Composite {NDO}}, 24955 journal = {Mathematical Programming}, 24956 year = {1987}, 24957 volume = {38}, 24958 pages = {287--302} 24959} 24960 24961@Article{ burke:sequential, 24962 author = {J. V. Burke}, 24963 title = {A Sequential Quadratic Programming Method for Potentially Infeasible Mathematical 24964 Programs}, 24965 journal = {Journal of Mathematical Analysis and its Applications}, 24966 year = {1989}, 24967 volume = {139}, 24968 pages = {319--351} 24969} 24970 24971@Article{ burman.kutcher.ea:fitting, 24972 author = {C. Burman and G. J. Kutcher and B. Emami and M. Goitein}, 24973 title = {Fitting of Normal Tissue Tolerance Data to an Analytical Function}, 24974 journal = {International Journal of Radiation Oncology, Biology and Physics}, 24975 year = {1991}, 24976 optvolume = {21}, 24977 optpages = {123-135} 24978} 24979 24980@TechReport{ busovaca:handling, 24981 author = {S. Busovaca}, 24982 title = {Handling Degeneracy in a Nonlinear $\ell_1$ algorithm}, 24983 institution = {University of Waterloo}, 24984 year = {1985}, 24985 address = {Ontario}, 24986 number = {CS85 34}, 24987 type = {Technical Report} 24988} 24989 24990@Article{ butler.martin:method, 24991 author = {T. Butler and A. V. Martin}, 24992 title = {On a Method of {C}ourant for Minimizing Functionals}, 24993 journal = {Journal of Mathematical Physics}, 24994 year = {1962}, 24995 volume = {41}, 24996 pages = {291--299} 24997} 24998 24999@Article{ calamai.more:projected, 25000 author = {P. H. Calamai and J. J. Mor\'{e}}, 25001 title = {Projected Gradient Methods for Linearly Constrained Problems}, 25002 journal = {Mathematical Programming}, 25003 year = {1987}, 25004 volume = {39}, 25005 pages = {93--116} 25006} 25007 25008@Article{ cao.ferris:genetic, 25009 author = {M. Cao and M. C. Ferris}, 25010 title = {Genetic Algorithms in Optimization}, 25011 journal = {Journal of Undergraduate Mathematics and its Applications}, 25012 year = {1991}, 25013 volume = {12}, 25014 pages = {81--90}, 25015 key = {17} 25016} 25017 25018@Article{ cao.ferris:interior, 25019 author = {M. Cao and M. C. Ferris}, 25020 title = {An Interior Point Algorithm for Monotone Affine Variational Inequalities}, 25021 journal = {Journal of Optimization Theory and Applications}, 25022 year = {1994}, 25023 volume = {83}, 25024 pages = {269--283}, 25025 url = {ftp: //ftp.cs.wisc.edu/tech-reports/reports/1992/tr1101.ps}, 25026 key = {28} 25027} 25028 25029@Article{ cao.ferris:lineality, 25030 author = {M. Cao and M. C. Ferris}, 25031 title = {Lineality Removal for Copositive--Plus Normal Maps}, 25032 year = {1995}, 25033 volume = {2}, 25034 pages = {1--10}, 25035 journal = {Communications on Applied Nonlinear Analysis}, 25036 url = {ftp: //ftp.cs.wisc.edu/math-prog/tech-reports/94-02.ps}, 25037 key = {38} 25038} 25039 25040@Article{ cao.ferris:pc, 25041 author = {M. Cao and M. C. Ferris}, 25042 title = {{$P_C$} Matrices and the Linear Complementarity Problem}, 25043 journal = {Linear Algebra and Its Applications}, 25044 year = {1996}, 25045 volume = {246}, 25046 pages = {299--312}, 25047 url = {ftp: //ftp.cs.wisc.edu/math-prog/tech-reports/94-01.ps}, 25048 key = {37} 25049} 25050 25051@Article{ cao.ferris:pivotal, 25052 author = {M. Cao and M. C. Ferris}, 25053 title = {A Pivotal Method for Affine Variational Inequalities}, 25054 journal = {Mathematics of Operations Research}, 25055 year = {1996}, 25056 volume = {21}, 25057 pages = {44--64}, 25058 url = {ftp: //ftp.cs.wisc.edu/tech-reports/reports/1992/tr1114.ps}, 25059 key = {29} 25060} 25061 25062@PhDThesis{ cao:piecewise, 25063 author = {M. Cao}, 25064 title = {Piecewise Linear Homotopies and Affine Variational Inequalities}, 25065 school = {Computer Sciences Department, University of Wisconsin}, 25066 year = {1994}, 25067 address = {Madison, Wisconsin}, 25068 note = {Technical Report 1210} 25069} 25070 25071@Article{ caroe.schultz:dual, 25072 author = {C. C. Car{\o}e and R. Schultz}, 25073 title = {Dual Decomposition in Stochastic Integer Programming}, 25074 journal = {Operations Research Letters}, 25075 volume = {24}, 25076 pages = {37-45}, 25077 year = {1999} 25078} 25079 25080@Article{ carol.targovnik.ea:initial, 25081 author = {M. Carol and W. H. Grant and D. Pavord and P. Eddy and H. S. Targovnik and B. 25082 Butler and S. Woo and J. Figura and V. Onufrey and R. Grossman and R. Selkar}, 25083 title = {Initial clinical experience with the Peacock intensity modulation of a 3-{D} 25084 conformal radiation therapy system}, 25085 journal = {Stereotactic and Functional Neurosurgery}, 25086 year = {1996}, 25087 volume = {66}, 25088 pages = {30--34} 25089} 25090 25091@Article{ carolan.hill.ea:empirical, 25092 author = {W. J. Carolan and J. E. Hill and J. L. Kennington and S. Niemi and S. J. 25093 Wichmann}, 25094 title = {An Empirical Evaluation of the {KORBX} Algorithms for Military Airlift 25095 Applications}, 25096 journal = {Operations Research}, 25097 year = {1990}, 25098 volume = {38}, 25099 pages = {240--248} 25100} 25101 25102@Article{ carroll:created, 25103 author = {C. W. Carroll}, 25104 title = {The Created Response Surface Technique for Optimizing Nonlinear Restrained 25105 Systems}, 25106 journal = {Operations Research}, 25107 year = {1961}, 25108 volume = {9}, 25109 pages = {169--184} 25110} 25111 25112@PhDThesis{ carroll:operations, 25113 author = {C. W. Carroll}, 25114 title = {An Operations Research Approach to the Economic Optimization of a Kraft Pulping 25115 Process}, 25116 year = {1959}, 25117 address = {Appleton, Wisconsin}, 25118 school = {Institute of Paper Chemistry} 25119} 25120 25121@TechReport{ casanova.dongarra:netsolve, 25122 author = {H. Casanova and J. Dongarra}, 25123 title = {{N}et{S}olve: {A} Network Server for Solving Computational Science Problems}, 25124 institution = {University of Tennessee}, 25125 year = {1996}, 25126 type = {Technical Report} 25127} 25128 25129@TechReport{ cavalier.soyster:computational, 25130 author = {T. M. Cavalier and A. L. Soyster}, 25131 title = {Some Computational Experience and a Modification of the {K}armarkar Algorithm}, 25132 institution = {Pennsylvania State University}, 25133 year = {1985}, 25134 address = {Pennsylvania}, 25135 number = {85-105}, 25136 type = {ISME Working Paper} 25137} 25138 25139@TechReport{ censor.iusem.ea:interior-point, 25140 author = {Y. Censor and A. N. Iusem and S. A. Zenios}, 25141 title = {An Interior-Point Method with {B}regman Functions for the Variational Inequality 25142 Problem with Paramonotone Operators}, 25143 institution = {University of Haifa}, 25144 year = {1994}, 25145 type = {Working Paper} 25146} 25147 25148@Article{ censor.lent:iterative, 25149 author = {Y. Censor and A. Lent}, 25150 title = {An Iterative Row-Action Method for Interval Convex Programming}, 25151 journal = {Journal of Optimization Theory and Applications}, 25152 year = {1981}, 25153 volume = {34}, 25154 pages = {275--291} 25155} 25156 25157@InCollection{ censor.pierro.ea:iterative, 25158 author = {Y. Censor and A. R. {De~Pierro} and T. Elfving and G. T. Herman and A. N. Iusem}, 25159 title = {On Iterative Methods for Linearly Constrained Entropy Maximization}, 25160 booktitle = {Numerical Analysis and Mathematical Modeling, Banach Center Publication Volume 25161 XXIV}, 25162 publisher = {Banach Center}, 25163 year = {1987}, 25164 editor = {A. J. Wakulicz}, 25165 address = {Warsaw, Poland} 25166} 25167 25168@Article{ censor.segman:block-iterative, 25169 author = {Y. Censor and J. Segman}, 25170 title = {On Block-Iterative Entropy Maximization}, 25171 journal = {Journal of Information and Optimization Science}, 25172 year = {1987}, 25173 volume = {8}, 25174 pages = {275--291} 25175} 25176 25177@Article{ censor.zenios:proximal, 25178 author = {Y. Censor and S. A. Zenios}, 25179 title = {The Proximal Minimization Algorithm with ${D}$-functions}, 25180 journal = {Journal of Optimization Theory and Applications}, 25181 year = {1992}, 25182 volume = {73}, 25183 pages = {451--464} 25184} 25185 25186@Article{ censor:parallel, 25187 author = {Yair Censor}, 25188 title = {Parallel Application of Block-Iterative Methods in Medical Imaging and Radiation 25189 Therapy}, 25190 journal = {Mathematical Programming}, 25191 year = {1988}, 25192 volume = {42}, 25193 pages = {307--325} 25194} 25195 25196@Article{ censor:row-action, 25197 author = {Yair Censor}, 25198 title = {Row-action Methods for Huge and Sparse Systems and their Applications}, 25199 journal = {SIAM Review}, 25200 year = {1981}, 25201 volume = {23}, 25202 pages = {444--466} 25203} 25204 25205@Article{ chajakis.zenios:synchronous, 25206 author = {E. D. Chajakis and S. A. Zenios}, 25207 title = {Synchronous and Asynchronous Implementations of Relaxation Algorithms for 25208 Nonlinear Network Optimization}, 25209 journal = {Parallel Computing}, 25210 year = {1990}, 25211 note = {To appear} 25212} 25213 25214@Article{ chamberlain.powell.ea:watchdog, 25215 author = {R. M. Chamberlain and M. J. D. Powell and C. Lemar\'{e}chal}, 25216 title = {The Watchdog Technique for Forcing Convergence in Algorithms for Constrained 25217 Optimization}, 25218 journal = {Mathematical Programming Study}, 25219 year = {1982}, 25220 volume = {16}, 25221 pages = {1--17} 25222} 25223 25224@Article{ chan.pang:generalized, 25225 author = {D. Chan and J. S. Pang}, 25226 title = {The Generalized Quasi-Variational Inequality Problem}, 25227 journal = {Mathematics of Operations Research}, 25228 volume = {7}, 25229 pages = {211--222}, 25230 year = {1982} 25231} 25232 25233@Article{ charalambous:nonlinear, 25234 author = {C. Charalambous}, 25235 title = {Nonlinear Least p--th Optimization and Nonlinear Programming}, 25236 journal = {Mathematical Programming}, 25237 year = {1977}, 25238 volume = {12}, 25239 pages = {195--225} 25240} 25241 25242@Article{ charnes.cooper.ea:duality, 25243 author = {A. Charnes and W. W. Cooper and K. O. Kortanek}, 25244 title = {Duality, {H}aar Programs and Finite Sequence Spaces}, 25245 journal = {Proceedings of the National Academy of Sciences of the United States}, 25246 year = {1962}, 25247 pages = {783--786} 25248} 25249 25250@Book{ charnes.cooper.ea:introduction, 25251 author = {A. Charnes and W. W. Cooper and A. Henderson}, 25252 title = {An Introduction to Linear Programming}, 25253 year = {1953}, 25254 publisher = {John Wiley \& Sons}, 25255 address = {New York} 25256} 25257 25258@TechReport{ charnes.semple:practical, 25259 author = {A. Charnes and J. Semple}, 25260 title = {Practical Error Bounds for a Class of Quadratic Programming Problems}, 25261 institution = {CCS}, 25262 year = {1991}, 25263 address = {Austin, Texas}, 25264 number = {663}, 25265 type = {Research Report} 25266} 25267 25268@InProceedings{ charnes:fundamental, 25269 author = {A. Charnes}, 25270 title = {Some Fundamental Theorems of Perceptron Theory and Their Geometry}, 25271 booktitle = {Computer and Information Sciences}, 25272 year = {1964}, 25273 editor = {J. T. Lou and R. H. Wilcox}, 25274 publisher = {Spartan Books}, 25275 address = {Washington, D.C.}, 25276 pages = {67--74} 25277} 25278 25279@TechReport{ chen.chen.ea:penalized, 25280 author = {B. Chen and X. Chen and C. Kanzow}, 25281 title = {A Penalized {F}ischer-{B}urmeister {NCP}-Function: Theoretical Investigation and 25282 Numerical Results}, 25283 institution = {Institute of Applied Mathematics, University of Hamburg}, 25284 year = {1997}, 25285 type = {Preprint}, 25286 number = {126}, 25287 address = {Hamburg, Germany} 25288} 25289 25290@Article{ chen.chen:global, 25291 author = {B. Chen and X. Chen}, 25292 title = {A Global and Local Superlinear Continuation-Smoothing Method for ${P}_0$ + 25293 ${R}_0$ {NCP} or Monotone {NCP}}, 25294 journal = {SIAM Journal on Optimization}, 25295 year = {1999}, 25296 volume = {9}, 25297 pages = {624--645} 25298} 25299 25300@Article{ chen.ferris.ea:fatcop, 25301 author = {Q. Chen and M. C. Ferris and J. T. Linderoth}, 25302 title = {{FATCOP} 2.0: Advanced Features in an Opportunistic Mixed Integer Programming 25303 Solver}, 25304 journal = {Annals of Operations Research, forthcoming}, 25305 year = {2000}, 25306 url = {ftp://ftp.cs.wisc.edu/pub/dmi/tech-reports/99-11.ps}, 25307 key = {89}, 25308 type = {Data Mining Institute Technical Report}, 25309 institution = {Computer Sciences Department, University of Wisconsin}, 25310 address = {Madison, Wisconsin}, 25311 number = {99-11} 25312} 25313 25314@TechReport{ chen.ferris:fatcop, 25315 author = {Q. Chen and M. C. Ferris}, 25316 title = {{FATCOP}: {A} Fault Tolerant {C}ondor-{PVM} Mixed Integer Program Solver}, 25317 type = {Mathematical Programming Technical Report}, 25318 institution = {Computer Sciences Department, University of Wisconsin}, 25319 address = {Madison, Wisconsin}, 25320 year = {1999}, 25321 url = {ftp: //ftp.cs.wisc.edu/math-prog/tech-reports/99-05.ps}, 25322 number = {99-05}, 25323 key = {81}, 25324 annote = {Submitted to {\em SIOPT}} 25325} 25326 25327@Article{ chen.florian:nonlinear, 25328 author = {Y. Chen and M. Florian}, 25329 title = {The Nonlinear Bilevel Programming Problem: Formulations, Regularity, and 25330 Optimality Conditions}, 25331 journal = {Optimization}, 25332 year = {1995}, 25333 volume = {32}, 25334 pages = {193--209} 25335} 25336 25337@TechReport{ chen.florian:o-d, 25338 author = {Y. Chen and M. Florian}, 25339 title = {{O}-{D} demand adjustment problem with congestion: Part {I}. Model analysis and 25340 optimality conditions}, 25341 type = {Publication}, 25342 number = {CRT-94-56}, 25343 institution = {Centre de Recherche sur les Transports, Universit\'e de Montr\'eal}, 25344 address = {Montr\'eal, Canada}, 25345 year = {1994} 25346} 25347 25348@Article{ chen.harker:continuation, 25349 author = {B. Chen and P. T. Harker}, 25350 title = {A Continuation Method for Monotone Variational Inequalities}, 25351 journal = {Mathematical Programming}, 25352 volume = {69}, 25353 pages = {237--253}, 25354 year = {1995} 25355} 25356 25357@Article{ chen.harker:non-interior, 25358 author = {B. Chen and P. T. Harker}, 25359 title = {A Non-Interior-Point Continuation Method for Linear Complementarity Problems}, 25360 journal = {SIAM Journal on Matrix Analysis and Applications}, 25361 year = {1993}, 25362 volume = {14}, 25363 pages = {1168--1190} 25364} 25365 25366@Article{ chen.harker:smooth, 25367 author = {B. Chen and P. T. Harker}, 25368 title = {Smooth Approximations to Nonlinear Complementarity Problems}, 25369 journal = {SIAM Journal on Optimization}, 25370 year = {1997}, 25371 volume = {7}, 25372 pages = {403--420} 25373} 25374 25375@Article{ chen.mangasarian:class, 25376 author = {Chunhui Chen and O. L. Mangasarian}, 25377 title = {A Class of Smoothing Functions for Nonlinear and Mixed Complementarity Problems}, 25378 journal = {Computational Optimization and Applications}, 25379 year = {1996}, 25380 volume = {5}, 25381 pages = {97--138} 25382} 25383 25384@Article{ chen.mangasarian:smoothing, 25385 author = {Chunhui Chen and O. L. Mangasarian}, 25386 title = {Smoothing Methods for Convex Inequalities and Linear Complementarity Problems}, 25387 journal = {Mathematical Programming}, 25388 year = {1995}, 25389 volume = {78}, 25390 pages = {51--70} 25391} 25392 25393@Article{ chen.nashed.ea:convergence, 25394 author = {X. Chen and Z. Nashed and L. Qi}, 25395 title = {Convergence of {N}ewton's Method for Singular Smooth and Nonsmooth Equations 25396 using Adaptive Outer Inverses}, 25397 year = {1997}, 25398 journal = {SIAM Journal on Optimization}, 25399 volume = {7}, 25400 pages = {445--462} 25401} 25402 25403@Article{ chen.qi.ea:global, 25404 author = {X. Chen and L. Qi and D. Sun}, 25405 title = {Global and Superlinear Convergence of the Smoothing {N}ewton Method and its 25406 Application to General Box Constrained Variational Inequalities}, 25407 year = {1998}, 25408 journal = {Mathematics of Computation}, 25409 volume = {67}, 25410 pages = {519--540} 25411} 25412 25413@Article{ chen.teboulle:convergence, 25414 author = {G. Chen and M. Teboulle}, 25415 title = {A Convergence Analysis of Proximal-Like Minimization Algorithms Using {B}regman 25416 Functions}, 25417 journal = {SIAM Journal on Optimization}, 25418 year = {1993}, 25419 volume = {3}, 25420 pages = {538--543} 25421} 25422 25423@Article{ chen.ye:homotopy-smoothing, 25424 author = {X.~Chen and Y.~Ye}, 25425 title = {On Homotopy-Smoothing Methods for Variational Inequalities}, 25426 year = {1999}, 25427 journal = {SIAM Journal on Control and Optimization}, 25428 volume = {37}, 25429 pages = {589--616} 25430} 25431 25432@PhDThesis{ chen:forward-backward, 25433 author = {G. H.--G. Chen}, 25434 title = {Forward--Backward Splitting Techniques: Theory and Applications}, 25435 school = {University of Washington}, 25436 year = {1994} 25437} 25438 25439@PhDThesis{ chen:smoothing, 25440 author = {Chunhui Chen}, 25441 title = {Smoothing Methods in Mathematical Programming}, 25442 school = {Computer Sciences Department, University of Wisconsin}, 25443 year = {1995}, 25444 address = {Madison, Wisconsin}, 25445 note = {Available from ftp://ftp.cs.wisc.edu/math-prog/tech-reports/}, 25446 annote = {Mathematical Programming Technical Report 95-12} 25447} 25448 25449@Book{ cheney:introduction, 25450 author = {E. W. Cheney}, 25451 title = {Introduction to Approximation Theory}, 25452 year = {1966}, 25453 publisher = {McGraw--Hill}, 25454 address = {New York} 25455} 25456 25457@Article{ cho.kuterdem.ea:spherical, 25458 author = {P. S. Cho and H. G. Kuterdem and R. J. Marks}, 25459 title = {A spherical dose model for radiosurgery treatment planning}, 25460 journal = {Physics in Medicine and Biology}, 25461 year = {1998}, 25462 volume = {43}, 25463 pages = {3145--3148} 25464} 25465 25466@Article{ cho.lee.ea:optimization, 25467 author = {P. S. Cho and S. Lee and R. J. Marks and S. Oh and S. Sutlief and H. Phillips}, 25468 title = {Optimization of intensity modulated beams with volume constraints using two 25469 methods: cost function minimization and projection onto convex sets}, 25470 journal = {Medical Physics}, 25471 year = {1998}, 25472 volume = {25}, 25473 number = {4}, 25474 pages = {435--443} 25475} 25476 25477@Article{ choi.desarbo.ea:product, 25478 author = {S. C. Choi and W. S. DeSarbo and P. T. Harker}, 25479 title = {Product Positioning Under Price Competition}, 25480 journal = {Management Science}, 25481 year = {1990}, 25482 volume = {36}, 25483 pages = {175--199} 25484} 25485 25486@Article{ chow.mallet-parret.ea:finding, 25487 author = {S. N. Chow and J. Mallet--Parret and J. A. Yorke}, 25488 title = {Finding Zeroes of Maps: Homotopy Methods that are Constructive with Probability 25489 One}, 25490 journal = {Mathematics of Computing}, 25491 year = {1978}, 25492 volume = {32}, 25493 pages = {887--899} 25494} 25495 25496@Article{ christopherson:mathematical, 25497 author = {D. G. Christopherson}, 25498 title = {A new mathematical method for the solution of film lubrication problems}, 25499 journal = {Proceedings of the Institute of Mechanical Engineers}, 25500 volume = {146}, 25501 year = {1941}, 25502 pages = {126--135} 25503} 25504 25505@TechReport{ chun.lee.ea:implementation, 25506 author = {B. J. Chun and S. J. Lee and S. M. Robinson}, 25507 title = {An Implementation of the Bundle Decomposition Algorithm}, 25508 institution = {Department of Industrial Engineering, University of Wisconsin}, 25509 year = {1991}, 25510 address = {Madison, Wisconsin}, 25511 number = {91-6} 25512} 25513 25514@Article{ chung:np-completeness, 25515 author = {S.--J. Chung}, 25516 title = {{NP}-Completeness of the Linear Complementarity Problem}, 25517 journal = {Journal of Optimization Theory and Applications}, 25518 volume = {60}, 25519 year = {1989}, 25520 pages = {393--399} 25521} 25522 25523@Book{ chvatal:linear, 25524 author = {V. Chv\'atal}, 25525 title = {Linear Programming}, 25526 year = {1983}, 25527 publisher = {W. H. Freeman and Company}, 25528 address = {New York} 25529} 25530 25531@Book{ ciarlet:finite, 25532 author = {P. G. Ciarlet}, 25533 title = {The Finite Element Method for Elliptic Problems}, 25534 year = {1978}, 25535 publisher = {North-Holland}, 25536 address = {New York} 25537} 25538 25539@Article{ cinquini.contro:optimal, 25540 author = {C. Cinquini and R. Contro}, 25541 title = {Optimal design of beams discretized by elastic plastic finite element}, 25542 journal = {Computers \& Structures}, 25543 volume = {20}, 25544 year = {1985}, 25545 pages = {475--585} 25546} 25547 25548@Book{ clarke:optimization, 25549 author = {F. H. Clarke}, 25550 title = {Optimization and Nonsmooth Analysis}, 25551 year = {1983}, 25552 publisher = {John Wiley \& Sons}, 25553 address = {New York} 25554} 25555 25556@InProceedings{ cleveland.smith:genetic, 25557 crossref = {schaeffer:third}, 25558 author = {G. A. Cleveland and S. F. Smith}, 25559 title = {Using Genetic Algorithms to Schedule Flow Shop Releases}, 25560 pages = {160--169} 25561} 25562 25563@Book{ cochran:sampling, 25564 author = {W. Cochran}, 25565 title = {Sampling Techniques}, 25566 publisher = {Wiley}, 25567 year = {1977}, 25568 address = {New York}, 25569 edition = {Third} 25570} 25571 25572@Article{ coleman.conn:nonlinear, 25573 author = {T. F. Coleman and A. R. Conn}, 25574 title = {Nonlinear Programming via an Exact Penalty Function Method: Asymptotic Analysis}, 25575 journal = {Mathematical Programming}, 25576 year = {1982}, 25577 volume = {24}, 25578 pages = {123--136} 25579} 25580 25581@Article{ coleman.conn:nonlinear*1, 25582 author = {T. F. Coleman and A. R. Conn}, 25583 title = {Nonlinear Programming via an Exact Penalty Function Method: Global Analysis}, 25584 journal = {Mathematical Programming}, 25585 year = {1982}, 25586 volume = {24}, 25587 pages = {137--161} 25588} 25589 25590@TechReport{ coleman.liu:interior, 25591 author = {T. F. Coleman and J. Liu}, 25592 title = {An interior newton method for quadratic programming}, 25593 institution = {Dept. of Computer Science, Cornell University}, 25594 year = {1993}, 25595 number = {TR 93-1388}, 25596 address = {Ithaca, NY}, 25597 month = oct 25598} 25599 25600@Article{ coleman.more:estimation, 25601 author = {T. F. Coleman and J. J. Mor\'{e}}, 25602 title = {Estimation of Sparse {J}acobian Matrices and Graph Coloring Problems}, 25603 journal = {SIAM Journal on Numerical Analysis}, 25604 year = {1983}, 25605 volume = {20}, 25606 pages = {187--209} 25607} 25608 25609@Manual{ coleman.verma:admat, 25610 author = {T. F. Coleman and A. Verma}, 25611 title = {{ADMAT} User Guide}, 25612 year = {2000} 25613} 25614 25615@TechReport{ colville:comparative, 25616 author = {A. R. Colville}, 25617 title = {A Comparative Study on Nonlinear Programming Codes}, 25618 institution = {IBM New York Scientific Center}, 25619 year = {1968}, 25620 month = jun, 25621 number = {320--2949}, 25622 type = {Technical Report} 25623} 25624 25625@Article{ comi.maier:extremum, 25626 author = {C. Comi and G. Maier}, 25627 title = {Extremum Theorem and Convergence Criterion for an Iterative Solution to the 25628 Finite-Step Problem in Elastoplasticity with Mixed Nonlinear Hardening}, 25629 journal = {European Journal Mechanics A/Solids}, 25630 volume = {9}, 25631 year = {1990}, 25632 pages = {563--585} 25633} 25634 25635@Misc{ condon.dahl.ea:implementing, 25636 author = {T. Condon and H. Dahl and S. Devarajan}, 25637 title = {Implementing a Computable General Equilibrium Model on {GAMS} -- The {C}ameroon 25638 Model}, 25639 year = {1987}, 25640 howpublished = {{DRD} Discussion Paper 290}, 25641 note = {The World Bank, Washington DC} 25642} 25643 25644@Book{ conn.gould.ea:lancelot, 25645 author = {A. R. Conn and N. I. M. Gould and Ph. L. Toint}, 25646 title = {{LANCELOT}: {A} {F}ortran package for Large--Scale Nonlinear Optimization 25647 (Release {A})}, 25648 year = {1992}, 25649 publisher = {Springer Verlag}, 25650 address = {Heidelberg, Berlin}, 25651 series = {Springer Series in Computational Mathematics}, 25652 number = {17} 25653} 25654 25655@Article{ conn.gould.ea:numerical, 25656 author = {A. R. Conn and N. I. M. Gould and Ph. L. Toint}, 25657 title = {Numerical Experiments with the {LANCELOT} Package (Release {A}) for Large-Scale 25658 Nonlinear Optimization}, 25659 journal = {Mathematical Programming}, 25660 year = {1996}, 25661 volume = {75}, 25662 pages = {73--110} 25663} 25664 25665@Book{ cgt, 25666 author = {A. R. Conn and N. I. M. Gould and Ph. L. Toint}, 25667 title = {Trust-Region Methods}, 25668 year = {2000}, 25669 publisher = {SIAM}, 25670 address = {Philadelphia, Pennsylvania} 25671} 25672 25673@InCollection{ conn.toint:algorithm, 25674 author = {A. R. Conn and Ph. L. Toint}, 25675 title = {An Algorithm using Quadratic Interpolation for Unconstrained Derivative Free 25676 Optimization}, 25677 booktitle = {Nonlinear Optimization and Applications}, 25678 editor = {G. Di Pillo and F. Giannessi}, 25679 year = {1996}, 25680 publisher = {Plenum Press}, 25681 address = {New York} 25682} 25683 25684@Article{ conry.seireg:mathematical, 25685 author = {T. F. Conry and A. Seireg}, 25686 title = {A Mathematical Programming Method for Design for Elastic Bodies in Contact}, 25687 journal = {{ASME} Transactions Journal of Applied Mechanics}, 25688 volume = {93}, 25689 year = {1971}, 25690 pages = {387--392} 25691} 25692 25693@Article{ cook.gerards.ea:sensitivity, 25694 author = {W. Cook and A. M. H. Gerards and A. Schrijver and \'{E}. Tardos}, 25695 title = {Sensitivity Results in Integer Linear Programming}, 25696 journal = {Mathematical Programming}, 25697 year = {1986}, 25698 volume = {34}, 25699 pages = {251--264} 25700} 25701 25702@Article{ cook:taxonomy, 25703 author = {S. A. Cook}, 25704 title = {A Taxonomy of Problems with Fast Parallel Algorithms}, 25705 journal = {Information and Control}, 25706 year = {1985}, 25707 volume = {64}, 25708 pages = {2--22} 25709} 25710 25711@Article{ cooper:gradient, 25712 author = {R. E. M. Cooper}, 25713 title = {A gradient method of optimizing external-beam radiotherapy treatment plans}, 25714 journal = {Radiology}, 25715 year = {1978}, 25716 volume = {128}, 25717 pages = {235--243} 25718} 25719 25720@Article{ cormack:problem, 25721 author = {A. M. Cormack}, 25722 title = {A problem in roatation therapy with x-rays}, 25723 journal = {International Journal of Radiation Oncology, Biology and Physics}, 25724 year = {1987}, 25725 volume = {13}, 25726 pages = {623--630} 25727} 25728 25729@Article{ cormack:problem*1, 25730 author = {A. M. Cormack}, 25731 title = {A problem in roatation therapy with x-rays2: dose distributions with an axis of 25732 symmetry}, 25733 journal = {International Journal of Radiation Oncology, Biology and Physics}, 25734 year = {1987}, 25735 volume = {13}, 25736 pages = {1921--1925} 25737} 25738 25739@Article{ cottle.dantzig:complementary, 25740 author = {R. W. Cottle and G. B. Dantzig}, 25741 title = {Complementary Pivot Theory of Mathematical Programming}, 25742 journal = {Linear Algebra and Its Applications}, 25743 year = {1968}, 25744 volume = {1}, 25745 pages = {103--125} 25746} 25747 25748@Article{ cottle.dantzig:generalization, 25749 author = {R. W. Cottle and G. B. Dantzig}, 25750 title = {A Generalization of the Linear Complementarity Problem}, 25751 journal = {Journal of Combinatorial Theory}, 25752 year = {1970}, 25753 volume = {8}, 25754 pages = {79--90} 25755} 25756 25757@Book{ cottle.giannessi.ea:variational, 25758 author = {R. W. Cottle and F. Giannessi and J.--L. Lions}, 25759 title = {Variational Inequalities and Complementarity Problems: Theory and Applications}, 25760 year = {1980}, 25761 publisher = {John Wiley \& Sons}, 25762 address = {New York} 25763} 25764 25765@InCollection{ cottle.goheen:special, 25766 author = {R. W. Cottle and M. S. Goheen}, 25767 title = {A Special Class of Large Quadratic Programs}, 25768 pages = {361--390}, 25769 crossref = {mangasarian.meyer.ea:nonlinear*3} 25770} 25771 25772@Article{ cottle.golub.ea:solution, 25773 author = {R. W. Cottle and G. H. Golub and R. S. Sacher}, 25774 title = {On the Solution of Large Structured Complementarity Problems: The Block 25775 Partitioned Case}, 25776 journal = {Applied Mathematics and Optimization}, 25777 year = {1978}, 25778 volume = {4}, 25779 pages = {347--363} 25780} 25781 25782@Book{ cottle.pang.ea:linear, 25783 author = {R. W. Cottle and J. S. Pang and R. E. Stone}, 25784 title = {The Linear Complementarity Problem}, 25785 year = {1992}, 25786 publisher = {Academic Press}, 25787 address = {Boston} 25788} 25789 25790@Article{ cottle.pang.ea:sufficient, 25791 author = {R. W. Cottle and J. S. Pang and V. Venkateswaran}, 25792 title = {Sufficient Matrices and the Linear Complementarity Problem}, 25793 journal = {Linear Algebra and Its Applications}, 25794 year = {1989}, 25795 volume = {114/115}, 25796 pages = {231--249} 25797} 25798 25799@PhDThesis{ cottle:nonlinear, 25800 author = {R. W. Cottle}, 25801 title = {Nonlinear programs with positively bounded {J}acobians}, 25802 school = {Department of Mathematics, University of California}, 25803 year = {1964}, 25804 address = {Berkeley, California} 25805} 25806 25807@Article{ cottle:nonlinear*1, 25808 author = {R. W. Cottle}, 25809 title = {Nonlinear programs with positively bounded {J}acobians}, 25810 journal = {Journal of the Society for Industrial and Applied Mathematics}, 25811 volume = {14}, 25812 year = {1966}, 25813 pages = {147--158} 25814} 25815 25816@InCollection{ cottle:principal, 25817 author = {R. W. Cottle}, 25818 title = {The principal pivoting method of quadratic programming}, 25819 booktitle = {Mathematics of the Decision Sciences, Part 1}, 25820 publisher = {American Mathematical Society}, 25821 editor = {G. B. Dantzig and Jr. A. F. Veinott}, 25822 address = {Providence, Rhode Island}, 25823 year = {1968}, 25824 pages = {144--162} 25825} 25826 25827@Unpublished{ courant:calculus, 25828 author = {R. Courant}, 25829 title = {Calculus of Variations and Supplementary Notes and Exercises}, 25830 year = {1956}, 25831 note = {Supplementary notes by M. Kruskal and H. Rubin, revised and amended by J. Moser, 25832 New York University} 25833} 25834 25835@Article{ courant:variational, 25836 author = {R. Courant}, 25837 title = {Variational Methods for the Solution of Problems of Equilibrium and Vibration}, 25838 journal = {Bulletin of the American Mathematical Society}, 25839 year = {1943}, 25840 volume = {49}, 25841 pages = {1--23} 25842} 25843 25844@Book{ cristianini.shawe-taylor:introduction, 25845 author = {N. Cristianini and J. Shawe-Taylor}, 25846 title = {An Introduction to Support Vector Machines}, 25847 publisher = {Cambridge University Press}, 25848 address = {Cambridge}, 25849 year = {2000} 25850} 25851 25852@Article{ cromme:strong, 25853 author = {L. Cromme}, 25854 title = {Strong Uniqueness}, 25855 journal = {Numerische Mathematik}, 25856 year = {1978}, 25857 volume = {29}, 25858 pages = {179--193} 25859} 25860 25861@Article{ crowder.johnson.ea:solving, 25862 author = {H. Crowder and E. L. Johnson and M. W. Padberg}, 25863 title = {Solving Large Scale Zero-One Linear Programming Problems}, 25864 journal = {Operations Research}, 25865 year = {1983}, 25866 volume = {31}, 25867 pages = {803--834} 25868} 25869 25870@Article{ cryer.dempster:equivalence, 25871 author = {C. W. Cryer and M. A. H. Dempster}, 25872 title = {Equivalence of Linear Complementarity Problems and Linear Programs in Vector 25873 Lattice {H}ilbert Spaces}, 25874 journal = {SIAM Journal on Control and Optimization}, 25875 year = {1980}, 25876 volume = {18}, 25877 pages = {76--89} 25878} 25879 25880@Article{ cryer:method, 25881 author = {C. W. Cryer}, 25882 title = {The method of {C}hristopherson for solving free boundary problems for infinite 25883 journal bearings by means of finite differences}, 25884 journal = {Mathematics of Computation}, 25885 volume = {25}, 25886 year = {1971}, 25887 pages = {435--553} 25888} 25889 25890@Article{ cryer:solution, 25891 author = {C. W. Cryer}, 25892 title = {The Solution of a Quadratic Programming Problem Using Systematic Overrelaxation}, 25893 journal = {SIAM Journal on Control and Optimization}, 25894 year = {1971}, 25895 volume = {9}, 25896 pages = {385--392} 25897} 25898 25899@Article{ cryer:solution*1, 25900 author = {C. W. Cryer}, 25901 title = {The Solution of a Quadratic Programming Using Systematic Overrelaxation}, 25902 journal = {SIAM Journal on Control}, 25903 year = {1971}, 25904 volume = {9}, 25905 pages = {385--392} 25906} 25907 25908@Manual{ culler:split-c, 25909 author = {D. Culler}, 25910 title = {The Split--{C} Programming Language}, 25911 organization = {Computer Science Department, University of California, Berkeley} 25912} 25913 25914@InProceedings{ cun.denker.ea:optimal, 25915 author = {Y. le Cun and J. S. Denker and S. A. Solla}, 25916 title = {Optimal Brain Damage}, 25917 booktitle = {Advances in Neural Information Processing Systems II {(Denver 1989)}}, 25918 year = {1990}, 25919 editor = {D. S. Touretzky}, 25920 publisher = {Morgan Kaufmann}, 25921 address = {San Mateo, California}, 25922 pages = {598--605} 25923} 25924 25925@TechReport{ czyzyk.mehrotra.ea:pcx, 25926 author = {J. Czyzyk and S. Mehrotra and S. J. Wright}, 25927 title = {{PCx} Users Guide}, 25928 institution = {Optimization Technology Center, Argonne National Laboratory and Northwestern 25929 University}, 25930 year = {1996}, 25931 type = {Technical Report}, 25932 number = {OTC 96/01} 25933} 25934 25935@TechReport{ czyzyk.mesnier.ea:network-enabled, 25936 address = {Argonne, Illinois}, 25937 author = {J. Czyzyk and M. P. Mesnier and J. J. Mor\'e}, 25938 institution = {Argonne National Laboratory}, 25939 number = {MCS-P615-0996}, 25940 title = {The {N}etwork-{E}nabled {O}ptimization {S}erver}, 25941 type = {Preprint}, 25942 year = {1996} 25943} 25944 25945@Article{ czyzyk.wisniewski.ea:optimization, 25946 title = {Optimization Case Studies in the {NEOS} Guide}, 25947 author = {J. Czyzyk and T. Wisniewski and S. J. Wright}, 25948 journal = {SIAM Review}, 25949 volume = {41}, 25950 pages = {148--163}, 25951 year = {1999} 25952} 25953 25954@Article{ dai.laan.ea:simplicial, 25955 author = {Y. Dai and G. van der Laan and A. J. J. Talman and Y. Yamamoto}, 25956 title = {A Simplicial Algorithm for the Nonlinear Stationary Problem on an Unbounded 25957 Polyhedron}, 25958 journal = {SIAM Journal on Optimization}, 25959 year = {1991}, 25960 volume = {1}, 25961 pages = {151--165} 25962} 25963 25964@Article{ dai.talman:linear, 25965 author = {Y. Dai and D. Talman}, 25966 title = {Linear Stationary Point Problems on Unbounded Polyhedra}, 25967 journal = {Mathematics of Operations Research}, 25968 year = {1993}, 25969 pages = {635--644} 25970} 25971 25972@Book{ daniel:approximate, 25973 author = {J. W. Daniel}, 25974 title = {The approximate minimization of functionals}, 25975 year = {1971}, 25976 publisher = {Prentice-Hall, Inc}, 25977 address = {Englewood Cliffs, New Jersey} 25978} 25979 25980@Article{ danskin:theory, 25981 author = {J. M. Danskin}, 25982 title = {The Theory of Min--Max, with Applications}, 25983 journal = {SIAM Journal on Applied Mathematics}, 25984 year = {1964}, 25985 volume = {14}, 25986 pages = {641--664} 25987} 25988 25989@Book{ danskin:theory*1, 25990 author = {J. M. Danskin}, 25991 title = {The Theory of Min--Max}, 25992 year = {1967}, 25993 publisher = {Springer-Verlag}, 25994 address = {New York} 25995} 25996 25997@InCollection{ dantzig.cottle:positive, 25998 author = {G. B. Dantzig and R. W. Cottle}, 25999 title = {Positive (semi-)definite programming}, 26000 booktitle = {Nonlinear Programming}, 26001 publisher = {North-Holland}, 26002 editor = {J. Abadie}, 26003 address = {Amsterdam}, 26004 year = {1967}, 26005 pages = {55--73} 26006} 26007 26008@Article{ dantzig.manne:complementarity, 26009 author = {G. B. Dantzig and A. S. Manne}, 26010 title = {A Complementarity Algorithm for an Optimal Captial Path with Invariant 26011 Proportions}, 26012 journal = {Journal of Economic Theory}, 26013 year = {1974}, 26014 volume = {9}, 26015 pages = {312--323} 26016} 26017 26018@Article{ dantzig.wolfe:decomposition, 26019 author = {G. B. Dantzig and P. Wolfe}, 26020 title = {Decomposition Principle for Linear Programs}, 26021 journal = {Operations Research}, 26022 year = {1960}, 26023 volume = {8}, 26024 pages = {101--111} 26025} 26026 26027@Book{ dantzig:linear, 26028 author = {G. B. Dantzig}, 26029 title = {Linear Programming and Extensions}, 26030 year = {1963}, 26031 publisher = {Princeton University Press}, 26032 address = {Princeton, New Jersey} 26033} 26034 26035@Manual{ dash:xpress-mp, 26036 title = {{XPRESS-MP} User Guide}, 26037 organization = {Dash Associates}, 26038 address = {Blisworth House, Blisworth, Northants, UK}, 26039 note = {http://www.dashopt.com/} 26040} 26041 26042@Book{ davis:handbook, 26043 author = {L. D. Davis}, 26044 title = {The Handbook of Genetic Algorithms}, 26045 year = {1990}, 26046 publisher = {Van Nostrand Reinhold} 26047} 26048 26049@TechReport{ davis:users, 26050 author = {T. A. Davis}, 26051 title = {Users' guide for the unsymmetric-pattern multifrontal Package ({UMFPACK})}, 26052 type = {{Technical Report}}, 26053 year = {1993}, 26054 institution = {Computer and Information Sciences Department, University of Florida}, 26055 address = {Gainesville, Florida} 26056} 26057 26058@TechReport{ dax:computation, 26059 author = {A. Dax}, 26060 title = {The Computation of Descent Directions at Degenerate Points}, 26061 institution = {Hydrological Service of Israel}, 26062 year = {1985}, 26063 type = {Technical Report} 26064} 26065 26066@Article{ dax:note, 26067 author = {A. Dax}, 26068 title = {A Note on Optimality Conditions for the Euclidean Multifacility Location 26069 Problem}, 26070 journal = {Mathematical Programming}, 26071 year = {1986}, 26072 volume = {36}, 26073 pages = {72--80} 26074} 26075 26076@Article{ deasy:multiple, 26077 author = {J. O. Deasy}, 26078 title = {Multiple local minima in radiotherapy optimization problems with dose volume 26079 constraints}, 26080 journal = {Medical Physics}, 26081 year = {1997}, 26082 optvolume = {24}, 26083 optnumber = {7}, 26084 optpages = {1157-1161} 26085} 26086 26087@Article{ deboor.ron:computational, 26088 author = {C. {deBoor} and A. Ron}, 26089 title = {Computational Aspects of Polynomial Interpolation in Several Variables}, 26090 journal = {Mathematics of Computation}, 26091 year = {1992}, 26092 volume = {58}, 26093 pages = {705--727} 26094} 26095 26096@Article{ debremaecker.ferris.ea:compressional, 26097 author = {J.--C. {De~Bremaecker} and M. C. Ferris and D. Ralph}, 26098 title = {Compressional Fractures considered as Contact Problems and Mixed Complementarity 26099 Problems}, 26100 year = {2000}, 26101 key = {82}, 26102 journal = {Engineering Fracture Mechanics}, 26103 volume = {66}, 26104 pages = {287--303} 26105} 26106 26107@Article{ debremaecker.ferris:comparison, 26108 author = {J.--C. {De~Bremaecker} and M. C. Ferris}, 26109 title = {A Comparison of Two Algorithms for Solving Closed Crack Problems}, 26110 year = {2000}, 26111 key = {90}, 26112 url = {ftp://ftp.cs.wisc.edu/math-prog/tech-reports/00-01.ps}, 26113 journal = {Engineering Fracture Mechanics}, 26114 volume = {66}, 26115 pages = {601--605}, 26116 institution = {Computer Sciences Department, University of Wisconsin}, 26117 address = {Madison, Wisconsin}, 26118 number = {00-01} 26119} 26120 26121@Article{ dedonato.maier:mathematical, 26122 author = {O. {De~Donato} and G. Maier}, 26123 title = {Mathematical programming methods for the inelastic analysis of reinforced 26124 concrete frames allowing for limited rotation capacity}, 26125 journal = {International Journal for Numerical Methods in Engineering}, 26126 volume = {4}, 26127 year = {1972}, 26128 pages = {307--329} 26129} 26130 26131@Book{ deimling:nonlinear, 26132 author = {K. Deimling}, 26133 title = {Nonlinear Functional Analysis}, 26134 publisher = {Springer-Verlag}, 26135 year = {1985} 26136} 26137 26138@PhDThesis{ dejong:analysis, 26139 author = {K. A. De~Jong}, 26140 title = {An Analysis of the Behavior of a Class of Genetic Adaptive Systems}, 26141 year = {1975}, 26142 school = {University of Michigan}, 26143 note = {Dissertation Abstracts International 36(10), 5140B} 26144} 26145 26146@Article{ deleone.mangasarian.ea:multi-sweep, 26147 author = {R. {De~Leone} and O. L. Mangasarian and T.-H. Shiau}, 26148 title = {Multi-Sweep Asynchronous Parallel Successive Overelaxation for the Nonsymmetric 26149 Linear Complementarity Problem}, 26150 journal = {Annals of Operations Research}, 26151 year = {1990}, 26152 volume = {22}, 26153 pages = {43--54} 26154} 26155 26156@InCollection{ deleone.mangasarian:serial, 26157 author = {R. {De~Leone} and O. L. Mangasarian}, 26158 title = {Serial and Parallel Solution of Large Scale Linear Programs by Augmented 26159 {L}agrangian Successive Overrelaxation}, 26160 booktitle = {Optimization, Parallel Processing and Applications}, 26161 publisher = {Springer-Verlag}, 26162 year = {1988}, 26163 editor = {A. Kurzhanski and K. Neumann and D. Pallaschke}, 26164 volume = {304}, 26165 series = {Lecture Notes in Economics and Mathematical Systems}, 26166 pages = {103--124}, 26167 address = {Berlin} 26168} 26169 26170@TechReport{ deluca.facchinei.ea:combining, 26171 author = {T. {De~Luca} and F. Facchinei and C. Kanzow}, 26172 title = {Combining Equation-Based Methods for the Solution of Large-Scale Nonlinear 26173 Complementarity Problems: Theory and Numerical Results}, 26174 type = {Preprint}, 26175 institution = {Institute of Applied Mathematics, University of Hamburg}, 26176 year = {1996} 26177} 26178 26179@TechReport{ deluca.facchinei.ea:general, 26180 author = {T. {De~Luca} and F. Facchinei and C. Kanzow}, 26181 title = {A General Framework for Solving Nonlinear Complementarity Problems: Theory and 26182 Numerical Results}, 26183 type = {Preprint}, 26184 institution = {Institute of Applied Mathematics, University of Hamburg}, 26185 year = {1997} 26186} 26187 26188@Article{ deluca.facchinei.ea:semismooth, 26189 author = {T. {De~Luca} and F. Facchinei and C. Kanzow}, 26190 title = {A Semismooth Equation Approach to the Solution of Nonlinear Complementarity 26191 Problems}, 26192 journal = {Mathematical Programming}, 26193 volume = {75}, 26194 pages = {407--439}, 26195 year = {1996} 26196} 26197 26198@Article{ deluca.facchinei.ea:theoretical, 26199 author = {T. {De~Luca} and F. Facchinei and C. Kanzow}, 26200 title = {A Theoretical and Numerical Comparison of some Semismooth Algorithms for 26201 Complementarity Problems}, 26202 year = {1999}, 26203 journal = {Computational Optimization and Applications, forthcoming} 26204} 26205 26206@Article{ demarzo.eaves:computing, 26207 author = {P. M. DeMarzo and B. C. Eaves}, 26208 title = {Computing Equilibria of {GEI} by Relocalization on a Grassmann Manifold}, 26209 journal = {Journal of Mathematical Economics}, 26210 year = {1996}, 26211 volume = {26}, 26212 pages = {479--497} 26213} 26214 26215@Article{ dembo.steihaug:truncated, 26216 author = {R. S. Dembo and T. Steihaug}, 26217 title = {Truncated {N}ewton Method Algorithms for Large--Scale Unconstrained 26218 Optimization}, 26219 journal = {Mathematical Programming}, 26220 year = {1983}, 26221 volume = {26}, 26222 pages = {190--212} 26223} 26224 26225@Article{ dembo:performance, 26226 author = {R. S. Dembo}, 26227 title = {The Performance of {NLPNET}, {A} Large--Scale Nonlinear Network Optimizer}, 26228 journal = {Mathematical Programming Study}, 26229 year = {1986}, 26230 volume = {26}, 26231 pages = {245--248} 26232} 26233 26234@Article{ demoor.vandenberghe.ea:generalized, 26235 author = {B. {De~Moor} and L. Vandenberghe and J. Vandewalle}, 26236 title = {The generalized linear complementarity problem and an algorithm to find all its 26237 solutions}, 26238 journal = {Mathematical Programming}, 26239 volume = {57}, 26240 year = {1992}, 26241 pages = {415--426} 26242} 26243 26244@Book{ demyanov.vasilev:nondifferentiable, 26245 author = {V. F. Dem\'{y}anov and L. V. Vasil\'{e}v}, 26246 title = {Nondifferentiable Optimization}, 26247 publisher = {Optimization Software, Inc.}, 26248 year = {1985}, 26249 address = {New York} 26250} 26251 26252@Book{ dennis.schnabel:numerical, 26253 author = {J. E. Dennis and R. B. Schnabel}, 26254 title = {Numerical Methods for Unconstrained Optimization and Nonlinear Equations}, 26255 year = {1983}, 26256 publisher = {Prentice-Hall, Inc}, 26257 address = {Englewood Cliffs, New Jersey} 26258} 26259 26260@Article{ dennis.torczon:direct, 26261 author = {J. E. Dennis and V. Torczon}, 26262 title = {Direct Search Methods on Parallel Machines}, 26263 journal = {SIAM Journal on Optimization}, 26264 year = {1991}, 26265 volume = {1}, 26266 pages = {448--474} 26267} 26268 26269@TechReport{ depierro.iusem:convergence, 26270 author = {A. R. {De~Pierro} and A. N. Iusem}, 26271 title = {Convergence Properties of Iterative Methods for Symmetric Positive Semidefinite 26272 Linear Complementarity Problems}, 26273 institution = {Instituto de Matematica, Elasticita e Ciencia da Computacao}, 26274 year = {1990}, 26275 address = {Universidade Estadual de Campinas, CP 6065, Campinas, 13081, SP, Brazil} 26276} 26277 26278@Article{ depierro.iusem:relaxed, 26279 author = {A. R. {De~Pierro} and A. N. Iusem}, 26280 title = {A Relaxed Version of {B}regman's Method for Convex Programming}, 26281 journal = {Journal of Optimization Theory and Applications}, 26282 year = {1986}, 26283 volume = {51}, 26284 pages = {421--440} 26285} 26286 26287@Book{ dervis.melo.ea:general, 26288 author = {K. Dervis and J. de Melo and S. Robinson}, 26289 title = {General Equilibrium Models of Development Policy}, 26290 publisher = {Cambridge University Press}, 26291 year = {1982}, 26292 address = {Cambridge, England} 26293} 26294 26295@Article{ deschutter.demoor:minimal, 26296 author = {B. {De~Schutter} and B. {De~Moor}}, 26297 title = {Minimal Realization in the Max Algebra is an Extended Linear Complementarity 26298 Problem}, 26299 journal = {Systems \& Control Letters}, 26300 year = {1995}, 26301 pages = {103--111} 26302} 26303 26304@Article{ desilets.golden.ea:predicting, 26305 author = {L. DeSilets and B. Golden and Q. Wang and R. Kumar}, 26306 title = {Predicting Salinity in the {C}hesapeake {B}ay Using Backpropagation}, 26307 journal = {Computers \& Operations Research}, 26308 year = {1992}, 26309 volume = {19}, 26310 pages = {277--285} 26311} 26312 26313@PhDThesis{ desilva:sensitivity, 26314 author = {A. H. DeSilva}, 26315 title = {Sensitivity Formulas for Nonlinear Factorable Programming and their Application 26316 to the Solution of an Implicitly Defined Optimization Model of {US} Crude Oil 26317 Production}, 26318 school = {George Washington University}, 26319 address = {Washington, D.C.}, 26320 year = {1978} 26321} 26322 26323@TechReport{ dijkstra:cooperating, 26324 author = {E. W. Dijkstra}, 26325 title = {Cooperating Sequential Processes}, 26326 institution = {Technological University}, 26327 year = {1965}, 26328 address = {Eindhoven, The Netherlands}, 26329 number = {EWD--123}, 26330 type = {Technical Report} 26331} 26332 26333@Article{ dikin:iterative, 26334 author = {I. I. Dikin}, 26335 title = {Iterative Solution of Problems of Linear and Quadratic Programming}, 26336 journal = {Soviet Mathematics Doklady}, 26337 year = {1967}, 26338 volume = {8}, 26339 pages = {674--675} 26340} 26341 26342@InCollection{ dipillo.grippo.ea:class, 26343 author = {G. Di~Pillo and L. Grippo and F. Lampariello}, 26344 title = {A Class of Methods for the Solution of Optimization Problems with Inequalities}, 26345 booktitle = {System Modelling and Optimization}, 26346 year = {1981}, 26347 editor = {R. F. Drenick and F. Kozin}, 26348 publisher = {Springer-Verlag}, 26349 address = {Berlin} 26350} 26351 26352@Article{ dipillo.grippo:augmented, 26353 author = {G. Di~Pillo and L. Grippo}, 26354 title = {An Augmented {L}agrangian for Inequality Constraints in Nonlinear Programming 26355 Problems}, 26356 journal = {Journal of Optimization Theory and Applications}, 26357 year = {1982}, 26358 volume = {36}, 26359 pages = {495--519} 26360} 26361 26362@Article{ dipillo.grippo:class, 26363 author = {G. Di~Pillo and L. Grippo}, 26364 title = {A New Class of Augmented {L}agrangians in Nonlinear Programming}, 26365 journal = {SIAM Journal on Control and Optimization}, 26366 year = {1979}, 26367 volume = {17}, 26368 pages = {618--628} 26369} 26370 26371@Article{ dipillo.grippo:continuously, 26372 author = {G. Di~Pillo and L. Grippo}, 26373 title = {A Continuously Differentiable Exact Penalty Function for Nonlinear Programming 26374 Problems with Inequality Constraints}, 26375 journal = {SIAM Journal on Control and Optimization}, 26376 year = {1985}, 26377 volume = {23}, 26378 pages = {72--84} 26379} 26380 26381@Article{ dipillo.grippo:exact, 26382 author = {G. Di~Pillo and L. Grippo}, 26383 title = {An Exact Penalty Method with Global Convergence Properties for Nonlinear 26384 Programming Problems}, 26385 journal = {Mathematical Programming}, 26386 year = {1986}, 26387 volume = {36}, 26388 pages = {1--18} 26389} 26390 26391@TechReport{ dirkse.ferris.ea:gams, 26392 author = {S. P. Dirkse and M. C. Ferris and P. V. Preckel and T. Rutherford}, 26393 title = {The {GAMS} Callable Program Library for Variational and Complementarity Solvers}, 26394 institution = {Computer Sciences Department, University of Wisconsin}, 26395 year = {1994}, 26396 address = {Madison, Wisconsin}, 26397 number = {94-07}, 26398 type = {Mathematical Programming Technical Report}, 26399 url = {ftp: //ftp.cs.wisc.edu/math-prog/tech-reports/94-07.ps}, 26400 key = {25} 26401} 26402 26403@InProceedings{ dirkse.ferris:crash, 26404 crossref = {ferris.pang:complementarity}, 26405 author = {S. P. Dirkse and M. C. Ferris}, 26406 title = {Crash Techniques for Large-Scale Complementarity Problems}, 26407 pages = {40--61}, 26408 url = {ftp: //ftp.cs.wisc.edu/math-prog/tech-reports/95-22.ps}, 26409 key = {52} 26410} 26411 26412@Article{ dirkse.ferris:mcplib, 26413 author = {S. P. Dirkse and M. C. Ferris}, 26414 title = {{MCPLIB}: {A} Collection of Nonlinear Mixed Complementarity Problems}, 26415 journal = {Optimization Methods and Software}, 26416 pages = {319--345}, 26417 volume = {5}, 26418 year = {1995}, 26419 url = {ftp: //ftp.cs.wisc.edu/tech-reports/reports/1994/tr1215.ps}, 26420 key = {36} 26421} 26422 26423@InCollection{ dirkse.ferris:modeling, 26424 author = {S. P. Dirkse and M. C. Ferris}, 26425 title = {Modeling and Solution Environments for {MPEC}: {GAMS} \& {MATLAB}}, 26426 year = {1999}, 26427 pages = {127--148}, 26428 editor = {M. Fukushima and L. Qi}, 26429 booktitle = {Reformulation: Nonsmooth, Piecewise Smooth, Semismooth and Smoothing Methods}, 26430 publisher = {Kluwer Academic Publishers}, 26431 url = {ftp: //ftp.cs.wisc.edu/math-prog/tech-reports/97-09.ps}, 26432 key = {62} 26433} 26434 26435@Article{ dirkse.ferris:path, 26436 author = {S. P. Dirkse and M. C. Ferris}, 26437 title = {The {PATH} Solver: {A} Non-Monotone Stabilization Scheme for Mixed 26438 Complementarity Problems}, 26439 journal = {Optimization Methods and Software}, 26440 pages = {123--156}, 26441 volume = {5}, 26442 year = {1995}, 26443 url = {ftp: //ftp.cs.wisc.edu/tech-reports/reports/1993/tr1179.ps}, 26444 key = {33} 26445} 26446 26447@Article{ dirkse.ferris:pathsearch, 26448 author = {S. P. Dirkse and M. C. Ferris}, 26449 title = {A Pathsearch Damped {N}ewton Method for Computing General Equilibria}, 26450 journal = {Annals of Operations Research}, 26451 vol = {68}, 26452 year = {1996}, 26453 pages = {211--232}, 26454 url = {ftp: //ftp.cs.wisc.edu/math-prog/tech-reports/94-03.ps}, 26455 key = {39} 26456} 26457 26458@InCollection{ dirkse.ferris:traffic, 26459 author = {S. P. Dirkse and M. C. Ferris}, 26460 title = {Traffic Modeling and Variational Inequalities using {GAMS}}, 26461 booktitle = {Operations Research and Decision Aid Methodologies in Traffic and Transportation 26462 Management}, 26463 publisher = {Springer-Verlag}, 26464 year = {1998}, 26465 editor = {Ph. L. Toint and M. Labbe and K. Tanczos and G. Laporte}, 26466 series = {NATO ASI Series F}, 26467 volume = {166}, 26468 pages = {136--163}, 26469 key = {61}, 26470 url = {ftp: //ftp.cs.wisc.edu/math-prog/tech-reports/97-06.ps} 26471} 26472 26473@PhDThesis{ dirkse:robust, 26474 author = {S. P. Dirkse}, 26475 title = {Robust Solution of Mixed Complementarity Problems}, 26476 school = {Computer Sciences Department, University of Wisconsin}, 26477 year = {1994}, 26478 address = {Madison, Wisconsin}, 26479 note = {Available from ftp://ftp.cs.wisc.edu/math-prog/tech-reports/}, 26480 annote = {Mathematical Programming Technical Report 94-12} 26481} 26482 26483@TechReport{ dixon.mills:neural, 26484 author = {L. C. Dixon and D. J. Mills}, 26485 title = {Neural Nets for Massively Parallel Optimisation}, 26486 institution = {Hatfield Polytechnic}, 26487 year = {1992}, 26488 address = {Hatfield, Hertforshire, England}, 26489 number = {Numerical Optimisation Centre Technical Report No. 259} 26490} 26491 26492@Article{ dontchev:local, 26493 author = {A. L. Dontchev}, 26494 title = {Local Convergence of the {N}ewton method for Generalized Equations}, 26495 journal = {C.R. Acad. Sci. Paris Series I}, 26496 year = {1996}, 26497 volume = {332}, 26498 pages = {327--331} 26499} 26500 26501@Article{ douglas.rachford:numerical, 26502 author = {J. Douglas and H. H. Rachford}, 26503 title = {On the Numerical Solution of Heat Conduction Problems in Two and Three Space 26504 Variables}, 26505 journal = {Transactions of the American Mathematical Society}, 26506 year = {1956}, 26507 volume = {82}, 26508 pages = {421--439} 26509} 26510 26511@Article{ drud:conopt, 26512 author = {A. Drud}, 26513 title = {{CONOPT}: {A} {GRG} Code for Large Sparse Dynamic Nonlinear Optimization 26514 Problems}, 26515 journal = {Mathematical Programming}, 26516 year = {1985}, 26517 volume = {31}, 26518 pages = {153--191} 26519} 26520 26521@Article{ dsouza.meyer.ea:mixed, 26522 author = {W. D. D'Souza and R. R. Meyer and M. C. Ferris and B. R. Thomadsen}, 26523 title = {Mixed Integer Programming Models for Prostate Brachytherapy Treatment 26524 Optimization}, 26525 journal = {Medical Physics}, 26526 year = {1999}, 26527 key = {85}, 26528 volume = {26}, 26529 number = {6}, 26530 pages = {1099} 26531} 26532 26533@TechReport{ dsouza.meyer.ea:mixed*1, 26534 author = {W. D. D'Souza and R. R. Meyer and M. C. Ferris and B. R. Thomadsen}, 26535 title = {Mixed Integer Programming Models for Prostate Brachytherapy Treatment 26536 Optimization}, 26537 year = {1999}, 26538 key = {87}, 26539 url = {ftp: //ftp.cs.wisc.edu/math-prog/tech-reports/99-08.ps}, 26540 institution = {Computer Sciences Department, University of Wisconsin}, 26541 address = {Madison, Wisconsin}, 26542 number = {99-08}, 26543 type = {Mathematical Programming Technical Report}, 26544 annote = {Submitted to } 26545} 26546 26547@Article{ dsouza.meyer.ea:iterative, 26548 author = {W. D. D'Souza and R. R. Meyer and B. R. Thomadsen and M. C. Ferris}, 26549 title = {An Iterative Sequential Mixed-Integer Approach to Automated Prostate 26550 Brachytherapy Treatment Optimization}, 26551 year = {2000}, 26552 key = {96}, 26553 journal = {Physics and Medicine in Biology, forthcoming} 26554} 26555 26556@Article{ du.yu.ea:multileaf, 26557 author = {M. N. Du and C. X. Yu and M. Symons and D. Yan and R. Taylor and R. C. Matter and 26558 G. Gustafson and A. Martinez and J. W. Wong}, 26559 title = {A multileaf collimator field prescription preparation system for conventional 26560 radiotherapy}, 26561 journal = {International Journal of Radiation Oncology, Biology and Physics}, 26562 year = {1994}, 26563 volume = {30}, 26564 number = {3}, 26565 pages = {707--714} 26566} 26567 26568@Article{ duda.fossum:pattern, 26569 author = {R. O. Duda and H. Fossum}, 26570 title = {Pattern Classification by Iteratively Determined Linear and Piecewise Linear 26571 Discriminant Functions}, 26572 journal = {IEEE Transactions on Electronic Computers}, 26573 year = {1966}, 26574 volume = {15}, 26575 pages = {220--232} 26576} 26577 26578@Book{ duda.hart:pattern, 26579 author = {R. O. Duda and P. E. Hart}, 26580 title = {Pattern Classification and Scene Analysis}, 26581 year = {1973}, 26582 publisher = {John Wiley \& Sons}, 26583 address = {New York} 26584} 26585 26586@Book{ duff.erisman.ea:direct, 26587 author = {I. S. Duff and A. M. Erisman and J. K. Reid}, 26588 title = {Direct Methods for Sparse Matrices}, 26589 publisher = {Oxford University Press}, 26590 year = {1986}, 26591 address = {Oxford, England} 26592} 26593 26594@InCollection{ duffin:infinite, 26595 author = {R. J. Duffin}, 26596 title = {Infinite Programs}, 26597 booktitle = {Linear Inequalities and Related Systems}, 26598 year = {1975}, 26599 editor = {H. W. Kuhn and A. W. Tucker}, 26600 publisher = {Princeton University Press}, 26601 address = {Princeton, New Jersey}, 26602 pages = {157--170} 26603} 26604 26605@Article{ dunn.sachs:effect, 26606 author = {J. C. Dunn and E. Sachs}, 26607 title = {The Effect of Perturbations on the Convergence Rates of Optimization Algorithms}, 26608 journal = {Applied Mathematics and Optimization}, 26609 year = {1983}, 26610 volume = {10}, 26611 pages = {143--157} 26612} 26613 26614@Article{ dunn:convergence, 26615 author = {J. C. Dunn}, 26616 title = {On the Convergence of Projected Gradient Processes to Singular Critical Points}, 26617 journal = {Journal of Optimization Theory and Applications}, 26618 year = {1987}, 26619 volume = {55}, 26620 pages = {203--216} 26621} 26622 26623@Article{ dunn:global, 26624 author = {J. C. Dunn}, 26625 title = {Global and Asymptotic Convergence Rate Estimates for a Class of Projected 26626 Gradient Processes}, 26627 journal = {SIAM Journal on Control and Optimization}, 26628 year = {1981}, 26629 volume = {19}, 26630 pages = {368--400} 26631} 26632 26633@Article{ dunn:rates, 26634 author = {J. C. Dunn}, 26635 title = {Rates of Convergence for Conditional Gradient Algorithms Near Singular and 26636 Nonsingular Extremals}, 26637 journal = {SIAM Journal on Control and Optimization}, 26638 year = {1979}, 26639 volume = {17}, 26640 pages = {187--211} 26641} 26642 26643@Article{ dupuis.simha:sampling, 26644 author = {P. Dupuis and R. Simha}, 26645 title = {On Sampling-Controlled Stochastic Approximation}, 26646 journal = {{IEEE} Transactions on Automatic Control}, 26647 year = {1991}, 26648 volume = {36}, 26649 pages = {915--924} 26650} 26651 26652@TechReport{ eager.ferris.ea:models, 26653 author = {D. L. Eager and M. C. Ferris and M. K. Vernon}, 26654 title = {Models for Optimized Regional Caching in Heterogeneous Video-On-Demand Systems}, 26655 institution = {Computer Sciences Department, University of Wisconsin}, 26656 year = {1999}, 26657 type = {Technical Report}, 26658 number = {1402}, 26659 address = {Madison, Wisconsin}, 26660 url = {http: //www.cs.wisc.edu/tech-reports/reports/1999/tr1402.ps.Z}, 26661 key = {84} 26662} 26663 26664@InProceedings{ eager.ferris.ea:optimized, 26665 author = {D. L. Eager and M. C. Ferris and M. K. Vernon}, 26666 title = {Optimized Regional Caching for On-Demand Data Delivery}, 26667 year = {1999}, 26668 booktitle = {Multimedia Computing and Networking, Proceedings of {SPIE}}, 26669 volume = {3654}, 26670 address = {Bellingham, Washington}, 26671 url = {ftp://ftp.cs.wisc.edu/math-prog/tech-reports/98-10.ps}, 26672 key = {69}, 26673 pages = {301--316}, 26674 annote = {18 percent acceptance rate} 26675} 26676 26677@Article{ eager.ferris.ea:optimized*1, 26678 author = {D. L. Eager and M. C. Ferris and M. K. Vernon}, 26679 title = {Optimized Caching in Systems with Heterogeneous Client Populations}, 26680 journal = {Performance Evaluation}, 26681 year = {2000}, 26682 key = {72}, 26683 url = {ftp://ftp.cs.wisc.edu/math-prog/tech-reports/98-15.ps}, 26684 volume = {42}, 26685 pages = {163--185} 26686} 26687 26688@InProceedings{ eager.vernon:dynamic, 26689 author = {D. L. Eager and M. K. Vernon}, 26690 title = {Dynamic Skyscraper Broadcasts for Video-On-Demand}, 26691 year = {1998}, 26692 booktitle = {Proceedings of the 4th International Workshop on Multimedia Information Systems 26693 ({MIS '98})}, 26694 pages = {18--32}, 26695 address = {Istanbul, Turkey} 26696} 26697 26698@Article{ eaves.lemke:equivalence, 26699 author = {B. C. Eaves and C. E. Lemke}, 26700 title = {Equivalence of {LCP} and {PLS}}, 26701 journal = {Mathematics of Operations Research}, 26702 year = {1981}, 26703 volume = {6}, 26704 pages = {475--484} 26705} 26706 26707@Article{ eaves.rothblum:relationships, 26708 author = {B. C. Eaves and U. G. Rothblum}, 26709 title = {Relationships of Properties of Piecewise Affine Maps over Ordered Fields}, 26710 journal = {Linear Algebra and Its Applications}, 26711 year = {1990}, 26712 volume = {132}, 26713 pages = {1--63} 26714} 26715 26716@Article{ eaves:basic, 26717 author = {B. C. Eaves}, 26718 title = {On the Basic Theorem of Complementarity}, 26719 journal = {Mathematical Programming}, 26720 year = {1971}, 26721 volume = {1}, 26722 pages = {68--87} 26723} 26724 26725@Article{ eaves:computing, 26726 author = {B. C. Eaves}, 26727 title = {Computing Stationary Points}, 26728 journal = {Mathematical Programming Study}, 26729 year = {1978}, 26730 volume = {7}, 26731 pages = {1--14} 26732} 26733 26734@InCollection{ eaves:computing*1, 26735 author = {B. C. Eaves}, 26736 title = {Computing Stationary Points, Again}, 26737 pages = {391--405}, 26738 crossref = {mangasarian.meyer.ea:nonlinear*3} 26739} 26740 26741@Article{ eaves:homotopies, 26742 author = {B. C. Eaves}, 26743 title = {Homotopies for Computation of Fixed Points}, 26744 journal = {Mathematical Programming}, 26745 year = {1972}, 26746 volume = {3}, 26747 pages = {1--22} 26748} 26749 26750@Article{ eaves:linear, 26751 author = {B. C. Eaves}, 26752 title = {The Linear Complementarity Problem}, 26753 journal = {Management Science}, 26754 year = {1971}, 26755 volume = {17}, 26756 pages = {612--634} 26757} 26758 26759@Article{ eaves:quadratic, 26760 author = {B. C. Eaves}, 26761 title = {On Quadratic Programming}, 26762 journal = {Management Science}, 26763 year = {1971}, 26764 volume = {17}, 26765 pages = {698--711} 26766} 26767 26768@InProceedings{ eaves:short, 26769 author = {B. C. Eaves}, 26770 title = {A Short Course in Solving Equations with {PL} Homotopies}, 26771 booktitle = {Nonlinear Programming}, 26772 organization = {American Mathematical Society}, 26773 year = {1976}, 26774 editor = {R. W. Cottle and C. E. Lemke}, 26775 publisher = {SIAM--AMS Proceedings}, 26776 address = {Providence, RI}, 26777 pages = {73--143} 26778} 26779 26780@InCollection{ ebiefung.kostreva:global, 26781 author = {A. A. Ebiefung and M. M. Kostreva}, 26782 title = {Global Solvability of Generalized Linear Complementarity Problems and a Related 26783 Class of Polynomial Complementarity Problems}, 26784 editors = {C. Floudas and P. Pardalos}, 26785 booktitle = {Recent Advances in Global Optimization}, 26786 publisher = {Princeton University Press}, 26787 pages = {102--124}, 26788 year = {1991} 26789} 26790 26791@TechReport{ ebiefung.kostreva:z-matrices, 26792 author = {A. A. Ebiefung and M. M. Kostreva}, 26793 title = {{Z}--Matrices annd the Generalized Linear Complementarity Problem}, 26794 institution = {Department of Mathematical Sciences, Clemson University}, 26795 year = {1991}, 26796 number = {608}, 26797 address = {Clemson, South Carolina} 26798} 26799 26800@TechReport{ eckstein.bertsekas:alternating, 26801 author = {J. Eckstein and D. P. Bertsekas}, 26802 title = {An Alternating Direction Method for Linear Programming}, 26803 institution = {Harvard Business School}, 26804 year = {1990}, 26805 type = {Working Paper}, 26806 number = {90-063}, 26807 address = {Boston, MA} 26808} 26809 26810@Article{ eckstein.bertsekas:douglas-rachford, 26811 author = {J. Eckstein and D. P. Bertsekas}, 26812 title = {On the {D}ouglas-{R}achford Splitting Method and the Proximal Point Algorithm for 26813 Maximal Monotone Operators}, 26814 journal = {Mathematical Programming}, 26815 year = {1992}, 26816 pages = {293--318}, 26817 volume = {55} 26818} 26819 26820@Article{ eckstein.bertsekas:douglas-rachford*1, 26821 author = {J. Eckstein and D. P. Bertsekas}, 26822 title = {On the {D}ouglas--{R}achford Splitting Method and the Proximal Point Algorithm 26823 for Maximal Monotone Operators}, 26824 journal = {Mathematical Programming}, 26825 year = {1991}, 26826 note = {To appear} 26827} 26828 26829@TechReport{ eckstein.ferris:operator, 26830 author = {J. Eckstein and M. C. Ferris}, 26831 title = {Operator Splitting Methods for Monotone Linear Complementarity Problems}, 26832 institution = {Thinking Machines Corporation}, 26833 year = {1992}, 26834 address = {Cambridge, MA 02142}, 26835 number = {239}, 26836 type = {TMC}, 26837 key = {26} 26838} 26839 26840@Article{ eckstein.ferris:operator*1, 26841 author = {J. Eckstein and M. C. Ferris}, 26842 title = {Operator Splitting Methods for Monotone Affine Variational Inequalities, with a 26843 Parallel Application to Optimal Control}, 26844 volume = {10}, 26845 pages = {218--235}, 26846 year = {1998}, 26847 journal = {INFORMS Journal on Computing}, 26848 url = {ftp: //ftp.cs.wisc.edu/math-prog/tech-reports/94-17.ps}, 26849 key = {44} 26850} 26851 26852@Article{ eckstein.ferris:smooth, 26853 author = {J. Eckstein and M. C. Ferris}, 26854 title = {Smooth Methods of Multipliers for Complementarity Problems}, 26855 key = {58}, 26856 url = {ftp: //ftp.cs.wisc.edu/math-prog/tech-reports/97-01.ps}, 26857 year = {1999}, 26858 journal = {Mathematical Programming}, 26859 volume = {86}, 26860 pages = {65--90} 26861} 26862 26863@InProceedings{ eckstein.hart.ea:resource, 26864 author = {J. Eckstein and W. E. Hart and C. A. Phillips}, 26865 title = {Resource Management in a Parallel Mixed Integer Programming Package}, 26866 booktitle = {Intel Supercomputer Users Group Thirteenth Annual Conference}, 26867 year = {1997}, 26868 note = {www.cs.sandia.gov/ISUG97} 26869} 26870 26871@Article{ eckstein:alternating, 26872 author = {J. Eckstein}, 26873 title = {The Alternating Step Method for Monotropic Programming on the {Connection Machine 26874 CM-2}}, 26875 journal = {ORSA Journal on Computing}, 26876 year = {to appear} 26877} 26878 26879@Article{ eckstein:approximate, 26880 author = {J. Eckstein}, 26881 title = {Approximate Iterations in {B}regman-Function-Based Proximal Algorithms}, 26882 year = {1998}, 26883 journal = {Mathematical Programming}, 26884 volume = {83}, 26885 pages = {113--124} 26886} 26887 26888@Article{ eckstein:communication, 26889 author = {J. Eckstein}, 26890 title = {How Much Communication Does Parallel Branch and Bound Need}, 26891 journal = {{INFORMS} Journal on Computing}, 26892 volume = {9}, 26893 year = {1997}, 26894 pages = {15--29} 26895} 26896 26897@Article{ eckstein:distributed, 26898 author = {J. Eckstein}, 26899 title = {Distributed Versus Centralized Control for Parallel Branch and Bound: {M}ixed 26900 Integer Programming on the {CM}-5}, 26901 journal = {Computational Optimization and Applications}, 26902 volume = {7}, 26903 pages = {199--220}, 26904 year = {1997} 26905} 26906 26907@TechReport{ eckstein:lions-mercier, 26908 author = {J. Eckstein}, 26909 title = {The {L}ions--{M}ercier Splitting Algorithm and the Alternating Direction Method 26910 as instances of the Proximal Point Algorithm}, 26911 institution = {MIT}, 26912 year = {1988}, 26913 address = {Cambridge, Massachusetts}, 26914 number = {LIDS-P-1769} 26915} 26916 26917@Article{ eckstein:nonlinear, 26918 author = {J. Eckstein}, 26919 title = {Nonlinear Proximal Point Algorithms Using {B}regman Functions, with Applications 26920 to Convex Programming}, 26921 journal = {Mathematics of Operations Research}, 26922 year = {1993}, 26923 pages = {202--226}, 26924 volume = {18} 26925} 26926 26927@Article{ eckstein:parallel, 26928 author = {J. Eckstein}, 26929 title = {Parallel Branch-and-Bound Algorithms for General Mixed Integer Programming on the 26930 {CM}-5}, 26931 journal = {SIAM Journal on Optimization}, 26932 volume = {4}, 26933 pages = {794--814}, 26934 year = {1994} 26935} 26936 26937@TechReport{ eckstein:smooth, 26938 author = {J. Eckstein}, 26939 title = {Smooth Methods of Multipliers for Monotone Complementarity Problems}, 26940 institution = {Rutgers Center for Operations Research, Rutgers University}, 26941 address = {New Brunswick, New Jersey}, 26942 year = {1996}, 26943 type = {Research Report}, 26944 number = {27-96} 26945} 26946 26947@PhDThesis{ eckstein:splitting, 26948 author = {J. Eckstein}, 26949 title = {Splitting Methods for Monotone Operators, with Applications to Parallel 26950 Optimization}, 26951 school = {Massachusetts Institute of Technology}, 26952 year = {1989}, 26953 address = {Cambridge, MA}, 26954 note = {Report LIDS-TH-1877, Laboratory for Information and Decision Systems, M.I.T.} 26955} 26956 26957@Article{ eglese:simulated, 26958 author = {R. W. Eglese}, 26959 title = {Simulated Annealing: {A} Tool for Operational Research}, 26960 journal = {European Journal of Operations Research}, 26961 year = {1990}, 26962 volume = {46}, 26963 pages = {271--281} 26964} 26965 26966@Book{ ekeland.temam:convex, 26967 author = {I. Ekeland and R. Temam}, 26968 title = {Convex Analysis and Variational Problems}, 26969 year = {1976}, 26970 publisher = {North--Holland}, 26971 address = {Amsterdam} 26972} 26973 26974@Article{ ekeland:variational, 26975 author = {I. Ekeland}, 26976 title = {On the Variational Principle}, 26977 journal = {Journal of Mathematical Analysis and Applications}, 26978 year = {1974}, 26979 volume = {47}, 26980 pages = {324--353} 26981} 26982 26983@TechReport{ el-bakry.tapia.ea:formulation, 26984 author = {A. S. El-Bakry and R. A. Tapia and T. Tsuchiya and Y. Zhang}, 26985 title = {On the formulation and theory of the primal-dual {N}ewton interior-point method 26986 for nonlinear programming}, 26987 type = {{Technical Report TR92-40}}, 26988 institution = {{Department of Computational and Applied Mathematics, Rice University}}, 26989 year = {1992} 26990} 26991 26992@Article{ eldersveld.saunders:block, 26993 author = {S. K. Eldersveld and M. A. Saunders}, 26994 title = {A Block-{LU} Update for Large--Scale Linear Programming}, 26995 journal = {SIAM Journal on Matrix Analysis and Applications}, 26996 year = {1992}, 26997 volume = {13}, 26998 pages = {191--201} 26999} 27000 27001@Article{ elster.neumaier:grid, 27002 author = {C. Elster and A. Neumaier}, 27003 title = {A Grid Algorithm for Bound Constrained Optimization of Noisy Functions}, 27004 journal = {{IMA} Journal of Numerical Analysis}, 27005 year = {1995}, 27006 volume = {15}, 27007 pages = {585--608} 27008} 27009 27010@Article{ epema.livny.ea:worldwide, 27011 author = {D. H. J. Epema and M. Livny and R. van Dantzig and X. Evers and J. Pruyne}, 27012 title = {A Worldwide Flock of Condors: Load Sharing among Workstation Clusters}, 27013 journal = {Journal on Future Generations of Computer Systems}, 27014 year = {1996}, 27015 volume = {12}, 27016 pages = {53--65} 27017} 27018 27019@Book{ ermoliev.editors:numerical, 27020 author = {Y. Ermoliev and R. J.-B. Wets {(editors)}}, 27021 title = {Numerical Techniques for Stochastic Optimization Problems}, 27022 year = {1988}, 27023 publisher = {Springer-Verlag}, 27024 address = {Berlin} 27025} 27026 27027@TechReport{ evett.spiehler:rule, 27028 author = {I. W. Evett and E. J. Spiehler}, 27029 title = {Rule Induction in Forensic Science}, 27030 institution = {Central Research Establishment, Home Office Forensic Science Service}, 27031 year = {1987}, 27032 address = {Aldermaston, Reading, Berkshire RG7 4PN}, 27033 type = {Technical Report} 27034} 27035 27036@Article{ evtushenko.purtov:sufficient, 27037 author = {Y. G. Evtushenko and V. A. Purtov}, 27038 title = {Sufficient Conditions for a Minimum for Nonlinear Programming Problems}, 27039 journal = {Soviet Mathematics Doklady}, 27040 year = {1984}, 27041 volume = {30}, 27042 pages = {313--316} 27043} 27044 27045@Article{ facchinei.fischer.ea:regularity, 27046 author = {F. Facchinei and A. Fischer and C. Kanzow}, 27047 title = {Regularity Properties of a Semismooth Reformulation of Variational Inequalities}, 27048 journal = {SIAM Journal on Optimization}, 27049 year = {1998}, 27050 volume = {8}, 27051 pages = {850--869} 27052} 27053 27054@Article{ facchinei.fischer.ea:semismooth, 27055 title = {A Semismooth {N}ewton Method for Variational Inequalities: {T}he Case of Box 27056 Constraints}, 27057 author = {Facchinei, Francisco and Fischer, Andreas and Kanzow, Christian}, 27058 journal = {Complementarity and Variational Problems: State of the Art}, 27059 volume = {92}, 27060 pages = {76}, 27061 year = {1997} 27062} 27063 27064@TechReport{ facchinei.fischer.ea:simply, 27065 author = {F. Facchinei and A. Fischer and C. Kanzow and J. -M. Peng}, 27066 title = {A Simply Constrained Optimization Reformulation of {KKT} Systems Arising from 27067 Variational Inequalities}, 27068 institution = {University of Hamburg}, 27069 year = {1996} 27070} 27071 27072@Article{ facchinei.jiang.ea:smoothing, 27073 author = {F. Facchinei and H. Jiang and L. Qi}, 27074 title = {A Smoothing Method for Mathematical Programs with Equilibrium Constraints}, 27075 year = {1999}, 27076 journal = {Mathematical Programming}, 27077 volume = {85}, 27078 pages = {107--134} 27079} 27080 27081@Article{ facchinei.kanzow:nonsmooth, 27082 author = {F. Facchinei and C. Kanzow}, 27083 title = {A Nonsmooth Inexact {N}ewton Method for the solution of Large-Scale Nonlinear 27084 Complementarity Problems}, 27085 year = {1997}, 27086 journal = {Mathematical Programming}, 27087 volume = {76}, 27088 pages = {493--512} 27089} 27090 27091@Article{ facchinei.kanzow:unconstrained, 27092 author = {F. Facchinei and C. Kanzow}, 27093 title = {On Unconstrained and Constrained Stationary Points of the {I}mplicit 27094 {L}agrangian}, 27095 year = {1997}, 27096 journal = {Journal of Optimization Theory and Applications}, 27097 volume = {92}, 27098 pages = {99--115} 27099} 27100 27101@TechReport{ facchinei.pang:total, 27102 author = {F. Facchinei and J. S. Pang}, 27103 title = {Total stability of variational inequalities}, 27104 institution = {Universit\'a di Roma ``La Sapienza'', Dipartimento di Informatica e Sistemistica}, 27105 year = {1988}, 27106 type = {Manuscript}, 27107 address = {Roma, Italy} 27108} 27109 27110@Article{ facchinei.soares:merit, 27111 author = {F. Facchinei and J. Soares}, 27112 title = {A New Merit Function for Nonlinear Complementarity Problems and a Related 27113 Algorithm}, 27114 journal = {SIAM Journal on Optimization}, 27115 year = {1997}, 27116 volume = {7}, 27117 pages = {225--247} 27118} 27119 27120@InCollection{ facchinei.soares:testing, 27121 author = {F. Facchinei and J. Soares}, 27122 title = {Testing a new class of algorithms for nonlinear complementarity problems}, 27123 booktitle = {Variational Inequalities and Network Equilibrium Problems}, 27124 publisher = {Plenum Press}, 27125 address = {New York}, 27126 editor = {F. Giannessi and A. Maugeri}, 27127 year = {1995}, 27128 pages = {69--83} 27129} 27130 27131@InProceedings{ fahlman.lebiere:cascade-correlation, 27132 author = {S. E. Fahlman and C. Lebiere}, 27133 title = {The cascade-correlation learning architecture}, 27134 booktitle = {Advances in Neural Information Processing Systems II {(Denver 1989)}}, 27135 year = {1990}, 27136 editor = {D. S. Touretzky}, 27137 publisher = {Morgan Kaufmann}, 27138 address = {San Mateo, California}, 27139 pages = {524--532} 27140} 27141 27142@InProceedings{ fang.geiser.ea:software, 27143 author = {G. Fang and B. Geiser and T. R. Mackie}, 27144 title = {Software system for {UW}/{GE} tomotherapy prototype}, 27145 booktitle = {Proceedings of the XII International Conference on the Use of Computers in 27146 Radiation Therapy, Salt Lake City}, 27147 year = {1997}, 27148 editor = {D. D. Leavitt and G. Starkshall}, 27149 publisher = {Medical Physics Publishing}, 27150 address = {St. Louis, Missouri}, 27151 pages = {332--334} 27152} 27153 27154@Book{ fang.puthenpura:linear, 27155 author = {S.--C. Fang and S. Puthenpura}, 27156 title = {Linear Optimization and Extensions}, 27157 year = {1993}, 27158 publisher = {Prentice-Hall, Inc}, 27159 address = {Englewood Cliffs, New Jersey} 27160} 27161 27162@Article{ fayard.plateau:algorithm, 27163 author = {D. Fayard and G. Plateau}, 27164 title = {An Algorithm for the Solution of the 0--1 Knapsack Problem}, 27165 journal = {Computing}, 27166 year = {1982}, 27167 volume = {28}, 27168 pages = {269--287} 27169} 27170 27171@Book{ feller:introduction, 27172 author = {W. Feller}, 27173 title = {An Introduction to Probability Theory and its Applications}, 27174 publisher = {John Wiley \& Sons}, 27175 year = {1968}, 27176 address = {New York} 27177} 27178 27179@Article{ ferris.fourer.ea:expressing, 27180 author = {M. C. Ferris and R. Fourer and D. M. Gay}, 27181 title = {Expressing Complementarity Problems and Communicating them to Solvers}, 27182 journal = {SIAM Journal on Optimization}, 27183 volume = {9}, 27184 pages = {991--1009}, 27185 year = {1999}, 27186 url = {ftp://ftp.cs.wisc.edu/math-prog/tech-reports/98-02.ps}, 27187 key = {65}, 27188 institution = {Computer Sciences Department, University of Wisconsin}, 27189 address = {Madison, Wisconsin}, 27190 number = {98-02}, 27191 type = {Mathematical Programming Technical Report} 27192} 27193 27194@TechReport{ ferris.horn:nlp2mcp, 27195 author = {M. C. Ferris and J. D. Horn}, 27196 title = {{NLP2MCP}: Automatic conversion of nonlinear programs into mixed complementarity 27197 problems}, 27198 year = {1998}, 27199 institution = {Computer Sciences Department, University of Wisconsin}, 27200 note = {In preparation} 27201} 27202 27203@Article{ ferris.horn:partitioning, 27204 author = {M. C. Ferris and J. D. Horn}, 27205 title = {Partitioning Mathematical Programs for Parallel Solution}, 27206 year = {1998}, 27207 volume = {80}, 27208 pages = {35--62}, 27209 url = {ftp: //ftp.cs.wisc.edu/math-prog/tech-reports/tr1232.ps}, 27210 journal = {Mathematical Programming}, 27211 key = {40} 27212} 27213 27214@Article{ ferris.kanzow.ea:feasible, 27215 author = {M. C. Ferris and C. Kanzow and T. S. Munson}, 27216 title = {Feasible Descent Algorithms for Mixed Complementarity Problems}, 27217 year = {1999}, 27218 journal = {Mathematical Programming}, 27219 volume = {86}, 27220 pages = {475--497}, 27221 url = {ftp://ftp.cs.wisc.edu/math-prog/tech-reports/98-04.ps}, 27222 key = {67} 27223} 27224 27225@InCollection{ ferris.kanzow:complementarity, 27226 author = {M. C. Ferris and C. Kanzow}, 27227 title = {Complementarity and Related Problems: {A} Survey}, 27228 booktitle = {Handbook of Applied Optimization, forthcoming}, 27229 key = {74}, 27230 publisher = {Oxford University Press}, 27231 year = {2000}, 27232 editor = {P. M. Pardalos and M. G. C. Resende}, 27233 url = {ftp://ftp.cs.wisc.edu/math-prog/tech-reports/98-17.ps}, 27234 institution = {Computer Sciences Department, University of Wisconsin}, 27235 address = {Madison, Wisconsin}, 27236 number = {98-17}, 27237 type = {Mathematical Programming Technical Report} 27238} 27239 27240@Article{ ferris.lucidi.ea:nonmonotone, 27241 author = {M. C. Ferris and S. Lucidi and M. Roma}, 27242 title = {Nonmonotone Curvilinear Stabilization Techniques for Unconstrained Optimization}, 27243 journal = {Computational Optimization and Applications}, 27244 volume = {6}, 27245 pages = {117--136}, 27246 year = {1996}, 27247 url = {ftp: //ftp.cs.wisc.edu/math-prog/tech-reports/94-16.ps}, 27248 key = {43} 27249} 27250 27251@TechReport{ ferris.lucidi:globally, 27252 author = {M. C. Ferris and S. Lucidi}, 27253 title = {Globally Convergent Methods for Nonlinear Equations}, 27254 institution = {Computer Sciences Department, University of Wisconsin}, 27255 year = {1991}, 27256 address = {Madison, Wisconsin}, 27257 number = {1030}, 27258 url = {ftp: //ftp.cs.wisc.edu/tech-reports/reports/1991/tr1030.ps}, 27259 key = {21} 27260} 27261 27262@Article{ ferris.lucidi:nonmonotone, 27263 author = {M. C. Ferris and S. Lucidi}, 27264 title = {Nonmonotone Stabilization Methods for Nonlinear Equations}, 27265 journal = {Journal of Optimization Theory and Applications}, 27266 year = {1994}, 27267 volume = {81}, 27268 pages = {53--71}, 27269 key = {30} 27270} 27271 27272@Article{ ferris.mangasarian:breast, 27273 author = {M. C. Ferris and O. L. Mangasarian}, 27274 title = {Breast Cancer Diagnosis via Linear Programming}, 27275 key = {50}, 27276 journal = {{IEEE} Computational Science and Engineering}, 27277 year = {1995}, 27278 volume = {2}, 27279 pages = {70--71} 27280} 27281 27282@Article{ ferris.mangasarian:error, 27283 author = {M. C. Ferris and O. L. Mangasarian}, 27284 title = {Error Bounds and Strong Upper Semicontinuity for Monotone Affine Variational 27285 Inequalities}, 27286 journal = {Annals of Operations Research}, 27287 year = {1993}, 27288 volume = {47}, 27289 pages = {293--305}, 27290 url = {ftp://ftp.cs.wisc.edu/tech-reports/reports/1991/tr1056a.ps}, 27291 key = {24} 27292} 27293 27294@Article{ ferris.mangasarian:finite, 27295 author = {M. C. Ferris and O. L. Mangasarian}, 27296 title = {Finite Perturbation of Convex Programs}, 27297 journal = {Applied Mathematics and Optimization}, 27298 year = {1991}, 27299 volume = {23}, 27300 pages = {263--273}, 27301 key = {08} 27302} 27303 27304@Book{ ferris.mangasarian:linear, 27305 author = {M. C. Ferris and O. L. Mangasarian}, 27306 title = {Linear Programming via {MATLAB}}, 27307 publisher = {in preparation}, 27308 year = {1995}, 27309 address = {Madison, Wisconsin} 27310} 27311 27312@Article{ ferris.mangasarian:minimum, 27313 author = {M. C. Ferris and O. L. Mangasarian}, 27314 title = {Minimum Principle Sufficiency}, 27315 journal = {Mathematical Programming}, 27316 year = {1992}, 27317 volume = {57}, 27318 pages = {1--14}, 27319 key = {11} 27320} 27321 27322@Article{ ferris.mangasarian:parallel, 27323 author = {M. C. Ferris and O. L. Mangasarian}, 27324 title = {Parallel Constraint Distribution}, 27325 journal = {SIAM Journal on Optimization}, 27326 year = {1991}, 27327 volume = {1}, 27328 pages = {487--500}, 27329 url = {ftp://ftp.cs.wisc.edu/tech-reports/reports/1990/tr971a.ps}, 27330 key = {18} 27331} 27332 27333@Article{ ferris.mangasarian:parallel*1, 27334 author = {M. C. Ferris and O. L. Mangasarian}, 27335 title = {Parallel Variable Distribution}, 27336 journal = {SIAM Journal on Optimization}, 27337 year = {1994}, 27338 volume = {4}, 27339 pages = {815--832}, 27340 url = {ftp://ftp.cs.wisc.edu/tech-reports/reports/1993/tr1175.ps}, 27341 key = {31} 27342} 27343 27344@Article{ ferris.meeraus.ea:computing, 27345 title = {Computing {W}ardropian Equilibrium in a Complementarity Framework}, 27346 author = {M. C. Ferris and A. Meeraus and T. F. Rutherford}, 27347 journal = {Optimization Methods and Software}, 27348 year = {1999}, 27349 volume = {10}, 27350 pages = {669--685}, 27351 url = {ftp://ftp.cs.wisc.edu/math-prog/tech-reports/95-03.ps}, 27352 key = {45} 27353} 27354 27355@Article{ ferris.mesnier.ea:neos, 27356 author = {M. C. Ferris and M. P. Mesnier and J. Mor\'{e}}, 27357 title = {{NEOS} and {C}ondor: Solving Nonlinear Optimization Problems over the 27358 {I}nternet}, 27359 year = {2000}, 27360 journal = {{ACM} Transactions on Mathematical Software}, 27361 key = {54}, 27362 volume = {26}, 27363 pages = {1--18}, 27364 url = {ftp://ftp.cs.wisc.edu/math-prog/tech-reports/96-08.ps}, 27365 institution = {Computer Sciences Department, University of Wisconsin}, 27366 address = {Madison, Wisconsin}, 27367 number = {96-08}, 27368 type = {Mathematical Programming Technical Report}, 27369 note = {Also available as ANL/MCS-P708-0398, Mathematics and Computer Science Division, 27370 Argonne National Laboratory}, 27371 annote = {Revised version of: The {NEOS} System for Complementarity Problems: {PATH}, 27372 1996} 27373} 27374 27375@InCollection{ ferris.meyer:models, 27376 author = {M. C. Ferris and R. R. Meyer}, 27377 title = {Models and Solution for On-Demand Data Delivery Problems}, 27378 url = {ftp://ftp.cs.wisc.edu/math-prog/tech-reports/99-04.ps}, 27379 key = {80}, 27380 booktitle = {Approximation and Complexity in Numerical Optimization: Continuous and Discrete 27381 Problems}, 27382 editor = {P. M. Pardalos}, 27383 series = {Nonconvex Optimization and its Applications}, 27384 volume = {42}, 27385 address = {Dordrect}, 27386 year = {2000}, 27387 pages = {175--188}, 27388 publisher = {Kluwer}, 27389 type = {Mathematical Programming Technical Report}, 27390 institution = {Computer Sciences Department, University of Wisconsin}, 27391 number = {99-04} 27392} 27393 27394@InProceedings{ ferris.munson.ea:homotopy, 27395 author = {M. C. Ferris and T. S. Munson and D. Ralph}, 27396 title = {A Homotopy Method for Mixed Complementarity Problems based on the {PATH} Solver}, 27397 booktitle = {Numerical Analysis 1999}, 27398 key = {88}, 27399 year = {2000}, 27400 editor = {D. F. Griffiths and G. A. Watson}, 27401 series = {Research Notes in Mathematics}, 27402 url = {ftp://ftp.cs.wisc.edu/math-prog/tech-reports/99-09.ps}, 27403 address = {London}, 27404 pages = {143--167}, 27405 publisher = {Chapman and Hall}, 27406 institution = {Computer Sciences Department, University of Wisconsin}, 27407 number = {99-09}, 27408 type = {Mathematical Programming Technical Report} 27409} 27410 27411@TechReport{ ferris.munson.ea:practical, 27412 author = {M. C. Ferris and T. S. Munson and K. Sinapiromsaran}, 27413 title = {A Practical Approach to Sample-Path Simulation Optimization}, 27414 type = {Data Mining Institute Technical Report}, 27415 institution = {Computer Sciences Department, University of Wisconsin}, 27416 address = {Madison, Wisconsin}, 27417 year = {2000}, 27418 url = {ftp://ftp.cs.wisc.edu/pub/dmi/tech-reports/00-03.ps}, 27419 number = {00-03}, 27420 key = {92}, 27421 annote = {To appear in WSC 2000} 27422} 27423 27424@InCollection{ ferris.munson:case, 27425 author = {M. C. Ferris and T. S. Munson}, 27426 title = {Case Studies in Complementarity: Improving Model Formulation}, 27427 booktitle = {Ill--Posed Variational Problems and Regularization Techniques}, 27428 key = {73}, 27429 pages = {79--98}, 27430 publisher = {Springer Verlag}, 27431 year = {1999}, 27432 editor = {M. Th\'{e}ra and R. Tichatschke}, 27433 number = {477}, 27434 series = {Lecture Notes in Economics and Mathematical Systems}, 27435 address = {Berlin}, 27436 url = {ftp://ftp.cs.wisc.edu/math-prog/tech-reports/98-16.ps}, 27437 type = {Mathematical Programming Technical Report}, 27438 institution = {Computer Sciences Department, University of Wisconsin} 27439} 27440 27441@Article{ ferris.munson:complementarity, 27442 author = {M. C. Ferris and T. S. Munson}, 27443 title = {Complementarity Problems in {GAMS} and the {PATH} Solver}, 27444 year = {2000}, 27445 volume = {24}, 27446 pages = {165--188}, 27447 journal = {Journal of Economic Dynamics and Control}, 27448 url = {ftp://ftp.cs.wisc.edu/math-prog/tech-reports/98-12.ps}, 27449 key = {70}, 27450 type = {Mathematical Programming Technical Report}, 27451 institution = {Computer Sciences Department, University of Wisconsin}, 27452 address = {Madison, Wisconsin}, 27453 number = {98-12} 27454} 27455 27456@Misc{ ferris.munson:condor, 27457 author = {M. C. Ferris and T. S. Munson}, 27458 title = {Condor Modeling Language Interface}, 27459 organization = {Computer Sciences Department, University of Wisconsin}, 27460 address = {Madison, Wisconsin}, 27461 note = {ftp://ftp.cs.wisc.edu/math-prog/condor} 27462} 27463 27464@Manual{ ferris.munson:gams, 27465 author = {M. C. Ferris and T. S. Munson}, 27466 title = {{GAMS}/{PATH} User Guide: Version 4.3}, 27467 organization = {Department of Computer Sciences, University of Wisconsin, Madison} 27468} 27469 27470@Article{ ferris.munson:interfaces, 27471 author = {M. C. Ferris and T. S. Munson}, 27472 title = {Interfaces to {PATH} 3.0: Design, Implementation and Usage}, 27473 journal = {Computational Optimization and Applications}, 27474 volume = {12}, 27475 pages = {207--227}, 27476 year = {1999}, 27477 url = {ftp://ftp.cs.wisc.edu/math-prog/tech-reports/97-12.ps}, 27478 key = {63}, 27479 institution = {Computer Sciences Department, University of Wisconsin}, 27480 address = {Madison, Wisconsin}, 27481 number = {97-12}, 27482 type = {Mathematical Programming Technical Report} 27483} 27484 27485@TechReport{ ferris.munson:interior, 27486 author = {M. C. Ferris and T. S. Munson}, 27487 title = {Interior Point Methods for Massive Support Vector Machines}, 27488 institution = {Computer Sciences Department, University of Wisconsin}, 27489 year = {2000}, 27490 key = {94}, 27491 type = {Data Mining Institute Technical Report}, 27492 number = {00-05}, 27493 url = {ftp://ftp.cs.wisc.edu/pub/dmi/tech-reports/00-05.ps}, 27494 address = {Madison, Wisconsin}, 27495 annote = {Submitted to SIOPT} 27496} 27497 27498@Article{ ferris.munson:linear, 27499 author = {M. C. Ferris and T. S. Munson}, 27500 title = {Linear Programming for Emergency Broadcast Systems}, 27501 year = {1999}, 27502 journal = {{SIAG/OPT} Newsletter}, 27503 volume = {10}, 27504 pages = {6--8}, 27505 url = {ftp://ftp.cs.wisc.edu/math-prog/tech-reports/98-20.ps}, 27506 key = {76}, 27507 type = {Mathematical Programming Technical Report}, 27508 institution = {Computer Sciences Department, University of Wisconsin}, 27509 address = {Madison, Wisconsin}, 27510 number = {98-20} 27511} 27512 27513@Article{ ferris.munson:modeling, 27514 author = {M. C. Ferris and T. S. Munson}, 27515 title = {Modeling Languages and {C}ondor: Metacomputing for Optimization}, 27516 year = {2000}, 27517 journal = {Mathematical Programming}, 27518 volume = {88}, 27519 pages = {487--506}, 27520 url = {ftp://ftp.cs.wisc.edu/math-prog/tech-reports/98-13.ps}, 27521 key = {71}, 27522 type = {Mathematical Programming Technical Report}, 27523 institution = {Computer Sciences Department, University of Wisconsin}, 27524 address = {Madison, Wisconsin}, 27525 number = {98-13} 27526} 27527 27528@TechReport{ ferris.munson:preprocessing, 27529 author = {M. C. Ferris and T. S. Munson}, 27530 title = {Preprocessing Complementarity Problems}, 27531 type = {Mathematical Programming Technical Report}, 27532 institution = {Computer Sciences Department, University of Wisconsin}, 27533 address = {Madison, Wisconsin}, 27534 year = {1999}, 27535 url = {ftp://ftp.cs.wisc.edu/math-prog/tech-reports/99-07.ps}, 27536 number = {99-07}, 27537 key = {86}, 27538 annote = {Submitted to ICCP 99} 27539} 27540 27541@TechReport{ ferris.munson:semismooth, 27542 author = {M. C. Ferris and T. S. Munson}, 27543 title = {Semismooth Support Vector Machines}, 27544 institution = {Computer Sciences Department, University of Wisconsin}, 27545 year = {2000}, 27546 key = {97}, 27547 type = {Data Mining Institute Technical Report}, 27548 number = {00-09}, 27549 url = {ftp://ftp.cs.wisc.edu/pub/dmi/tech-reports/00-09.ps}, 27550 address = {Madison, Wisconsin}, 27551 annote = {Submitted to Math Prog B} 27552} 27553 27554@Article{ ferris.pang:engineering, 27555 author = {M. C. Ferris and J. S. Pang}, 27556 title = {Engineering and Economic Applications of Complementarity Problems}, 27557 year = {1997}, 27558 journal = {SIAM Review}, 27559 volume = {39}, 27560 pages = {669--713}, 27561 url = {http: //www.siam.org/journals/sirev/39-4/28596.html}, 27562 key = {46} 27563} 27564 27565@Article{ ferris.pang:nondegenerate, 27566 author = {M. C. Ferris and J. S. Pang}, 27567 title = {Nondegenerate Solutions and Related Concepts in Affine Variational Inequalities}, 27568 journal = {SIAM Journal on Control and Optimization}, 27569 year = {1996}, 27570 volume = {34}, 27571 pages = {244--263}, 27572 url = {ftp://ftp.cs.wisc.edu/tech-reports/reports/1994/tr1203.ps}, 27573 key = {35} 27574} 27575 27576@Article{ ferris.philpott:affine, 27577 author = {M. C. Ferris and A. B. Philpott}, 27578 title = {On Affine Scaling and Semi--Infinite Programming}, 27579 journal = {Mathematical Programming}, 27580 year = {1992}, 27581 volume = {56}, 27582 pages = {361--364}, 27583 key = {15} 27584} 27585 27586@Article{ ferris.philpott:interior, 27587 author = {M. C. Ferris and A. B. Philpott}, 27588 title = {An Interior Point Algorithm for Semi--Infinite Linear Programming}, 27589 journal = {Mathematical Programming}, 27590 year = {1989}, 27591 volume = {43}, 27592 pages = {257--276}, 27593 key = {04} 27594} 27595 27596@Article{ ferris.philpott:performance, 27597 author = {M. C. Ferris and A. B. Philpott}, 27598 title = {On the Performance of {K}armarkar's Algorithm}, 27599 journal = {Journal of the Operational Research Society}, 27600 year = {1988}, 27601 volume = {39}, 27602 pages = {257--270}, 27603 key = {03} 27604} 27605 27606@InCollection{ ferris.ralph:projected, 27607 author = {M. C. Ferris and D. Ralph}, 27608 title = {Projected Gradient Methods for Nonlinear Complementarity Problems via Normal 27609 Maps}, 27610 booktitle = {Recent Advances in Nonsmooth Optimization}, 27611 publisher = {World Scientific Publishers}, 27612 year = {1995}, 27613 pages = {57--87}, 27614 editor = {D. Du and L. Qi and R. Womersley}, 27615 url = {ftp://ftp.cs.wisc.edu/math-prog/tech-reports/94-08.ps}, 27616 key = {41} 27617} 27618 27619@Article{ ferris.ruszczynski:robust, 27620 author = {M. C. Ferris and A. Ruszczy{\'{n}}ski}, 27621 title = {Robust Path Choice and Vehicle Guidance in Networks with Failures}, 27622 year = {2000}, 27623 journal = {Networks}, 27624 volume = {35}, 27625 pages = {181--194}, 27626 url = {ftp://ftp.cs.wisc.edu/math-prog/tech-reports/97-04.ps}, 27627 key = {60} 27628} 27629 27630@InCollection{ ferris.rutherford:accessing, 27631 author = {M. C. Ferris and T. F. Rutherford}, 27632 title = {Accessing Realistic Complementarity Problems within {Matlab}}, 27633 booktitle = {Nonlinear Optimization and Applications}, 27634 key = {48}, 27635 url = {ftp://ftp.cs.wisc.edu/math-prog/tech-reports/95-10.ps}, 27636 editor = {G. Di Pillo and F. Giannessi}, 27637 year = {1996}, 27638 pages = {141--153}, 27639 publisher = {Plenum Press}, 27640 address = {New York} 27641} 27642 27643@InCollection{ ferris.shepard:optimizing, 27644 author = {M. C. Ferris and D. M. Shepard}, 27645 title = {Optimization of Gamma Knife Radiosurgery}, 27646 booktitle = {Discrete Mathematical Problems with Medical Applications, forthcoming}, 27647 editor = {D.-Z. Du and P. Pardolas and J. Wang}, 27648 publisher = {AMS}, 27649 year = {2000}, 27650 optseries = {DIMACS}, 27651 url = {ftp://ftp.cs.wisc.edu/pub/dmi/tech-reports/00-01.ps}, 27652 key = {91}, 27653 type = {Data Mining Institute Technical Report}, 27654 institution = {Computer Sciences Department, University of Wisconsin}, 27655 address = {Madison, Wisconsin}, 27656 number = {00-01} 27657} 27658 27659@InCollection{ ferris.sinapiromsaran:formulating, 27660 author = {M. C. Ferris and K. Sinapiromsaran}, 27661 title = {Formulating and Solving Nonlinear Programs as Mixed Complementarity Problems}, 27662 booktitle = {Optimization}, 27663 key = {77}, 27664 publisher = {Springer-Verlag}, 27665 year = {2000}, 27666 editor = {V.H. Nguyen and J. J. Strodiot and P. Tossings}, 27667 volume = {481}, 27668 series = {Lecture Notes in Economics and Mathematical Systems}, 27669 url = {ftp://ftp.cs.wisc.edu/math-prog/tech-reports/98-21.ps}, 27670 type = {Mathematical Programming Technical Report}, 27671 institution = {Computer Sciences Department, University of Wisconsin}, 27672 address = {Madison, Wisconsin}, 27673 number = {98-21} 27674} 27675 27676@Article{ ferris.tin-loi:limit, 27677 author = {M. C. Ferris and F. Tin-Loi}, 27678 title = {Limit Analysis of Frictional Block Assemblies as a Mathematical Program with 27679 Complementarity Constraints}, 27680 year = {2001}, 27681 url = {ftp://ftp.cs.wisc.edu/math-prog/tech-reports/99-01.ps}, 27682 key = {78}, 27683 journal = {International Journal of Mechanical Sciences}, 27684 pages = {209--224}, 27685 volume = {43}, 27686 type = {Mathematical Programming Technical Report}, 27687 institution = {Computer Sciences Department, University of Wisconsin}, 27688 address = {Madison, Wisconsin}, 27689 number = {99-01} 27690} 27691 27692@Article{ ferris.tin-loi:nonlinear, 27693 author = {M. C. Ferris and F. Tin-Loi}, 27694 title = {Nonlinear Programming Approach for a Class of Inverse Problems in 27695 Elastoplasticity}, 27696 year = {1998}, 27697 key = {64}, 27698 volume = {6}, 27699 pages = {857--870}, 27700 journal = {Structural Engineering and Mechanics} 27701} 27702 27703@Article{ ferris.tin-loi:solution, 27704 author = {M. C. Ferris and F. Tin-Loi}, 27705 title = {On the Solution of a Minimum Weight Elastoplastic Problem involving Displacement 27706 and Complementarity Constraints}, 27707 year = {1999}, 27708 journal = {Computer Methods in Applied Mechanics and Engineering}, 27709 volume = {174}, 27710 pages = {107--120}, 27711 url = {ftp://ftp.cs.wisc.edu/math-prog/tech-reports/minwt.ps}, 27712 key = {66} 27713} 27714 27715@Article{ ferris.vlach:scheduling, 27716 author = {M. C. Ferris and M. Vlach}, 27717 title = {Scheduling with Earliness and Tardiness Penalties}, 27718 journal = {Naval Research Logistics Quarterly}, 27719 year = {1992}, 27720 volume = {39}, 27721 pages = {229--245}, 27722 key = {13} 27723} 27724 27725@TechReport{ ferris.zavriev:linear, 27726 author = {M. C. Ferris and S. K Zavriev}, 27727 title = {The Linear Convergence of a Successive Linear Programming Algorithm}, 27728 institution = {Computer Sciences Department, University of Wisconsin}, 27729 year = {1996}, 27730 key = {56}, 27731 address = {Madison, Wisconsin}, 27732 type = {Mathematical Programming Technical Report}, 27733 number = {96--12}, 27734 url = {ftp://ftp.cs.wisc.edu/math-prog/tech-reports/96-12.ps} 27735} 27736 27737@Article{ ferris:finite, 27738 author = {M. C. Ferris}, 27739 title = {Finite Termination of the Proximal Point Algorithm}, 27740 journal = {Mathematical Programming}, 27741 year = {1991}, 27742 volume = {50}, 27743 pages = {359--366}, 27744 key = {06} 27745} 27746 27747@Article{ ferris:iterative, 27748 author = {M. C. Ferris}, 27749 title = {Iterative Linear Programming Solution of Convex Programs}, 27750 journal = {Journal of Optimization Theory and Applications}, 27751 year = {1990}, 27752 volume = {65}, 27753 pages = {53--65}, 27754 key = {07} 27755} 27756 27757@Article{ ferris:linear, 27758 author = {M. C. Ferris}, 27759 title = {The Linear Complementarity Problem}, 27760 journal = {Bulletin of the American Mathematical Society}, 27761 year = {1993}, 27762 volume = {28}, 27763 pages = {169--175}, 27764 key = {27} 27765} 27766 27767@MastersThesis{ ferris:linear*1, 27768 author = {M. C. Ferris}, 27769 title = {Linear Programming and Minimum Weight Design -- {A} Comparison of Methods for 27770 Solving a Class of Structural Optimization Problems}, 27771 year = {1985}, 27772 school = {University of Cambridge}, 27773 address = {England}, 27774 key = {01} 27775} 27776 27777@TechReport{ ferris:matlab, 27778 author = {M. C. Ferris}, 27779 title = {{MATLAB} and {GAMS}: Interfacing Optimization and Visualization Software}, 27780 institution = {Computer Sciences Department, University of Wisconsin}, 27781 year = {1998}, 27782 address = {Madison, Wisconsin}, 27783 type = {Mathematical Programming Technical Report}, 27784 url = {ftp://ftp.cs.wisc.edu/math-prog/tech-reports/98-19.ps}, 27785 number = {98-19}, 27786 key = {75} 27787} 27788 27789@Article{ ferris:parallel, 27790 author = {M. C. Ferris}, 27791 title = {Parallel Constraint Distribution for Convex Quadratic Programs}, 27792 journal = {Mathematics of Operations Research}, 27793 year = {1994}, 27794 volume = {19}, 27795 pages = {645--658}, 27796 url = {ftp://ftp.cs.wisc.edu/tech-reports/reports/1991/tr1009a.ps}, 27797 key = {20} 27798} 27799 27800@TechReport{ ferris:parallel*1, 27801 author = {M. C. Ferris}, 27802 title = {Parallel Solution of Extremely Large Knapsack Problems}, 27803 institution = {Computer Sciences Department, University of Wisconsin}, 27804 year = {1989}, 27805 address = {Madison, Wisconsin}, 27806 number = {842}, 27807 key = {09} 27808} 27809 27810@PhDThesis{ ferris:weak, 27811 author = {M. C. Ferris}, 27812 title = {Weak Sharp Minima and Penalty Functions in Mathematical Programming}, 27813 year = {1988}, 27814 school = {University of Cambridge}, 27815 address = {England}, 27816 key = {02} 27817} 27818 27819@TechReport{ ferris:weak*1, 27820 author = {M. C. Ferris}, 27821 title = {Weak Sharp Minima and Penalty Functions in Mathematical Programming}, 27822 institution = {Computer Sciences Department, University of Wisconsin}, 27823 year = {1988}, 27824 address = {Madison, Wisconsin}, 27825 number = {779}, 27826 key = {05} 27827} 27828 27829@Book{ fiacco.mccormick:nonlinear, 27830 author = {A. V. Fiacco and G. P. McCormick}, 27831 title = {Nonlinear Programming: Sequential Unconstrained Minimization Techniques}, 27832 year = {1968}, 27833 publisher = {John Wiley \& Sons}, 27834 address = {New York}, 27835 note = {SIAM Classics in Applied Mathematics 4, SIAM, Philadelphia, 1990} 27836} 27837 27838@Book{ fiacco:introduction, 27839 author = {A. V. Fiacco}, 27840 title = {Introduction to Sensitivity and Stability Analysis in Nonlinear Programming}, 27841 year = {1983}, 27842 publisher = {Academic Press}, 27843 address = {New York} 27844} 27845 27846@Article{ fiedler.ptak:matrices, 27847 author = {M. Fiedler and V. Pt\'{a}k}, 27848 title = {On matrices with nonpositive off-diagonal elements and positive principal 27849 minors}, 27850 journal = {Czechoslovak Mathematics Journal}, 27851 volume = {12}, 27852 pages = {382--400}, 27853 year = {1962} 27854} 27855 27856@Article{ fischer.kanzow:finite, 27857 author = {A. Fischer and C. Kanzow}, 27858 title = {On Finite Termination of an Iterative Method for Linear Complementarity 27859 Problems}, 27860 journal = {Mathematical Programming}, 27861 volume = {74}, 27862 pages = {279--292}, 27863 year = {1996} 27864} 27865 27866@TechReport{ fischer:constrained, 27867 author = {A. Fischer}, 27868 title = {A New Constrained Optimization Reformulation for Complementarity Problems}, 27869 institution = {Institute of Numerical Mathematics, Technical University of Dresden}, 27870 year = {1995}, 27871 type = {Technical Report}, 27872 number = {MATH-NM-10-1995}, 27873 address = {Dresden} 27874} 27875 27876@Article{ fischer:local, 27877 author = {A. Fischer}, 27878 title = {On the local superlinear convergence of a {N}ewton-type method for {LCP} under 27879 weak conditions}, 27880 journal = {Optimization Methods and Software}, 27881 year = {1995}, 27882 volume = {6}, 27883 pages = {83--107} 27884} 27885 27886@InCollection{ fischer:ncp-function, 27887 author = {A. Fischer}, 27888 title = {An {NCP}--Function and its Use for the Solution of Complementarity Problems}, 27889 booktitle = {Recent Advances in Nonsmooth Optimization}, 27890 publisher = {World Scientific Publishers}, 27891 editor = {D. Z. Du and L. Qi and R. S. Womersley}, 27892 year = {1995}, 27893 pages = {88--105} 27894} 27895 27896@Article{ fischer:newton-type, 27897 author = {A. Fischer}, 27898 title = {A {N}ewton-Type Method for Positive Semidefinite Linear Complementarity 27899 Problems}, 27900 journal = {Journal of Optimization Theory and Applications}, 27901 year = {1995}, 27902 volume = {86}, 27903 pages = {585--608} 27904} 27905 27906@Article{ fischer:solution, 27907 author = {A. Fischer}, 27908 title = {Solution of Monotone Complementarity Problems with Locally {L}ipschitzian 27909 Functions}, 27910 year = {1997}, 27911 journal = {Mathematical Programming}, 27912 pages = {513--532} 27913} 27914 27915@Article{ fischer:special, 27916 author = {A. Fischer}, 27917 title = {A Special {N}ewton--Type Optimization Method}, 27918 journal = {Optimization}, 27919 year = {1992}, 27920 volume = {24}, 27921 pages = {269--284} 27922} 27923 27924@Article{ fisher:use, 27925 author = {R. A. Fisher}, 27926 title = {The Use of Multiple Measurements in Taxonomic Problems}, 27927 journal = {Annual Eugenics}, 27928 year = {1936}, 27929 volume = {7}, 27930 number = {Part II}, 27931 pages = {179--188} 27932} 27933 27934@Book{ fishman:principles, 27935 author = {G. Fishman}, 27936 title = {Principles of Discrete Event Simulation}, 27937 publisher = {Wiley}, 27938 address = {New York, NY}, 27939 year = {1978} 27940} 27941 27942@Article{ fitchard.aldridge.ea:registration, 27943 author = {E. E. Fitchard and J. S. Aldridge and P. J. Reckwerdt and T. R. Mackie}, 27944 title = {Registration of Synthetic Tomographic Projection Data Sets Using 27945 Cross-Correlation}, 27946 journal = {Physics in Medicine and Biology}, 27947 year = {1998}, 27948 volume = {43}, 27949 pages = {1645--1657} 27950} 27951 27952@Article{ fletcher.matthews:stable, 27953 author = {R. Fletcher and S. P. J. Matthews}, 27954 title = {Stable Modifications of Explicit {LU} Factors for Simplex Updates}, 27955 journal = {Mathematical Programming}, 27956 year = {1984}, 27957 volume = {30}, 27958 pages = {267--284} 27959} 27960 27961@TechReport{ fletcher.maza:nonlinear, 27962 author = {R. Fletcher and E. Sainz de la Maza}, 27963 title = {Nonlinear Programming and Nonsmooth Optimization by Successive Linear 27964 Programming}, 27965 institution = {Department of Mathematical Sciences}, 27966 year = {1987}, 27967 address = {The University, Dundee, Scotland}, 27968 number = {NA/100}, 27969 type = {Numerical Analysis Report} 27970} 27971 27972@InCollection{ fletcher:class, 27973 author = {R. Fletcher}, 27974 title = {A Class of Methods for Nonlinear Programming with Termination and Convergence 27975 Properties}, 27976 booktitle = {Integer and Nonlinear Programming}, 27977 year = {1970}, 27978 editor = {J. Abadie}, 27979 publisher = {North--Holland}, 27980 address = {Amsterdam}, 27981 pages = {157--173} 27982} 27983 27984@Article{ fletcher:exact, 27985 author = {R. Fletcher}, 27986 title = {An Exact Penalty Function for Nonlinear Programming with Inequalities}, 27987 journal = {Mathematical Programming}, 27988 year = {1973}, 27989 volume = {5}, 27990 pages = {129--150} 27991} 27992 27993@Article{ fletcher:generalized, 27994 author = {R. Fletcher}, 27995 title = {Generalized Inverse Methods for the Best Least Squares Solution of Non--Linear 27996 Equations}, 27997 journal = {The Computer Journal}, 27998 year = {1968}, 27999 volume = {10}, 28000 pages = {392--399} 28001} 28002 28003@InProceedings{ fletcher:penalty, 28004 crossref = {bachem.grotschel.ea:mathematical}, 28005 author = {R. Fletcher}, 28006 title = {Penalty Functions}, 28007 pages = {87--114} 28008} 28009 28010@Book{ fletcher:practical, 28011 author = {R. Fletcher}, 28012 title = {Practical Methods of Optimization}, 28013 year = {1981}, 28014 publisher = {John Wiley \& Sons}, 28015 address = {Chichester}, 28016 volume = {1} 28017} 28018 28019@Book{ fletcher:practical*1, 28020 author = {R. Fletcher}, 28021 title = {Practical Methods of Optimization}, 28022 year = {1981}, 28023 publisher = {John Wiley \& Sons}, 28024 address = {Chichester}, 28025 volume = {2} 28026} 28027 28028@Book{ fletcher:practical*2, 28029 author = {R. Fletcher}, 28030 title = {Practical Methods of Optimization}, 28031 year = {1987}, 28032 publisher = {John Wiley \& Sons}, 28033 address = {New York}, 28034 edition = {second} 28035} 28036 28037@Unpublished{ fletcher:recent, 28038 author = {R. Fletcher}, 28039 title = {Recent Developments in Nonlinear Programming}, 28040 note = {Presentation at SOR 96, Braunchweig, Germany}, 28041 year = {1996} 28042} 28043 28044@InCollection{ fletcher:second, 28045 author = {R. Fletcher}, 28046 title = {Second Order Correction for Nondifferentiable Optimization}, 28047 booktitle = {Numerical Analysis}, 28048 year = {1982}, 28049 editor = {G. A. Watson}, 28050 publisher = {Springer-Verlag}, 28051 address = {Berlin}, 28052 pages = {85--114} 28053} 28054 28055@InCollection{ florian:mathematical, 28056 author = {M. Florian}, 28057 title = {Mathematical programming applications in national, regional, and urban planning}, 28058 editors = {M. Iri and K. Tanabe}, 28059 booktitle = {Mathematical Programming: Recent Developments and Applications}, 28060 publisher = {Kluwer Academic Publishers}, 28061 address = {Tokyo}, 28062 year = {1989} 28063} 28064 28065@Article{ florian:nonlinear, 28066 author = {M. Florian}, 28067 title = {Nonlinear Cost Network Models in Transportation Analysis}, 28068 journal = {Mathematical Programming Study}, 28069 year = {1986}, 28070 volume = {26}, 28071 pages = {167--196} 28072} 28073 28074@Article{ flynn:computer, 28075 author = {M.~J. Flynn}, 28076 title = {Some Computer Organizations and their Effectiveness}, 28077 journal = {IEEE Transactions on Computers}, 28078 year = {1972}, 28079 volume = {C-21}, 28080 pages = {948--960} 28081} 28082 28083@InProceedings{ fogarty:varying, 28084 crossref = {schaeffer:third}, 28085 author = {T. C. Fogarty}, 28086 title = {Varying the Probability of Mutation in the Genetic Algorithm}, 28087 pages = {422--427} 28088} 28089 28090@Article{ forrest.goldfarb:steepest-edge, 28091 author = {J. J. Forrest and D. Goldfarb}, 28092 title = {Steepest--Edge Simplex Algorithms for Linear Programming}, 28093 journal = {Mathematical Programming}, 28094 year = {1992}, 28095 volume = {57}, 28096 pages = {341--374} 28097} 28098 28099@Article{ forrest.tomlin:updating, 28100 author = {J. J. H. Forrest and J. A. Tomlin}, 28101 title = {Updating Triangular Factors of the Basis to Maintain Sparsity in the Product Form 28102 Simplex Method}, 28103 journal = {Mathematical Programming}, 28104 year = {1972}, 28105 volume = {2}, 28106 pages = {263--278} 28107} 28108 28109@TechReport{ forsgren.gill.ea:computing, 28110 author = {A. Forsgren and P. E. Gill and W. Murray}, 28111 title = {Computing Modified {N}ewton Directions using a Partial {C}holesky Factorization}, 28112 institution = {Department of Mathematics, Royal Institute of Technology}, 28113 year = {1993}, 28114 number = {TRITA-MAT-1993-9}, 28115 address = {Stockholm, Sweden} 28116} 28117 28118@TechReport{ forsgren.gill:primal-dual, 28119 author = {A. Forsgren and P. E. Gill}, 28120 title = {Primal-Dual Interior Methods for Nonconvex Nonlinear Programming}, 28121 institution = {Department of Mathematics, University of California}, 28122 year = {1996}, 28123 type = {Report NA}, 28124 number = {96-3}, 28125 address = {San Diego} 28126} 28127 28128@InCollection{ fortin.glowinski:decomposition-coordination, 28129 author = {M. Fortin and R. Glowinski}, 28130 title = {On Decomposition-Coordination Methods Using an Augmented Lagrangian}, 28131 booktitle = {Augmented Lagrangian methods: Applications to the Solution of Boundary Value 28132 Problems}, 28133 publisher = {North-Holland}, 28134 year = {1983}, 28135 editor = {M. Fortin and R. Glowinski}, 28136 address = {Amsterdam} 28137} 28138 28139@Misc{ foster.kesselman:globus, 28140 author = {I. Foster and C. Kesselman}, 28141 title = {The Globus Project}, 28142 howpublished = {www.globus.org} 28143} 28144 28145@Article{ foster.kesselman:globus*1, 28146 author = {I. Foster and C. Kesselman}, 28147 title = {Globus: A Metacomputing Infrastructure Toolkit}, 28148 journal = {International Journal of Supercomputer Applications}, 28149 volume = {11}, 28150 pages = {115--128}, 28151 year = {1997} 28152} 28153 28154@Book{ foster.kesselman:grid, 28155 editor = {I. Foster and C. Kesselman}, 28156 title = {The Grid: Blueprint for a Future Computing Infrastructure}, 28157 publisher = {Morgan Kaufmann Publishers}, 28158 year = {1999} 28159} 28160 28161@Book{ fourer.gay.ea:ampl, 28162 author = {R. Fourer and D. M. Gay and B. W. Kernighan}, 28163 title = {{AMPL}: {A} Modeling Language for Mathematical Programming}, 28164 year = {1993}, 28165 publisher = {Duxbury Press} 28166} 28167 28168@Article{ fourer.gay.ea:modeling, 28169 author = {R. Fourer and D. M. Gay and B. W. Kernighan}, 28170 title = {A Modeling Language for Mathematical Programming}, 28171 journal = {Management Science}, 28172 year = {1990}, 28173 volume = {36}, 28174 pages = {519--554} 28175} 28176 28177@Article{ fraass:development, 28178 author = {A. Fraass}, 28179 title = {The development of conformal radiation therapy}, 28180 journal = {Medical Physics}, 28181 year = {1995}, 28182 volume = {22}, 28183 number = {11}, 28184 pages = {1911--1921} 28185} 28186 28187@TechReport{ fraley:algorithms, 28188 author = {C. Fraley}, 28189 title = {Algorithms for Nonlinear Least Squares}, 28190 institution = {Stanford University}, 28191 year = {1988}, 28192 number = {{SOL} 88.16}, 28193 type = {Technical Report} 28194} 28195 28196@InCollection{ francois.mcdonald.ea:uruguay, 28197 author = {J. F. Francois and B. McDonald and H. Nordstrom}, 28198 title = {The {U}ruguay Round: {A} Numerically Based Qualitative Assessment}, 28199 booktitle = {The {U}ruguay Round and the Developing Economies}, 28200 address = {New York}, 28201 editors = {W. Martin and L. A. Winters}, 28202 publisher = {Cambridge University Press} 28203} 28204 28205@InCollection{ francois.mcdonald.ea:uruguay*1, 28206 author = {J. F. Francois and B. McDonald and H. Nordstrom}, 28207 title = {The {U}ruguay Round: {A} Global Analysis}, 28208 booktitle = {Challenges and Opportunities for East Asian Trade}, 28209 address = {Cambridge}, 28210 editors = {D. Robertson}, 28211 publisher = {Cambridge University Press} 28212} 28213 28214@Article{ frank.wolfe:algorithm, 28215 author = {M. Frank and P. Wolfe}, 28216 title = {An Algorithm for Quadratic Programming}, 28217 journal = {Naval Research Logistics Quarterly}, 28218 year = {1956}, 28219 volume = {3}, 28220 pages = {95--110} 28221} 28222 28223@Article{ freund.nachtigal:qmrpack, 28224 author = {R. W. Freund and N. M. Nachtigal}, 28225 title = {{QMRPACK}: {A} Package of {QMR} Algorithms}, 28226 journal = {{ACM} Transactions on Mathematical Software}, 28227 year = {1996}, 28228 volume = {22}, 28229 pages = {46--77} 28230} 28231 28232@InProceedings{ freund.schapire:experiments, 28233 author = {Y. Freund and R. E. Schapire}, 28234 title = {Experiments with a New Boosting Algorithm}, 28235 booktitle = {Machine Learning: Proceedings of the Thirteenth National Conference}, 28236 pages = {148--156}, 28237 year = {1996}, 28238 editor = {L. Saitta}, 28239 publisher = {Morgan Kaufmann} 28240} 28241 28242@Unpublished{ freund.todd:barrier, 28243 author = {Robert M. Freund and Michael J. Todd}, 28244 title = {Barrier functions and interior-point algorithms for linear programming with 28245 zero-, one-, or two-sided bounds on the variables}, 28246 year = {1992}, 28247 month = jul 28248} 28249 28250@Article{ friedman.chernina:iterative, 28251 author = {V. M. Friedman and V. S. Chernina}, 28252 title = {Iterative Methods Applied to the Solution of Contact Problems Between Bodies}, 28253 note = {In Russian}, 28254 journal = {Mekhanika Tvergodo Tela Academia Nauk SSSR}, 28255 volume = {1}, 28256 pages = {116--120}, 28257 year = {1967} 28258} 28259 28260@Article{ friesz.bernstein.ea:day-to-day, 28261 author = {T. L. Friesz and D. Bernstein and N. J. Mehta and R. L. Tobin and S. 28262 Ganjalizadeh}, 28263 title = {Day-to-day Dynamic Network Disequilibria and Idealized Traveller Information 28264 Systems}, 28265 journal = {Operations Research}, 28266 year = {1994}, 28267 volume = {42}, 28268 pages = {1120--1136} 28269} 28270 28271@Article{ friesz.tobin.ea:nonlinear, 28272 author = {T. L. Friesz and R. L. Tobin and T. E. Smith and P. T. Harker}, 28273 title = {A Nonlinear Complementarity Formulation and Solution Procedure for the General 28274 Derived Demand Network Equilibrium Problem}, 28275 journal = {Journal of Regional Science}, 28276 year = {1983}, 28277 volume = {23}, 28278 pages = {337--359} 28279} 28280 28281@Article{ friesz:network, 28282 author = {T. L. Friesz}, 28283 title = {Network Equilibrium, Design and Aggregation}, 28284 journal = {Transportation Research}, 28285 volume = {19A}, 28286 year = {1985}, 28287 pages = {413--427} 28288} 28289 28290@Unpublished{ frisch:logarithmic, 28291 author = {K. R. Frisch}, 28292 title = {The Logarithmic Potential Method of Convex Programming}, 28293 year = {1955}, 28294 note = {Unpublished manuscript, University Institute of Economics, Oslo} 28295} 28296 28297@Book{ fukunaga:statistical, 28298 author = {K. Fukunaga}, 28299 title = {Statistical Pattern Recognition}, 28300 year = {1990}, 28301 publisher = {Academic Press}, 28302 address = {New York} 28303} 28304 28305@Article{ fukushima.luo.ea:globally, 28306 author = {M. Fukushima and Z.--Q. Luo and J. S. Pang}, 28307 title = {A Globally Convergent Sequential Quadratic Programming Algorithm for Mathematical 28308 Programs with Linear Complementarity Constraints}, 28309 journal = {Computational Optimization and Applications}, 28310 year = {1998}, 28311 volume = {10}, 28312 pages = {5--34} 28313} 28314 28315@Article{ fukushima:equivalent, 28316 author = {M. Fukushima}, 28317 title = {Equivalent Differentiable Optimization Problems and Descent Methods for 28318 Asymmetric Variational Inequality Problems}, 28319 journal = {Mathematical Programming}, 28320 year = {1992}, 28321 volume = {53}, 28322 pages = {99--110} 28323} 28324 28325@Article{ fukushima:primal, 28326 author = {M. Fukushima}, 28327 title = {The Primal {D}ouglas-{R}achford Splitting Algorithm for a Class of Monotone 28328 Mappings with Application to the Traffic Equilibrium Problem}, 28329 journal = {Mathematical Programming}, 28330 year = {1996}, 28331 volume = {72}, 28332 pages = {1--15} 28333} 28334 28335@Article{ gabay.mercier:dual, 28336 author = {D. Gabay and B. Mercier}, 28337 title = {A Dual Algorithm for the Solution of Nonlinear Variational Inequalities via 28338 Finite Element Approximations}, 28339 journal = {Computational Mathematics and Applications}, 28340 year = {1976}, 28341 volume = {2}, 28342 pages = {17--48} 28343} 28344 28345@InCollection{ gabay:applications, 28346 author = {D. Gabay}, 28347 title = {Applications of the Method of Multipliers to Variational Inequalities}, 28348 booktitle = {Augmented {L}agrangian Methods: Applications to the Solution of Boundary Value 28349 Problems}, 28350 publisher = {North-Holland}, 28351 year = {1983}, 28352 editor = {M. Fortin and R. Glowinski}, 28353 address = {Amsterdam} 28354} 28355 28356@Unpublished{ gabriel.bernstein:path, 28357 author = {S. A. Gabriel and D. Berstein}, 28358 title = {A Path Generation Method for the Nonadditive, Asymmetric, Elastic Traffic 28359 Equilibrium Problem}, 28360 note = {Draft, 1995} 28361} 28362 28363@TechReport{ gabriel.kydes:nonlinear, 28364 author = {S. A. Gabriel and A. S. Kydes}, 28365 title = {A Nonlinear Complementarity Approach for Solving the National Energy Modeling 28366 System}, 28367 institution = {Mathematics and Computer Science Division, Argonne National Laboratory}, 28368 year = {1995}, 28369 type = {Preprint}, 28370 number = {MCS-P504-0395}, 28371 address = {Argonne, Illinois}, 28372 month = mar 28373} 28374 28375@InProceedings{ gabriel.more:smoothing, 28376 crossref = {ferris.pang:complementarity}, 28377 author = {S. A. Gabriel and J. J. Mor\'{e}}, 28378 title = {Smoothing of Mixed Complementarity Problems} 28379} 28380 28381@Article{ gabriel.pang:inexact, 28382 author = {S. A. Gabriel and J. S. Pang}, 28383 title = {An Inexact {NE/SQP} Method for Solving the Nonlinear Complementarity Problem}, 28384 journal = {Computational Optimization and Applications}, 28385 year = {1992}, 28386 volume = {1}, 28387 pages = {67--91} 28388} 28389 28390@InCollection{ gabriel.pang:trust, 28391 author = {S. A. Gabriel and J. S. Pang}, 28392 title = {A Trust Region Method for Constrained Nonsmooth Equations}, 28393 booktitle = {Large--Scale Optimization: State of the Art}, 28394 publisher = {Kluwer Academic Publishers}, 28395 year = {1994}, 28396 editor = {W. W. Hager and D. W. Hearn and P. M. Pardalos}, 28397 pages = {159--186} 28398} 28399 28400@PhDThesis{ gabriel:algorithms, 28401 author = {S. A. Gabriel}, 28402 title = {Algorithms for the Nonlinear Complementarity Problem: The {NE}/{SQP} Method and 28403 Extensions}, 28404 school = {The Johns Hopkins University}, 28405 year = {1992}, 28406 address = {Baltimore, Maryland} 28407} 28408 28409@Article{ gafni.bertsekas:two-metric, 28410 author = {E. M. Gafni and D. P. Bertsekas}, 28411 title = {Two-Metric Projection Methods for Constrained Optimization}, 28412 journal = {SIAM Journal on Control and Optimization}, 28413 year = {1984}, 28414 volume = {22}, 28415 pages = {936--964} 28416} 28417 28418@InProceedings{ gaivoronski:convergence, 28419 author = {A. A. Gaivoronski}, 28420 title = {Convergence of Parallel Backpropagation for Neural Networks}, 28421 booktitle = {SIAM Journal on Optimization}, 28422 year = {1994}, 28423 note = {Proceedings of Symposium on Parallel Optimization 3, Madison July 7-9, 1993, 28424 submitted} 28425} 28426 28427@Misc{ gaivoronski:private, 28428 author = {A. A. Gaivoronski}, 28429 title = {Private Communication}, 28430 year = {1992}, 28431 month = nov, 28432 address = {ITALTEL, Milan} 28433} 28434 28435@Book{ gale:theory, 28436 author = {D. Gale}, 28437 title = {The Theory of Linear Economic Models}, 28438 year = {1960}, 28439 publisher = {McGraw-Hill Book Company}, 28440 address = {New York} 28441} 28442 28443@Book{ gallant:neural, 28444 author = {S. I. Gallant}, 28445 title = {Neural Network Learning and Expert Systems}, 28446 year = {1993}, 28447 publisher = {MIT Press}, 28448 address = {Cambridge, Massachusetts} 28449} 28450 28451@InProceedings{ ganti.gehrke.ea:framework, 28452 author = {V. Ganti and J. Gehrke and R. Ramakrishnan}, 28453 title = {A Framework for Measuring Changes in Data Characteristics}, 28454 booktitle = {Proceedings of the Eighteenth ACM SIGACT-SIGMOD-SIGART Symposium on Principles of 28455 Database Systems, May 31 - June 2, 1999, Philadelphia, Pennsylvania}, 28456 publisher = {ACM Press}, 28457 year = {1999}, 28458 isbn = {1-58113-062-7}, 28459 pages = {126--137} 28460} 28461 28462@Book{ ganz:gamma, 28463 author = {J. C. Ganz}, 28464 title = {Gamma Knife Surgery}, 28465 publisher = {Springer-Verlag Wien}, 28466 year = {1997}, 28467 address = {Austria} 28468} 28469 28470@TechReport{ gao:nonlinear, 28471 author = {Y. Gao}, 28472 title = {Nonlinear Complementarity Problems in Large Deformed Beam Subject to Unilateral 28473 Conditions}, 28474 type = {Manuscript}, 28475 institution = {Department of Mathematics, Virginia Polytechnic Institute and State University}, 28476 month = oct, 28477 year = {1994} 28478} 28479 28480@Article{ garcia-palomares.mangasarian:superlinearly, 28481 author = {U. M. {Garcia--Palomares} and O. L. Mangasarian}, 28482 title = {Superlinearly Convergent {Q}uasi--{N}ewton Algorithms for Nonlinearly Constrained 28483 Optimization Problems}, 28484 journal = {Mathematical Programming}, 28485 year = {1976}, 28486 volume = {11}, 28487 pages = {1--13} 28488} 28489 28490@Article{ garcia-palomares.restuccia:global, 28491 author = {U. M. {Garcia--Palomares} and A. Restuccia}, 28492 title = {A Global Quadratic Algorithm for Solving a System of Mixed Equations}, 28493 journal = {Mathematical Programming}, 28494 year = {1981}, 28495 volume = {21}, 28496 pages = {290--300} 28497} 28498 28499@InProceedings{ garcia-palomares:superlinearly, 28500 author = {U. M. {Garcia--Palomares}}, 28501 title = {Superlinearly Convergent Algorithms for Linearly Constrained Optimization}, 28502 crossref = {mangasarian.meyer.ea:nonlinear*2}, 28503 pages = {101--119} 28504} 28505 28506@Article{ garcia.gould:theorem, 28507 author = {C. B. Garcia and F. J. Gould}, 28508 title = {A Theorem on Homotopy Paths}, 28509 journal = {Mathematics of Operations Research}, 28510 year = {1978}, 28511 volume = {3}, 28512 pages = {282--289} 28513} 28514 28515@Book{ garcia.zangwill:pathways, 28516 author = {C. B. Garcia and W. I. Zangwill}, 28517 title = {Pathways to Solutions, Fixed Points, and Equilibria}, 28518 year = {1981}, 28519 publisher = {Prentice-Hall, Inc}, 28520 address = {Englewood Cliffs, New Jersey} 28521} 28522 28523@Book{ garey.johnson:computers, 28524 author = {M. R. Garey and D. S. Johnson}, 28525 title = {Computers and Intractability, {A} Guide to the Theory of {NP}--Completeness}, 28526 year = {1979}, 28527 publisher = {W.H. Freeman and Company}, 28528 address = {San Francisco} 28529} 28530 28531@Article{ garey.tarjan.ea:one-processor, 28532 author = {M. R. Garey and R. E. Tarjan and G. T. Wilfong}, 28533 title = {One--Processor Scheduling with Symmetric Earliness and Tardiness Penalties}, 28534 journal = {Mathematics of Operations Research}, 28535 year = {1988}, 28536 volume = {13}, 28537 pages = {330--348} 28538} 28539 28540@Book{ garfinkel.nemhauser:integer, 28541 author = {R. S. Garfinkel and G. L. Nemhauser}, 28542 title = {Integer Programming}, 28543 year = {1972}, 28544 publisher = {John Wiley \& Sons}, 28545 address = {New York} 28546} 28547 28548@Book{ gass:linear, 28549 author = {S. Gass}, 28550 title = {Linear Programming Methods and Applications}, 28551 edition = {Fifth}, 28552 publisher = {Boyd and Fraser Publishing Company}, 28553 address = {Danvers, Massachusetts}, 28554 year = {1985} 28555} 28556 28557@InProceedings{ gay:combining, 28558 author = {D. M. Gay}, 28559 title = {On Combining the Schemes of {R}eid and {S}aunders for Sparse {LP} Bases}, 28560 booktitle = {Sparse Matrix Proceedings 1978}, 28561 editor = {I. S. Duff and G. W. Stewart}, 28562 year = {1978}, 28563 organization = {SIAM}, 28564 address = {Philadelphia, Pennsylvania}, 28565 pages = {313--334} 28566} 28567 28568@Article{ gay:electronic, 28569 author = {D. M. Gay}, 28570 title = {Electronic Mail Distribution of Linear Programming Test Problems}, 28571 journal = {{COAL} Newsletter}, 28572 year = {1985}, 28573 volume = {13}, 28574 pages = {10--12} 28575} 28576 28577@TechReport{ gay:hooking, 28578 author = {D. M. Gay}, 28579 title = {Hooking Your Solver to {AMPL}}, 28580 year = {1997}, 28581 institution = {Bell Laboratories}, 28582 address = {Murray Hill, New Jersey}, 28583 note = {Revised 1994, 1997} 28584} 28585 28586@Article{ gay:variant, 28587 author = {D. Gay}, 28588 title = {A Variant of {K}armarkar's Linear Programming Algorithm for Problems in Standard 28589 Form}, 28590 journal = {Mathematical Programming}, 28591 year = {1987}, 28592 volume = {37}, 28593 pages = {81--90} 28594} 28595 28596@Article{ geiger.kanzow:resolution, 28597 author = {C. Geiger and C. Kanzow}, 28598 title = {On the Resolution of Monotone Complementarity Problems}, 28599 journal = {Computational Optimization and Applications}, 28600 volume = {5}, 28601 year = {1996}, 28602 pages = {155--173} 28603} 28604 28605@Book{ geist.beguelin.ea:pvm, 28606 author = {G. A. Geist and A. L. Beguelin and J. J. Dongarra and W. Jiang and R. Manchek and 28607 V. S. Sunderam}, 28608 title = {{PVM}: Parallel Virtual Machine}, 28609 publisher = {MIT Press}, 28610 address = {Cambridge, Massachusetts}, 28611 year = {1994} 28612} 28613 28614@Article{ gendron.crainic:parallel, 28615 author = {B. Gendron and T. G. Crainic}, 28616 title = {Parallel Branch-and-Bound Algorithms: Survey and Synthesis}, 28617 journal = {Operations Research}, 28618 year = {1994}, 28619 volume = {42}, 28620 pages = {1042--1060} 28621} 28622 28623@Article{ george:automatic, 28624 author = {A. George}, 28625 title = {An automatic one-way dissection algorithm for irregular finite-element problems}, 28626 journal = {SIAM Journal on Numerical Analysis}, 28627 vol = {17}, 28628 pages = {740--751}, 28629 year = {1980} 28630} 28631 28632@InProceedings{ georges-schleuter:asparagos, 28633 crossref = {schaeffer:third}, 28634 author = {M. Georges--Schleuter}, 28635 title = {Asparagos: An Asynchronous Parallel Genetic Algorithm}, 28636 pages = {416--421} 28637} 28638 28639@Article{ georgiou:comments, 28640 author = {G. M. Georgiou}, 28641 title = {Comments On Hidden Nodes in Neural Nets}, 28642 journal = {IEEE Transactions on Circuits and Systems}, 28643 year = {1991}, 28644 volume = {38}, 28645 pages = {1410} 28646} 28647 28648@TechReport{ gertz.linderoth.ea:object-oriented, 28649 author = {M. Gertz and J. Linderoth and S. Wright}, 28650 title = {Object-Oriented Software for Linear Complementarity and Quadratic Programming}, 28651 institution = {MCS Division, Argonne National Laboratory}, 28652 year = {in preparation} 28653} 28654 28655@Article{ ghellinck.vial:polynomial, 28656 author = {G. de Ghellinck and J.--Ph. Vial}, 28657 title = {A Polynomial {N}ewton Method for Linear Programming}, 28658 journal = {Algorithmica}, 28659 year = {1986}, 28660 volume = {1}, 28661 pages = {425--453} 28662} 28663 28664@InCollection{ gilbert.ng:predicting, 28665 author = {J. R. Gilbert and E. Ng}, 28666 title = {Predicting Structure in Nonsymmetric Sparse Matrix Factorizations}, 28667 year = {1993}, 28668 booktitle = {Graph Theory and Sparse Matrix Computation}, 28669 editor = {A. George and J. Gilbert and J. Liu}, 28670 publisher = {Springer-Verlag} 28671} 28672 28673@Article{ gilbert-lemarechal, 28674 author = {J. C. Gilbert and C. Lemarechal}, 28675 title = {Some Numerical Experiments with Variable-Storage Quasi-Newton Algorithms}, 28676 journal = {Mathematical Programming}, 28677 year = {1989}, 28678 volume = {45}, 28679 pages = {407--434} 28680} 28681 28682@Article{ gill.murray.ea:computing, 28683 author = {P. E. Gill and W. Murray and M. A. Saunders and M. H. Wright}, 28684 title = {Computing Forward-Difference Intervals for Numerical Optimization}, 28685 journal = {SIAM Journal on Scientific and Statistical Computing}, 28686 year = {1983}, 28687 volume = {4}, 28688 pages = {310--321} 28689} 28690 28691@Article{ gill.murray.ea:maintaining, 28692 author = {P. E. Gill and W. Murray and M. A. Saunders and M. H. Wright}, 28693 title = {Maintaining {LU} Factors of a General Sparse Matrix}, 28694 year = {1987}, 28695 journal = {Linear Algebra and Its Applications}, 28696 volume = {88/89}, 28697 pages = {239--270} 28698} 28699 28700@Book{ gill.murray.ea:practical, 28701 author = {P. E. Gill and W. Murray and M. H. Wright}, 28702 title = {Practical Optimization}, 28703 year = {1981}, 28704 publisher = {Academic Press}, 28705 address = {London} 28706} 28707 28708@Article{ gill.murray.ea:practical*1, 28709 author = {P. E. Gill and W. Murray and M. A. Saunders and M. H. Wright}, 28710 title = {A Practical Anti-Cycling Procedure for Linearly Constrained Optimization}, 28711 journal = {Mathematical Programming}, 28712 year = {1989}, 28713 volume = {45}, 28714 pages = {437--474} 28715} 28716 28717@Article{ gill.murray.ea:projected, 28718 author = {P. E. Gill and W. Murray and M. A. Saunders and J. A. Tomlin and M. H. Wright}, 28719 title = {On Projected {N}ewton Barrier Methods for Linear Programming and an Equivalence 28720 to {K}armarkar's Projective Method}, 28721 journal = {Mathematical Programming}, 28722 year = {1986}, 28723 volume = {36}, 28724 pages = {183--209} 28725} 28726 28727@Article{ gill.murray:newton-type, 28728 author = {P. E. Gill and W. Murray}, 28729 title = {{N}ewton--Type Methods for Unconstrained and Linearly Constrained Optimization}, 28730 journal = {Mathematical Programming}, 28731 year = {1974}, 28732 volume = {7}, 28733 pages = {311--350} 28734} 28735 28736@InProceedings{ gill.murray:nonlinear, 28737 author = {P. E. Gill and W. Murray}, 28738 title = {Nonlinear Least Squares and Nonlinearly Constrained Optimization}, 28739 booktitle = {Numerical Analysis, Dundee 1975}, 28740 year = {1976}, 28741 editor = {G. A. Watson}, 28742 publisher = {Springer-Verlag}, 28743 address = {Berlin}, 28744 note = {Lecture Notes in Mathematics 506} 28745} 28746 28747@Book{ ginsburgh.waelbroeck:activity, 28748 author = {V. Ginsburgh and J. Waelbroeck}, 28749 title = {Activity Analysis and General Equilibrium Modelling}, 28750 publisher = {North--Holland}, 28751 year = {1981}, 28752 address = {Amsterdam} 28753} 28754 28755@Article{ glad.goldstein:errors, 28756 author = {T. Glad and A. Goldstein}, 28757 title = {Optimization of Functions Whose Values are Subject to Small Errors}, 28758 journal = {BIT}, 28759 year = {1977}, 28760 volume = {17}, 28761 pages = {160--169} 28762} 28763 28764@Article{ glad.polak:multiplier, 28765 author = {T. Glad and E. Polak}, 28766 title = {A Multiplier Method with Automatic Limitation of Penalty Growth}, 28767 journal = {Mathematical Programming}, 28768 year = {1979}, 28769 volume = {17}, 28770 pages = {140--155} 28771} 28772 28773@Book{ glashoff.gustafson:linear, 28774 author = {K. Glashoff and S.--\AA. Gustafson}, 28775 title = {Linear Optimization and Approximation}, 28776 year = {1983}, 28777 publisher = {Springer-Verlag}, 28778 address = {New York} 28779} 28780 28781@Article{ glover:improved, 28782 author = {F. Glover}, 28783 title = {Improved Linear Programming Models for Discriminant Analysis}, 28784 journal = {Decision Sciences}, 28785 year = {1990}, 28786 volume = {21}, 28787 pages = {771--785} 28788} 28789 28790@Book{ glasserman:gradient, 28791 author = {P. Glasserman}, 28792 title = {Gradient Estimation via Perturbation Analysis}, 28793 publisher = {Kluwer}, 28794 year = {1991}, 28795 address = {Norwell, MA} 28796} 28797 28798@Article{ glover:tabu, 28799 author = {F. Glover}, 28800 title = {Tabu Search -- Part 1}, 28801 journal = {ORSA Journal on Computing}, 28802 year = {1989}, 28803 volume = {1}, 28804 pages = {190--206} 28805} 28806 28807@Article{ glowinski.marroco:sur, 28808 author = {R. Glowinski and A. Marroco}, 28809 title = {Sur l'Approximation, par Elements d'Ordre un, et la Resolution, par 28810 Penalisation-Dualit\'{e}, d'une Classe de Problemes de {D}irichlet non Lineares}, 28811 journal = {Revue Fran\c{c}aise d'Automatique, Informatique, et Recherche Operationelle}, 28812 year = {1975}, 28813 volume = {9(R-2)}, 28814 pages = {41--76} 28815} 28816 28817@TechReport{ goeleven.nguyen:convergence, 28818 author = {D. Goeleven and V. H. Nguyen}, 28819 title = {On the Convergence of the Parallel Constraint Distribution Algorithm}, 28820 institution = {Department of Mathematics, Facultes Universitaires de Namur}, 28821 year = {1992}, 28822 address = {B-5000 Namur, Belgium} 28823} 28824 28825@Book{ goldberg:genetic, 28826 author = {D. E. Goldberg}, 28827 title = {Genetic Algorithms in Search, Optimization and Machine Learning}, 28828 year = {1989}, 28829 publisher = {Addison-Wesley}, 28830 address = {Reading MA} 28831} 28832 28833@Article{ golden.skiscim:simulated, 28834 author = {B. L. Golden and C. C. Skiscim}, 28835 title = {Using Simulated Annealing to Solve Routing and Location Problems}, 28836 journal = {Naval Research Logistics Quarterly}, 28837 year = {1989}, 28838 volume = {33}, 28839 pages = {261--279} 28840} 28841 28842@Article{ goldfarb.reid:practical, 28843 author = {D. Goldfarb and J. K. Reid}, 28844 title = {A Practical Steepest--Edge Simplex Algorithm}, 28845 journal = {Mathematical Programming}, 28846 year = {1977}, 28847 volume = {12}, 28848 pages = {361--371} 28849} 28850 28851@InProceedings{ goldman.tucker:theory, 28852 author = {A. J. Goldman and A. W. Tucker}, 28853 title = {Theory of Linear Programming}, 28854 booktitle = {Linear Inequalities and Related Systems}, 28855 year = {1956}, 28856 editor = {H. W. Kuhn and A. W. Tucker}, 28857 publisher = {Princeton University Press}, 28858 address = {Princeton, New Jersey}, 28859 pages = {53--97} 28860} 28861 28862@Book{ goldstein:constructive, 28863 author = {A. A. Goldstein}, 28864 title = {Constructive Real Analysis}, 28865 year = {1967}, 28866 publisher = {Harper and Row}, 28867 address = {New York} 28868} 28869 28870@Article{ golshtein:block, 28871 author = {Ye. G. Golshtein}, 28872 title = {The Block Method of Convex Programming}, 28873 journal = {Soviet Mathematics Doklady}, 28874 year = {1986}, 28875 volume = {33}, 28876 pages = {584--587} 28877} 28878 28879@Article{ golshtein:general, 28880 author = {Ye. G. Golshtein}, 28881 title = {A General Approach to Decomposition of Optimization Systems}, 28882 journal = {Soviet Journal of Computer and Systems Sciences}, 28883 year = {1987}, 28884 volume = {3}, 28885 pages = {105--114} 28886} 28887 28888@Article{ golub.kahan:calculating, 28889 author = {G. H. Golub and W. Kahan}, 28890 title = {Calculating the Singular Values and Pseudoinverse of a Matrix}, 28891 journal = {SIAM Journal on Numerical Analysis}, 28892 year = {1965}, 28893 volume = {2}, 28894 pages = {205--224} 28895} 28896 28897@Book{ golub.vanloan:matrix, 28898 author = {G. H. Golub and C. F. {Van Loan}}, 28899 title = {Matrix Computations}, 28900 year = {1996}, 28901 publisher = {The John Hopkins University Press}, 28902 address = {Baltimore, Maryland}, 28903 edition = {Third} 28904} 28905 28906@TechReport{ gomez.barron:exponential, 28907 author = {S. Gom\'{e}z and C. Barr\'{o}n}, 28908 title = {The Exponential Tunneling Method}, 28909 institution = {Universidad Nacional Autonoma de Mexico}, 28910 year = {1991}, 28911 type = {Serie Reportes de Investigacion}, 28912 number = {3}, 28913 address = {Mexico} 28914} 28915 28916@Article{ gondzio:multiple, 28917 author = {J. Gondzio}, 28918 title = {Multiple Centrality Corrections in a Primal-Dual Method for Linear Programming}, 28919 journal = {Computational Optimization and Applications}, 28920 year = {1996}, 28921 volume = {6}, 28922 pages = {137--156} 28923} 28924 28925@TechReport{ gonzaga:algorithm, 28926 author = {C. C. Gonzaga}, 28927 title = {An Algorithm for Solving Linear Programming Problems in {O}($n^3${L}) 28928 operations}, 28929 institution = {Electronics Research Laboratory, University of California}, 28930 year = {1987}, 28931 address = {Berkeley, California}, 28932 number = {UCB/ERL M87/10}, 28933 type = {Memorandum} 28934} 28935 28936@Article{ gould.tolle:necessary, 28937 author = {F. J. Gould and J. W. Tolle}, 28938 title = {A Necessary and Sufficient Qualification for Constrained Optimization}, 28939 journal = {SIAM Journal on Applied Mathematics}, 28940 year = {1971}, 28941 volume = {20}, 28942 pages = {164--172} 28943} 28944 28945@InProceedings{ goux.kulkarni.ea:enabling, 28946 author = {J.-P. Goux and S. Kulkarni and J. Linderoth and M. E. Yoder}, 28947 title = {An Enabling Framework for Master-Worker Applications on the Computational Grid}, 28948 booktitle = {Proceedings of the Ninth {IEEE} International Symposium on High Performance 28949 Distributed Computing}, 28950 year = {2000} 28951} 28952 28953@Article{ gowda.pang:basic, 28954 author = {M. S. Gowda and J. S. Pang}, 28955 title = {The Basic Theorem of Complementarity Revisited}, 28956 journal = {Mathematical Programming}, 28957 year = {1993}, 28958 volume = {58}, 28959 pages = {161--178} 28960} 28961 28962@Article{ gowda.pang:boundedness, 28963 author = {M. S. Gowda and J. S. Pang}, 28964 title = {On the Boundedness and Stability of Solutions to the Affine Variational 28965 Inequality Problem}, 28966 journal = {SIAM Journal on Control and Optimization}, 28967 year = {1994}, 28968 volume = {32}, 28969 pages = {421--441} 28970} 28971 28972@Article{ gowda.pang:stability, 28973 author = {M. S. Gowda and J. S. Pang}, 28974 title = {Stability analysis of variational inequalities and nonlinear complementarity 28975 problems, via the mixed linear complementarity problem and degree theory}, 28976 journal = {Mathematics of Operations Research}, 28977 year = {1994}, 28978 volume = {19}, 28979 pages = {831--879} 28980} 28981 28982@Article{ gowda.sznajder:generalizations, 28983 author = {M. S. Gowda and R. Sznajder}, 28984 title = {Generalizations of ${P}_0$-- and ${P}$-- properties; Extended Vertical and 28985 Horizontal {LCP}s}, 28986 journal = {Linear Algebra and Its Applications}, 28987 year = {1995}, 28988 volume = {223/224}, 28989 pages = {695--715} 28990} 28991 28992@Article{ gowda.sznajder:generalized, 28993 author = {M. S. Gowda and R. Sznajder}, 28994 title = {The Generalized Order Linear Complementarity Problem}, 28995 journal = {SIAM Journal on Matrix Analysis and Applications}, 28996 year = {1994} 28997} 28998 28999@Article{ gowda:analysis, 29000 author = {M. S. Gowda}, 29001 title = {An Analysis of Zero Set and Global Error Bound Properties of a Piecewise Affine 29002 Function via its Recession Function}, 29003 journal = {SIAM Journal on Matrix Analysis and Applications}, 29004 year = {1996}, 29005 volume = {17}, 29006 pages = {594--609} 29007} 29008 29009@Article{ gowda:applications, 29010 author = {M. S. Gowda}, 29011 title = {Applications of Degree Theory to Linear Complementarity Problems}, 29012 journal = {Mathematics of Operations Research}, 29013 year = {1993}, 29014 volume = {18}, 29015 pages = {868--879} 29016} 29017 29018@Article{ grant.woo:clinical, 29019 author = {W. I. Grant and S. Y. Woo}, 29020 title = {Clinical and Financial Issues for Intensity Modulated Radiation Therapy 29021 Delivery}, 29022 journal = {Seminars in Radiation Oncology}, 29023 year = {1999}, 29024 volume = {9}, 29025 pages = {99--107} 29026} 29027 29028@Article{ greenberg.hegerich:branch, 29029 author = {H. Greenberg and R. L. Hegerich}, 29030 title = {A Branch Search Algorithm for the Knapsack Problem}, 29031 journal = {Management Science}, 29032 year = {1970}, 29033 volume = {16}, 29034 pages = {327--332} 29035} 29036 29037@InCollection{ grefenstette:incorporating, 29038 crossref = {davis:genetic}, 29039 author = {J. J. Grefenstette}, 29040 title = {Incorporating Problem Specific Knowledge into Genetic Algorithms} 29041} 29042 29043@Book{ griewank.corliss:automatic, 29044 editor = {A. Griewank and G. F. Corliss}, 29045 title = {Automatic Differentiation of Algorithms: Theory, Implementation and Application}, 29046 publisher = {SIAM}, 29047 year = {1991}, 29048 address = {Philadelphia, Pennsylvania} 29049} 29050 29051@Article{ griewank.juedes.ea:adol-c, 29052 author = {A. Griewank and D. Juedes and J. Utke}, 29053 title = {{ADOL}-{C}: {A} Package for the Automatic Differentiation of Algorithms Written 29054 in {C}/{C}++}, 29055 journal = {{ACM} Transactions on Mathematical Software}, 29056 year = {1996}, 29057 volume = {22}, 29058 pages = {131--167} 29059} 29060 29061@Article{ griffith.stewart:nonlinear, 29062 author = {R. E. Griffith and R. A. Stewart}, 29063 title = {A Nonlinear Programming Technique for the Optimization of Continuous Processing 29064 Systems}, 29065 journal = {Management Science}, 29066 year = {1961}, 29067 volume = {7}, 29068 pages = {379--392} 29069} 29070 29071@Article{ grinold:mathematical, 29072 author = {R. C. Grinold}, 29073 title = {Mathematical Methods for {PA}ttern Classification}, 29074 journal = {Management Science}, 29075 year = {1972}, 29076 volume = {19}, 29077 pages = {272--289} 29078} 29079 29080@Article{ grippo.lampariello.ea:class, 29081 author = {L. Grippo and F. Lampariello and S. Lucidi}, 29082 title = {A Class of Nonmonotone Stabilization Methods in Unconstrained Optimization}, 29083 journal = {Numerische Mathematik}, 29084 year = {1991}, 29085 volume = {59}, 29086 pages = {779--805} 29087} 29088 29089@Article{ grippo.lampariello.ea:global, 29090 author = {L. Grippo and F. Lampariello and S. Lucidi}, 29091 title = {Global Convergence and Stabilization of Unconstrained Minimization Methods 29092 Without Derivatives}, 29093 journal = {Journal of Optimization Theory and Applications}, 29094 year = {1988}, 29095 volume = {56}, 29096 pages = {385--406} 29097} 29098 29099@Article{ grippo.lampariello.ea:nonmonotone, 29100 author = {L. Grippo and F. Lampariello and S. Lucidi}, 29101 title = {A Nonmonotone Line Search Technique for {N}ewton's Method}, 29102 journal = {SIAM Journal on Numerical Analysis}, 29103 year = {1986}, 29104 volume = {23}, 29105 pages = {707--716} 29106} 29107 29108@Misc{ grippo:private, 29109 author = {L. Grippo}, 29110 title = {Private Communication}, 29111 year = {1992}, 29112 address = {Universita degli Studi di Roma ``La Sapienza'',Roma} 29113} 29114 29115@Article{ grotschel.lovasz.ea:ellipsoid, 29116 author = {M. Gr{\"{o}}tschel and L. Lov\'{a}sz and A. Schrijver}, 29117 title = {The Ellipsoid Method and its Consequences in Combinatorial Optimization}, 29118 journal = {Combinatorica}, 29119 year = {1981}, 29120 volume = {1}, 29121 pages = {169--197} 29122} 29123 29124@Article{ guignard:generalized, 29125 author = {M. Guignard}, 29126 title = {Generalized {K}uhn--{T}ucker conditions for Mathematical Programming in a 29127 {B}anach Space}, 29128 journal = {SIAM Journal on Control and Optimization}, 29129 year = {1969}, 29130 volume = {7}, 29131 pages = {232--241} 29132} 29133 29134@Article{ guler.ye:convergence, 29135 author = {O. G{\"{u}}ler and Y. Ye}, 29136 title = {Convergence Behavior of Interior--Point Algorithms}, 29137 journal = {Mathematical Programming}, 29138 year = {1993}, 29139 volume = {60}, 29140 pages = {215--228} 29141} 29142 29143@Article{ guler:existence, 29144 author = {O. G{\"{u}}ler}, 29145 title = {Existence of Interior Points and Interior Paths in Nonlinear Monotone 29146 Complementarity Problems}, 29147 journal = {Mathematics of Operations Research}, 29148 year = {1993}, 29149 volume = {18}, 29150 pages = {128--147} 29151} 29152 29153@Article{ guler:generalized, 29154 author = {O. G{\"{u}}ler}, 29155 title = {Generalized Linear Complementarity Problems}, 29156 journal = {Mathematics of Operations Research}, 29157 year = {1995}, 29158 volume = {20}, 29159 pages = {441--448} 29160} 29161 29162@Article{ gupta.sen:minimizing, 29163 author = {S. Gupta and T. Sen}, 29164 title = {Minimizing the Range of Lateness on a Single Machine}, 29165 journal = {Journal of the Operational Research Society}, 29166 year = {1984}, 29167 volume = {35}, 29168 pages = {853--857} 29169} 29170 29171@InCollection{ gustafson:numerical, 29172 author = {S.-\AA. Gustafson}, 29173 title = {On Numerical Analysis in Semi-Infinite Programming}, 29174 booktitle = {Semi-Infinite Programming}, 29175 year = {1979}, 29176 editor = {R. Hettich}, 29177 publisher = {Springer-Verlag}, 29178 address = {Berlin} 29179} 29180 29181@Article{ gustafsson.lind.ea:simultaneous, 29182 author = {A. Gustafsson and B. K. Lind and R. Svensson and A. Brahme}, 29183 title = {Simultaneous optimization of dynamic multileaf collimation and scanning patterns 29184 or compensation filters using a generalized pencil beam algorithm}, 29185 journal = {Medical Physics}, 29186 year = {1995}, 29187 volume = {22}, 29188 number = {7}, 29189 pages = {1141--1156} 29190} 29191 29192@PhDThesis{ ha:decomposition, 29193 author = {C. D. Ha}, 29194 title = {Decomposition Methods for Structured Convex Programming}, 29195 year = {1980}, 29196 school = {Department of Industrial Engineering, University of Wisconsin--Madison} 29197} 29198 29199@TechReport{ haakonsen.mathiesen:toward, 29200 author = {L. Haakonsen and L. Mathiesen}, 29201 title = {Toward a more comprehensive cost measure for {CO2}-reductions}, 29202 institution = {NHH, Bergen}, 29203 year = {1995}, 29204 type = {Discussion Paper}, 29205 number = {3/95} 29206} 29207 29208@Article{ haaland.norman.ea:vemod, 29209 author = {J. Haaland and V. Norman and T. Rutherford and T. Wergeland}, 29210 title = {{VEMOD}: {A} {R}icardo--{H}eckscher--{O}hlin--{J}ones Model of World Trade}, 29211 journal = {Scandinavian Journal of Economics}, 29212 year = {1987} 29213} 29214 29215@Article{ haarhoff.buys:method, 29216 author = {P. C. Haarhoff and J. D. Buys}, 29217 title = {A New Method for the Optimization of a Nonlinear Function Subject to Nonlinear 29218 Constraints}, 29219 journal = {Computer Journal}, 29220 year = {1970}, 29221 volume = {12}, 29222 pages = {178--184} 29223} 29224 29225@Article{ habetler.kostreva:direct, 29226 author = {G. J. Habetler and M. M. Kostreva}, 29227 title = {On a direct algorithm for nonlinear complementarity problems}, 29228 journal = {SIAM Journal on Control and Optimization}, 29229 volume = {16}, 29230 year = {1978}, 29231 pages = {504--511} 29232} 29233 29234@Book{ hadamard:cauchys, 29235 author = {J. Hadamard}, 29236 title = {Cauchy's Problem in Linear Partial Differential Equations}, 29237 year = {1923}, 29238 publisher = {Yale University Press} 29239} 29240 29241@Article{ haddock.mittenthal:simulation, 29242 author = {J. Haddock and J. Mittenthal}, 29243 title = {Simulation optimization using simulated annealing}, 29244 journal = {Comput. Ind. Eng.}, 29245 year = {1992}, 29246 volume = {22}, 29247 pages = {387--395} 29248} 29249 29250@TechReport{ hamala:general, 29251 author = {M. Hamala}, 29252 title = {A General Approach to Interior Point Methods with Linear Parameter for 29253 Mathematical Programming}, 29254 institution = {Royal Institute of Technology}, 29255 year = {1978}, 29256 number = {1978--20}, 29257 type = {Department of Mathematics Paper TRITA--MAT} 29258} 29259 29260@Article{ han.mangasarian:dual, 29261 author = {S.--P. Han and O. L. Mangasarian}, 29262 title = {A Dual Differentiable Exact Penalty Function}, 29263 journal = {Mathematical Programming}, 29264 year = {1983}, 29265 volume = {25}, 29266 pages = {293--301} 29267} 29268 29269@Article{ han.mangasarian:exact, 29270 author = {S.--P. Han and O. L. Mangasarian}, 29271 title = {Exact Penalty Functions in Nonlinear Programming}, 29272 journal = {Mathematical Programming}, 29273 year = {1979}, 29274 volume = {17}, 29275 pages = {251--269} 29276} 29277 29278@Article{ han.pang.ea:globally, 29279 author = {S.--P. Han and J. S. Pang and N. Rangaraj}, 29280 title = {Globally Convergent {N}ewton Methods for Nonsmooth Equations}, 29281 journal = {Mathematics of Operations Research}, 29282 year = {1992}, 29283 volume = {17}, 29284 pages = {586--607} 29285} 29286 29287@Article{ han:decomposition, 29288 author = {S.--P. Han}, 29289 title = {A Decomposition Method and its Application to Convex Programming}, 29290 journal = {Mathematics of Operations Research}, 29291 year = {1989}, 29292 volume = {14}, 29293 pages = {237--248} 29294} 29295 29296@Article{ han:globally, 29297 author = {S.--P. Han}, 29298 title = {A Globally Convergent Method for Nonlinear Programming}, 29299 journal = {Journal of Optimization Theory and Applications}, 29300 year = {1977}, 29301 volume = {22}, 29302 pages = {297--309} 29303} 29304 29305@Article{ han:superlinearly, 29306 author = {S.--P. Han}, 29307 title = {Superlinearly Convergent Variable Metric Algorithms for General Nonlinear 29308 Programming Problems}, 29309 journal = {Mathematical Programming}, 29310 year = {1976}, 29311 volume = {11}, 29312 pages = {263--282} 29313} 29314 29315@Article{ hansen.koopmans:definition, 29316 author = {T. Hansen and T. C. Koopmans}, 29317 title = {On the Definition and Computation of a Capital Stock Invariant Under 29318 Optimization}, 29319 journal = {Journal of Economic Theory}, 29320 year = {1972}, 29321 volume = {5}, 29322 pages = {487--523} 29323} 29324 29325@InCollection{ harker.pang:damped, 29326 author = {P. T. Harker and J. S. Pang}, 29327 title = {A Damped {N}ewton Method for the Linear Complementarity Problem}, 29328 booktitle = {Computational Solution of Nonlinear Systems of Equations}, 29329 publisher = {AMS}, 29330 year = {1990}, 29331 editor = {E. L. Allgower and K. Georg}, 29332 number = {26}, 29333 series = {Lectures on Applied Mathematics}, 29334 address = {Providence, Rhode Island}, 29335 pages = {265--284} 29336} 29337 29338@Article{ harker.pang:existence, 29339 author = {P. T. Harker and J. S. Pang}, 29340 title = {Existence of Optimal Solutions to Mathematical Programs with Equilibrium 29341 Constraints}, 29342 journal = {Operations Research Letters}, 29343 year = {1988}, 29344 volume = {7}, 29345 pages = {61--64} 29346} 29347 29348@Article{ harker.pang:finite-dimensional, 29349 author = {P. T. Harker and J. S. Pang}, 29350 title = {Finite--dimensional variational inequality and nonlinear complementarity 29351 problems: {A} survey of theory, algorithms and applications}, 29352 journal = {Mathematical Programming}, 29353 year = {1990}, 29354 volume = {48}, 29355 pages = {161--220} 29356} 29357 29358@Article{ harker.xiao:newtons, 29359 author = {P. T. Harker and B. Xiao}, 29360 title = {{N}ewton's Method for the Nonlinear Complementarity Problem: {A} 29361 {B}--Differentiable Equation Approach}, 29362 journal = {Mathematical Programming}, 29363 year = {1990}, 29364 volume = {48}, 29365 pages = {339--358} 29366} 29367 29368@Article{ harker:accelerating, 29369 author = {P. T. Harker}, 29370 title = {Accelerating the Convergence of the Diagonalization and Projection Algorithms for 29371 Finite--Dimensional Variational Inequalities}, 29372 journal = {Mathematical Programming}, 29373 year = {1988}, 29374 volume = {41}, 29375 pages = {29--50} 29376} 29377 29378@Article{ harker:generalized, 29379 author = {P. T. Harker}, 29380 title = {Generalized {N}ash Games and Quasi-Variational Inequalities}, 29381 journal = {European Journal of Operations Research}, 29382 volume = {54}, 29383 pages = {81--94}, 29384 year = {1987} 29385} 29386 29387@Book{ harker:lectures, 29388 author = {P. T. Harker}, 29389 title = {Lectures on Computation of Equilibria with Equation--Based Methods}, 29390 publisher = {CORE Foundation, Louvain--la--Neuve, Universit\'{e} Catholique de Louvain}, 29391 year = {1993}, 29392 series = {CORE Lecture Series} 29393} 29394 29395@Article{ harris:pivot, 29396 author = {P. M. J. Harris}, 29397 title = {Pivot Selection Methods of the {D}evex {LP} Code}, 29398 journal = {Mathematical Programming}, 29399 year = {1973}, 29400 volume = {5}, 29401 pages = {1--28} 29402} 29403 29404@InCollection{ harrison.kristrom:carbon, 29405 author = {G. W. Harrison and B. Kristrom}, 29406 title = {Carbon Emissions and the Economic Costs of Transport Policy in {S}weden}, 29407 booktitle = {Environment and Transport in Economic Modelling}, 29408 publisher = {Kluwer Academic Publishers}, 29409 year = {1997}, 29410 editor = {R. Roson and K. A. Small}, 29411 address = {Amsterdam} 29412} 29413 29414@Article{ harrison.rutherford.ea:increased, 29415 author = {G. W. Harrison and T. F. Rutherford and D. G. Tarr}, 29416 title = {Increased Competition and Completion of the Market in the {E}uropean {U}nion}, 29417 journal = {Journal of Economic Integration}, 29418 year = {1996}, 29419 volume = {11}, 29420 pages = {332--365} 29421} 29422 29423@Article{ harrison.rutherford.ea:liberalizing, 29424 author = {G. W. Harrison and T. F. Rutherford and I. Wooton}, 29425 title = {Liberalizing Agriculture in the {E}uropean {U}nion}, 29426 journal = {Journal of Policy Modeling}, 29427 year = {1995}, 29428 volume = {17} 29429} 29430 29431@Article{ harrison.rutherford.ea:quantifying, 29432 author = {G. W. Harrison and T. F. Rutherford and D. Tarr}, 29433 title = {Quantifying the {U}ruguay Round}, 29434 journal = {Finance and Development}, 29435 year = {1995}, 29436 volume = {32}, 29437 pages = {38--41} 29438} 29439 29440@InProceedings{ harrison.rutherford.ea:quantifying*1, 29441 author = {G. W. Harrison and T. F. Rutherford and D. G. Tarr}, 29442 title = {Quantifying the {U}ruguay Round}, 29443 year = {1996}, 29444 booktitle = {The {U}ruguay Round and the Developing Economies}, 29445 address = {New York}, 29446 editors = {W. Martin and L. A. Winters}, 29447 publisher = {Cambridge University Press} 29448} 29449 29450@Article{ harrison.rutherford.ea:quantifying*2, 29451 author = {G. W. Harrison and T. F. Rutherford and D. Tarr}, 29452 title = {Quantifying the {U}ruguay Round}, 29453 journal = {The Economic Journal}, 29454 year = {1997}, 29455 volume = {107}, 29456 pages = {1405--1430} 29457} 29458 29459@Article{ harrison.rutherford.ea:trade, 29460 author = {G. W. Harrison and T. F. Rutherford and D. G. Tarr}, 29461 title = {Trade Reform in the Partially Liberalized Economy of {T}urkey}, 29462 journal = {The World Bank Economic Review}, 29463 year = {1993}, 29464 volume = {7}, 29465 pages = {191--217} 29466} 29467 29468@Article{ hartman.stampacchia:nonlinear, 29469 author = {P. Hartman and G. Stampacchia}, 29470 title = {On some nonlinear differential-functional equations}, 29471 journal = {Acta Mathematica}, 29472 year = {1966}, 29473 volume = {115}, 29474 pages = {271--310} 29475} 29476 29477@Book{ harvey:forecasting, 29478 author = {Andrew C. Harvey}, 29479 title = {Forecasting, Structural Time Series Models and the {K}alman Filter}, 29480 publisher = {Cambridge University Press}, 29481 address = {New York, NY}, 29482 year = {1989} 29483} 29484 29485@Article{ haurie.marcotte:relationship, 29486 author = {A. Haurie and P. Marcotte}, 29487 title = {On the Relationship between {N}ash--{C}ournot and {W}ardrop Equilibria}, 29488 journal = {Networks}, 29489 year = {1985}, 29490 volume = {15}, 29491 pages = {295--308} 29492} 29493 29494@Article{ hearn.lawphongpanich.ea:restricted, 29495 author = {D. W. Hearn and S. Lawphongpanich and J. A. Ventura}, 29496 title = {Restricted Simplicial Decomposition: Computation and Extensions}, 29497 journal = {Mathematical Programming Study}, 29498 year = {1987}, 29499 volume = {31}, 29500 pages = {99--118} 29501} 29502 29503@Article{ hearn:gap, 29504 author = {D. W. Hearn}, 29505 title = {The Gap Function of a Convex Program}, 29506 journal = {Operations Research Letters}, 29507 year = {1982}, 29508 volume = {1}, 29509 pages = {67--71} 29510} 29511 29512@Article{ hedlund.gustavsson:design, 29513 author = {P. Hedlund and A. Gustavsson}, 29514 title = {Design and Evaluation of Modified Simplex Methods having Enhanced Convergence 29515 Ability}, 29516 journal = {Analytica Chimica Acta}, 29517 year = {1992}, 29518 volume = {259}, 29519 pages = {243--256} 29520} 29521 29522@Article{ helgason.kennington.ea:parallelization, 29523 author = {R. V. Helgason and J. L. Kennington and H. A. Zaki}, 29524 title = {A Parallelization of the Simplex Method}, 29525 journal = {Annals of Operations Research}, 29526 year = {1988}, 29527 volume = {14}, 29528 pages = {17--40} 29529} 29530 29531@Article{ helgason.kennington.ea:polynomially, 29532 author = {Richard Helgason and James Kennington and H. Lall}, 29533 title = {A Polynomially Bounded Algorithm for Singly Constrained Quadratic Programs}, 29534 journal = {Mathematical Programming}, 29535 year = {1980}, 29536 volume = {18}, 29537 pages = {338--343} 29538} 29539 29540@Book{ henderson.quandt:microeconomic, 29541 author = {J. M. Henderson and R. E. Quandt}, 29542 title = {Microeconomic Theory}, 29543 publisher = {McGraw--Hill}, 29544 address = {New York}, 29545 year = {1980}, 29546 edition = {Third} 29547} 29548 29549@TechReport{ hendrickson.leland:chaco, 29550 author = {B. Hendrickson and R. Leland}, 29551 title = {The {C}haco User's Guide: Version 2}, 29552 institution = {Sandia National Laboratories}, 29553 type = {Technical Report}, 29554 number = {SAND94-2692}, 29555 address = {Albuquerque, New Mexico}, 29556 year = {1994} 29557} 29558 29559@InProceedings{ hendrickson.leland:multilevel, 29560 author = {B. Hendrickson and R. Leland}, 29561 title = {A Multilevel Algorithm for Partitioning Graphs}, 29562 booktitle = {Proceedings of Supercomputing '95}, 29563 year = {1995} 29564} 29565 29566@Book{ hertz.krogh.ea:introduction, 29567 author = {J. Hertz and A. Krogh and R. G. Palmer}, 29568 title = {Introduction to the Theory of Neural Computation}, 29569 year = {1991}, 29570 publisher = {Addison-Wesley}, 29571 address = {Redwood City, California} 29572} 29573 29574@Article{ hertz.werra:tabu, 29575 author = {A. Hertz and D. de Werra}, 29576 title = {Using {T}abu Search techniques for Graph Coloring}, 29577 journal = {Computing}, 29578 year = {1987}, 29579 volume = {29}, 29580 pages = {345--351} 29581} 29582 29583@InCollection{ hettich:review, 29584 author = {R. Hettich}, 29585 title = {A Review of Numerical Methods for Semi-Infinite Optimization}, 29586 booktitle = {Semi-Infinite Programming and Applications}, 29587 year = {1983}, 29588 editor = {A. V. Fiacco and K. O. Kortanek}, 29589 publisher = {Springer-Verlag}, 29590 address = {Berlin} 29591} 29592 29593@Article{ highleyman:note, 29594 author = {W. H. Highleyman}, 29595 title = {A Note on Linear Separation}, 29596 journal = {IRE Transactions on Electronic Computers}, 29597 year = {1961}, 29598 volume = {10}, 29599 pages = {777--778} 29600} 29601 29602@Article{ hildreth:quadratic, 29603 author = {C. Hildreth}, 29604 title = {A Quadratic Programming Procedure}, 29605 journal = {Naval Research Logistics Quarterly}, 29606 year = {1957}, 29607 volume = {4}, 29608 pages = {79--85}, 29609 note = {Erratum, p. 361} 29610} 29611 29612@Book{ himmelblau:applied, 29613 author = {D. M. Himmelblau}, 29614 title = {Applied Nonlinear Programming}, 29615 year = {1972}, 29616 publisher = {McGraw--Hill}, 29617 address = {New York} 29618} 29619 29620@Book{ hiriart-urruty.lemarechal:convex, 29621 author = {Jean-Baptiste Hiriart-Urruty and Claude Lemar\'{e}chal}, 29622 title = {Convex Analysis and Minimization Algorithms {I}}, 29623 year = {1993}, 29624 publisher = {Springer Verlag}, 29625 address = {Berlin}, 29626 volume = {305}, 29627 series = {Grundlehren der mathematischen Wissenschaften} 29628} 29629 29630@TechReport{ hironaka:introduction, 29631 author = {H. Hironaka}, 29632 title = {Introduction to real-analytic sets and real-analytic maps}, 29633 institution = {Instituto Matematico ``L. Tonelli'', Universit\`a di Pisa}, 29634 year = {1973}, 29635 type = {Technical Report}, 29636 address = {Pisa, Italy} 29637} 29638 29639@Article{ ho.lee.ea:decomposition, 29640 author = {J. K. Ho and T. C. Lee and R. P. Sundarraj}, 29641 title = {Decomposition of Linear Programs Using Parallel Computation}, 29642 journal = {Mathematical Programming}, 29643 year = {1988}, 29644 volume = {42}, 29645 pages = {391--405} 29646} 29647 29648@Article{ ho.loute:computational, 29649 author = {J. K. Ho and E. Loute}, 29650 title = {Computational Experience with Advanced Implementation of Decomposition Algorithms 29651 for Linear Programming}, 29652 journal = {Mathematical Programming}, 29653 year = {1983}, 29654 volume = {27}, 29655 pages = {283--290} 29656} 29657 29658@Book{ hock.schittkowski:test, 29659 author = {W. Hock and K. Schittkowski}, 29660 title = {Test Examples for Nonlinear Programming Codes}, 29661 volume = {187}, 29662 series = {Lecture Notes in Economics and Mathematical Systems}, 29663 year = {1981}, 29664 publisher = {Springer Verlag}, 29665 address = {Berlin, Germany} 29666} 29667 29668@Book{ hockney.jesshope:parallel, 29669 author = {R. W. Hockney and C. R. Jesshope}, 29670 title = {Parallel Computers 2}, 29671 publisher = {Adam Hilger}, 29672 year = {1988}, 29673 address = {Bristol} 29674} 29675 29676@Article{ hoffman:approximate, 29677 author = {A. J. Hoffman}, 29678 title = {On Approximate Solutions of Systems of Linear Inequalities}, 29679 journal = {Journal of Research of the National Bureau of Standards}, 29680 year = {1952}, 29681 volume = {49}, 29682 pages = {263--265} 29683} 29684 29685@Article{ hogan:comments, 29686 author = {W. W. Hogan}, 29687 title = {Comments on Manne and Richels: `{CO2} Emission Limits: An Economic Cost Analysis 29688 for the {USA}}, 29689 journal = {The Energy Journal}, 29690 year = {1990}, 29691 volume = {11}, 29692 pages = {75--84} 29693} 29694 29695@Article{ hogan:energy, 29696 author = {W. W. Hogan}, 29697 title = {Energy Policy Models for {P}roject {I}ndependence}, 29698 journal = {Computers \& Operations Research}, 29699 year = {1975}, 29700 volume = {2}, 29701 pages = {251--271} 29702} 29703 29704@Book{ holland:adaptation, 29705 author = {J. Holland}, 29706 title = {Adaptation in Natural and Artificial Systems}, 29707 year = {1975}, 29708 publisher = {The University of Michigan Press}, 29709 address = {Ann Arbor, Michigan} 29710} 29711 29712@Article{ holmes.mackie:comparison, 29713 author = {T. Holmes and T. R. Mackie}, 29714 title = {A comparison of three inverse treatment planning algorithms}, 29715 journal = {Physics in Medicine and Biology}, 29716 year = {1994}, 29717 volume = {39}, 29718 number = {1}, 29719 pages = {91--106} 29720} 29721 29722@Article{ holmes.mackie:filtered, 29723 author = {T. Holmes and T. R. Mackie}, 29724 title = {A filtered backprojection dose calculation method for inverse treatment 29725 planning}, 29726 journal = {Medical Physics}, 29727 year = {1994}, 29728 volume = {21}, 29729 number = {2}, 29730 pages = {303--313} 29731} 29732 29733@Article{ hooke.jeeves:direct, 29734 author = {R. Hooke and T. A. Jeeves}, 29735 title = {Direct Search Solution of Numerical and Statistical Problems}, 29736 journal = {Journal of Associated Computing Machinery}, 29737 year = {1961}, 29738 volume = {8}, 29739 pages = {212--229} 29740} 29741 29742@Article{ hoppe.mittelmann:multi-grid, 29743 author = {R. H. W. Hoppe and H. D. Mittelmann}, 29744 title = {A Multi-grid Continuation Strategy for Parameter-dependent Variational 29745 Inequalities}, 29746 journal = {Journal of Computational and Applied Mathematics}, 29747 year = {1989}, 29748 volume = {26}, 29749 pages = {35--46} 29750} 29751 29752@Book{ horn.johnson:matrix, 29753 author = {R. A. Horn and C. R. Johnson}, 29754 title = {Matrix Anaysis}, 29755 publisher = {Cambridge University Press}, 29756 year = {1985}, 29757 address = {Cambridge, England} 29758} 29759 29760@Article{ hornik.stinchcombe.ea:multilayer, 29761 author = {K. Hornik and M. Stinchcombe and H. White}, 29762 title = {Multilayer Feedforward Networks are Universal Approximators}, 29763 journal = {Neural Networks}, 29764 year = {1989}, 29765 volume = {2}, 29766 pages = {359--366} 29767} 29768 29769@Article{ horowitz.sahni:computing, 29770 author = {E. Horowitz and S. Sahni}, 29771 title = {Computing Partitions with Applications to the Knapsack Problem}, 29772 journal = {jacm}, 29773 year = {1974}, 29774 volume = {21}, 29775 pages = {277--292} 29776} 29777 29778@Article{ hristov.fallone:continuous, 29779 author = {D. H. Hristov and B. G. Fallone}, 29780 title = {A continuous penalty function method for inverse treatment planning}, 29781 journal = {Medical Physics}, 29782 year = {1998}, 29783 volume = {25}, 29784 number = {2}, 29785 pages = {208--223} 29786} 29787 29788@Article{ hu.cheng.ea:numerical, 29789 author = {Y. Hu and H. S. Cheng and T. Arai and Y. Kobayashi and S. Aoyama}, 29790 title = {Numerical simulation of piston ring in mixed lubrication---a nonaxisymmetrical 29791 analysis}, 29792 journal = {Transactions of the {ASME}}, 29793 volume = {116}, 29794 year = {1994}, 29795 pages = {470--478} 29796} 29797 29798@InProceedings{ hua.sheu:skyscraper, 29799 author = {K. A. Hua and S. Sheu}, 29800 title = {Skyscraper Broadcasting: {A} New Broadcasting System for Metropolitan 29801 Video-On-Demand Systems}, 29802 year = {1997}, 29803 booktitle = {Proceedings of the {ACM SIGCOMM'97} Conference}, 29804 address = {Cannes, France}, 29805 pages = {89--100} 29806} 29807 29808@Article{ huang.pang:option, 29809 author = {J. Huang and J. S. Pang}, 29810 title = {Option Pricing and Linear Complementarity}, 29811 journal = {Journal of Computational Finance}, 29812 volume = {2}, 29813 year = {1998}, 29814 pages = {31--60} 29815} 29816 29817@InCollection{ huard:resolution, 29818 author = {P. Huard}, 29819 title = {Resolution of Mathematical Programming with Nonlinear Constraints by the Method 29820 of Centers}, 29821 booktitle = {Nonlinear Programming}, 29822 year = {1967}, 29823 editor = {J. Abadie}, 29824 publisher = {North--Holland}, 29825 address = {Amsterdam}, 29826 pages = {207--219} 29827} 29828 29829@Book{ huber:robust, 29830 author = {P. J. Huber}, 29831 title = {Robust Statistics}, 29832 year = {1981}, 29833 publisher = {John Wiley}, 29834 address = {New York} 29835} 29836 29837@Book{ hudson:piecewise, 29838 author = {J. F. P. Hudson}, 29839 title = {Piecewise Linear Topology}, 29840 publisher = {Benjamin}, 29841 address = {New York}, 29842 year = {1969} 29843} 29844 29845@InCollection{ hunter.markusen.ea:north, 29846 author = {L. Hunter and J. R. Markusen and T. F. Rutherford}, 29847 title = {{N}orth {A}merican free trade and the production of finished automobiles}, 29848 booktitle = {Modeling North American Economic Integration}, 29849 publisher = {Kluwer Academic Publishers}, 29850 year = {1995}, 29851 editor = {T. Kehoe and P. Kehoe}, 29852 pages = {117--130} 29853} 29854 29855@Article{ ibarra.kim:fast, 29856 author = {O. H. Ibarra and C. E. Kim}, 29857 title = {Fast Approximation Algorithms for the Knapsack and Sum of Subset Problems}, 29858 journal = {jacm}, 29859 year = {1975}, 29860 volume = {22}, 29861 pages = {463--468} 29862} 29863 29864@Article{ ijiri:fundamental, 29865 author = {Y. Ijiri}, 29866 title = {Fundamental Queries in Aggregation Theory}, 29867 journal = {Journal of the American Statistical Association}, 29868 year = {1971}, 29869 volume = {66}, 29870 pages = {766--782} 29871} 29872 29873@Article{ ingargiola.korsh:reduction, 29874 author = {G. P. Ingargiola and J. F. Korsh}, 29875 title = {A Reduction Algorithm for the Zero--One Single Knapsack Problem}, 29876 journal = {Management Science}, 29877 year = {1973}, 29878 volume = {20}, 29879 pages = {460--463} 29880} 29881 29882@Article{ ioffe:variational, 29883 author = {A. D. Ioffe}, 29884 title = {Variational Analysis of a Composite Function: {A} Formula for the Lower 29885 Second--Order Directional Derivative}, 29886 journal = {Journal of Mathematical Analysis and its Applications}, 29887 year = {1993} 29888} 29889 29890@Article{ iri.imai:multiplicative, 29891 author = {M. Iri and H. Imai}, 29892 title = {A Multiplicative Barrier Function Method for Linear Programming}, 29893 journal = {Algorithmica}, 29894 year = {1986}, 29895 volume = {1}, 29896 pages = {455--482} 29897} 29898 29899@Article{ isac.goeleven:implicit, 29900 author = {G. Isac and D. Goeleven}, 29901 title = {The Implicit General Order Complementarity Problem, Models and Iterative 29902 Methods}, 29903 journal = {Annals of Operations Research}, 29904 year = {1993} 29905} 29906 29907@Article{ isac.kostreva:generalized, 29908 author = {G. Isac and M. M. Kostreva}, 29909 title = {The Generalized Order Complementarity Problem}, 29910 journal = {Journal of Optimization Theory and Applications}, 29911 volume = {19}, 29912 pages = {227--232}, 29913 year = {1991} 29914} 29915 29916@Book{ isac:complementarity, 29917 author = {G. Isac}, 29918 title = {Complementarity Problems}, 29919 publisher = {Springer-Verlag}, 29920 year = {1992}, 29921 series = {Lecture Notes in Mathematics}, 29922 address = {New York} 29923} 29924 29925@Article{ iusem.svaiter:variant, 29926 author = {A. N. Iusem and B. F. Svaiter}, 29927 title = {A Variant of {K}orpelevich's Method for Variational Inequalities with a New 29928 Search Strategy}, 29929 journal = {Optimization}, 29930 year = {1997}, 29931 volume = {42}, 29932 pages = {309--321} 29933} 29934 29935@Article{ iusem:convergence, 29936 author = {A. N. Iusem}, 29937 title = {On the Convergence of Iterative Methods for Symmetric Linear Complementarity 29938 Problems}, 29939 journal = {Mathematical Programming}, 29940 year = {1993}, 29941 volume = {59}, 29942 pages = {33--48} 29943} 29944 29945@Article{ jackson.kutcher.ea:probability, 29946 author = {A. Jackson and G. J. Kutcher and E. D. Yorke}, 29947 title = {Probability of Radiation-Induced Complications for Normal Tissues with Parallel 29948 Architecture subject to Non-Uniform Irradiation}, 29949 journal = {Medical Physics}, 29950 year = {1993}, 29951 volume = {20}, 29952 pages = {613--625} 29953} 29954 29955@Article{ jackson:optimization, 29956 author = {A. Jackson and X. H. Wang and R. Mohan}, 29957 title = {Optimization of Conformal Treatment Planning and Quadratic Dose Objectives 29958 (abstract)}, 29959 journal = {Medical Physics}, 29960 year = {1994}, 29961 volume = {21}, 29962 pages = {1006} 29963} 29964 29965@TechReport{ jackson:scheduling, 29966 author = {J. R. Jackson}, 29967 title = {Scheduling a Production Line to Minimize Maximum Tardiness}, 29968 institution = {University of California}, 29969 year = {1955}, 29970 address = {Los Angeles}, 29971 number = {43}, 29972 type = {Research Report} 29973} 29974 29975@Article{ jansen.roos.ea:polynomiality, 29976 author = {B. Jansen and C. Roos and T. Terlaky and A. Yoshise}, 29977 title = {Polynomiality of Primal-Dual Affine Scaling Algorithms for Nonlinear 29978 Complementarity Problems}, 29979 journal = {Mathematical Programming}, 29980 volume = {78}, 29981 pages = {315--346}, 29982 year = {1997} 29983} 29984 29985@Article{ jiang.fukushima.ea:trust, 29986 author = {H. Jiang and M. Fukushima and L. Qi and D. Sun}, 29987 title = {A Trust Region Method for Solving Generalized Complementarity Problems}, 29988 journal = {SIAM Journal on Optimization}, 29989 volume = {8}, 29990 pages = {140--157}, 29991 year = {1998} 29992} 29993 29994@Article{ jiang.qi:nonsmooth, 29995 author = {H. Jiang and L. Qi}, 29996 title = {A New Nonsmooth Equations Approach to Nonlinear Complementarity Problems}, 29997 journal = {SIAM Journal on Control and Optimization}, 29998 volume = {35}, 29999 pages = {178--193}, 30000 year = {1997} 30001} 30002 30003@TechReport{ jiang.ralph:qpecgen, 30004 author = {H. Jiang and D. Ralph}, 30005 title = {{QPECgen}, a {MATLAB} Generator for Mathematical Programs with Quadratic 30006 Objectives and Affine Variational Inequality Constraints}, 30007 year = {1997}, 30008 institution = {Department of Mathematics and Statistics, The University of Melbourne}, 30009 address = {Australia} 30010} 30011 30012@TechReport{ jiang.ralph:smooth, 30013 author = {H. Jiang and D. Ralph}, 30014 title = {Smooth {SQP} methods for Mathematical Programs with Nonlinear Complementarity 30015 Constraints}, 30016 year = {1997}, 30017 institution = {Department of Mathematics and Statistics, The University of Melbourne}, 30018 address = {Australia} 30019} 30020 30021@Article{ jiang:unconstrained, 30022 author = {H. Jiang}, 30023 title = {Unconstrained Minimization Approaches to Nonlinear Complementarity Problems}, 30024 journal = {Journal of Global Optimization, forthcoming}, 30025 year = {1997} 30026} 30027 30028@Article{ jittorntrum.osborne:strong, 30029 author = {K. Jittorntrum and M. R. Osborne}, 30030 title = {Strong uniqueness and second order convergence in nonlinear discrete 30031 approximation}, 30032 journal = {Numerische Mathematik}, 30033 year = {1980}, 30034 volume = {34}, 30035 pages = {439--455} 30036} 30037 30038@InProceedings{ jog.suh.ea:effects, 30039 crossref = {schaeffer:third}, 30040 author = {P. Jog and J. Y. Suh and D. Van Gucht}, 30041 title = {The Effects of Population Size, Heuristic Crossover and Local Improvement on a 30042 Genetic Algorithm for the Travelling Salesman Problem}, 30043 pages = {110--115} 30044} 30045 30046@Article{ jog.suh.ea:parallel, 30047 author = {P. Jog and J. Y. Suh and D. Van Gucht}, 30048 title = {Parallel Genetic Algorithms Applied to the Travelling Salesman Problem}, 30049 journal = {SIAM Journal on Optimization}, 30050 year = {1991}, 30051 volume = {1} 30052} 30053 30054@Article{ johansson.klarbring:rigid, 30055 author = {L. Johansson and A. Klarbring}, 30056 title = {The Rigid Punch Problem with Friction using Variational Inequalities and Linear 30057 Complementarity}, 30058 journal = {Mechanics of Structures \& Machines}, 30059 volume = {20}, 30060 pages = {293--319}, 30061 year = {1992} 30062} 30063 30064@Article{ johnson.aragon.ea:optimization, 30065 author = {D. S. Johnson and C. R. Aragon and L. A. McGeoch and C. Schevon}, 30066 title = {Optimization by Simulated Annealing: An Experimental Evaluation; Part {I}, Graph 30067 Partitioning}, 30068 journal = {Operations Research}, 30069 year = {1989}, 30070 volume = {37}, 30071 pages = {865--892} 30072} 30073 30074@Article{ johnson:optimally, 30075 author = {R. Johnson}, 30076 title = {Optimally Balancing Large Assembly Lines with {FABLE}}, 30077 journal = {Management Science}, 30078 year = {1988}, 30079 volume = {34}, 30080 pages = {240--253} 30081} 30082 30083@Article{ johnsson:solving, 30084 author = {S. L. Johnsson}, 30085 title = {Solving Tridiagonal Systems on Ensemble Architectures}, 30086 journal = {SIAM Journal on Scientific and Statistical Computing}, 30087 year = {1987}, 30088 volume = {8}, 30089 pages = {475--489} 30090} 30091 30092@Article{ jorgenson.wilcoxen:reducing, 30093 author = {D. W. Jorgenson and P. J. Wilcoxen}, 30094 title = {Reducing {US} Carbon Emissions: An Econometric General Equilibrium Assessment}, 30095 journal = {Resource and Energy Economics}, 30096 year = {1993}, 30097 volume = {15}, 30098 pages = {7--25} 30099} 30100 30101@TechReport{ josephy:hogans, 30102 author = {N. H. Josephy}, 30103 title = {Hogan's {PIES} Example and {L}emke's Algorithm}, 30104 institution = {Mathematics Research Center, University of Wisconsin--Madison}, 30105 year = {1979}, 30106 address = {Madison, Wisconsin}, 30107 number = {1972}, 30108 type = {Technical Summary Report} 30109} 30110 30111@TechReport{ josephy:newton, 30112 author = {N. H. Josephy}, 30113 title = {A {N}ewton Method for the {PIES} Energy Model}, 30114 institution = {Mathematics Research Center, University of Wisconsin--Madison}, 30115 year = {1979}, 30116 address = {Madison, Wisconsin}, 30117 number = {1971}, 30118 type = {Technical Summary Report} 30119} 30120 30121@PhDThesis{ josephy:newtons, 30122 author = {N. H. Josephy}, 30123 title = {{N}ewton's Method for Generalized Equations and the {PIES} Energy Model}, 30124 year = {1979}, 30125 school = {Department of Industrial Engineering, University of Wisconsin--Madison} 30126} 30127 30128@TechReport{ josephy:newtons*1, 30129 author = {N. H. Josephy}, 30130 title = {{N}ewton's Method for Generalized Equations}, 30131 institution = {Mathematics Research Center, University of Wisconsin}, 30132 year = {1979}, 30133 address = {Madison, Wisconsin}, 30134 number = {1965}, 30135 type = {Technical Summary Report} 30136} 30137 30138@TechReport{ josephy:quasi-newton, 30139 author = {N. H. Josephy}, 30140 title = {Quasi--{N}ewton Methods for Generalized Equations}, 30141 institution = {Mathematics Research Center, University of Wisconsin}, 30142 year = {1979}, 30143 address = {Madison, Wisconsin}, 30144 number = {1966}, 30145 type = {Technical Summary Report} 30146} 30147 30148@PhDThesis{ kabbadj:methodes, 30149 author = {S. Kabbadj}, 30150 title = {Methodes Proximales Entropiques}, 30151 school = {Universit\'{e} de Montpellier II -- Sciences et Techniques du Languedoc}, 30152 year = {1994}, 30153 type = {Doctoral Thesis} 30154} 30155 30156@Book{ kall.wallace:stochastic, 30157 author = {P. Kall and S. W. Wallace}, 30158 title = {Stochastic Programming}, 30159 publisher = {John Wiley \& Sons}, 30160 year = {1994}, 30161 address = {Chichester} 30162} 30163 30164@Article{ kallman.agren.ea:tumor, 30165 author = {P. Kallman and A. Agren and A. Brahme}, 30166 title = {Tumor and Normal Tissue Responses to Fractionated Non-Uniform Dose Delivery}, 30167 journal = {International Journal of Radiation Biology}, 30168 year = {1992}, 30169 volume = {62}, 30170 pages = {249--262} 30171} 30172 30173@Misc{ kalvelagen:gams, 30174 author = {Erwin Kalvelagen}, 30175 title = {The {GAMS} {I/O} Library}, 30176 howpublished = {mimeo, GAMS Development Corporation}, 30177 year = {1992}, 30178 note = {Preliminary Version} 30179} 30180 30181@Article{ kaneko:complete, 30182 author = {I. Kaneko}, 30183 title = {Complete solution of a class of elastic-plastic structures}, 30184 journal = {Computer Methods in Applied Mechanics and Engineering}, 30185 volume = {21}, 30186 year = {1980}, 30187 pages = {193--209} 30188} 30189 30190@Article{ kaneko:mathematical, 30191 author = {I. Kaneko}, 30192 title = {A mathematical programming method for the inelastic analysis of reinforced 30193 concrete frames}, 30194 journal = {International Journal for Numerical Methods in Engineering}, 30195 volume = {11}, 30196 year = {1977}, 30197 pages = {1137--1154} 30198} 30199 30200@Article{ kaneko:piecewise, 30201 author = {I. Kaneko}, 30202 title = {Piecewise linear elastic-plastic analysis}, 30203 journal = {International Journal for Numerical Methods in Engineering}, 30204 volume = {14}, 30205 year = {1979}, 30206 pages = {757--767} 30207} 30208 30209@Article{ kanet:minimizing, 30210 author = {J. J. Kanet}, 30211 title = {Minimizing the Average Deviation of Job Completion Times about a Common Due 30212 Date}, 30213 journal = {Naval Research Logistics Quarterly}, 30214 year = {1981}, 30215 volume = {28}, 30216 pages = {643--651} 30217} 30218 30219@Article{ kantorovich:mathematical, 30220 author = {L. V. Kantorovich}, 30221 title = {Mathematical Methods in the Organization and Planning of Production}, 30222 journal = {Management Science}, 30223 year = {1960}, 30224 volume = {6}, 30225 pages = {366--422}, 30226 note = {English translation, Russian version 1939} 30227} 30228 30229@Article{ kanzow.fukushima:equivalence, 30230 author = {C. Kanzow and M. Fukushima}, 30231 title = {Equivalence of the Generalized Complementarity Problem to Differentiable 30232 Unconstrained Minimization}, 30233 journal = {Journal of Optimization Theory and Applications}, 30234 year = {1996}, 30235 volume = {90}, 30236 pages = {581--603} 30237} 30238 30239@Article{ kanzow.fukushima:theoretical, 30240 author = {C. Kanzow and M. Fukushima}, 30241 title = {Theoretical and Numerical Investigation of the {D}-gap function for 30242 Box-Constrained Variational Inequalities}, 30243 journal = {Mathematical Programming}, 30244 year = {1998}, 30245 volume = {83}, 30246 pages = {55--88} 30247} 30248 30249@Article{ kanzow.jiang:continuation, 30250 author = {C. Kanzow and H. Jiang}, 30251 title = {A Continuation Method for (Strongly) Monotone Variational Inequalities}, 30252 journal = {Mathematical Programming}, 30253 year = {1998}, 30254 volume = {81}, 30255 pages = {103--125} 30256} 30257 30258@Article{ kanzow.kleinmichel:class, 30259 author = {C. Kanzow and H. Kleinmichel}, 30260 title = {A Class of {N}ewton-Type Methods for Equality and Inequality Constrained 30261 Optimization}, 30262 journal = {Optimization Methods and Software}, 30263 year = {1995}, 30264 volume = {5}, 30265 pages = {173--198} 30266} 30267 30268@Article{ kanzow.kleinmichel:new, 30269 author = {C. Kanzow and H. Kleinmichel}, 30270 title = {A New Class of Semismooth {N}ewton-Type Methods for Nonlinear Complementarity 30271 Problems}, 30272 journal = {Computational Optimization and Applications}, 30273 volume = {11}, 30274 pages = {227--251}, 30275 year = {1998} 30276} 30277 30278@Article{ kanzow.pieper:jacobian, 30279 author = {C. Kanzow and H. Pieper}, 30280 title = {Jacobian Smoothing Methods for Nonlinear Complementarity Problems}, 30281 journal = {SIAM Journal on Optimization}, 30282 year = {1999}, 30283 volume = {9}, 30284 pages = {342--373} 30285} 30286 30287@Article{ kanzow.qi:qp-free, 30288 author = {C. Kanzow and H. -D. Qi}, 30289 title = {A {QP}-free constrained {N}ewton-type method for variational inequality 30290 problems}, 30291 journal = {Mathematical Programming}, 30292 year = {1999}, 30293 volume = {85}, 30294 pages = {81--106} 30295} 30296 30297@Article{ kanzow.yamashita.ea:ncp-functions, 30298 author = {C. Kanzow and N. Yamashita and M. Fukushima}, 30299 title = {New {NCP}-functions and their properties}, 30300 journal = {Journal of Optimization Theory and Applications}, 30301 year = {1997}, 30302 volume = {94}, 30303 pages = {115--135} 30304} 30305 30306@TechReport{ kanzow.zupke:inexact, 30307 author = {C. Kanzow and M. Zupke}, 30308 title = {Inexact Trust-Region Methods for Nonlinear Complementarity Problems}, 30309 year = {1997}, 30310 institution = {Institute of Applied Mathematics, University of Hamburg}, 30311 type = {Preprint}, 30312 number = {127}, 30313 address = {Hamburg, Germany} 30314} 30315 30316@Article{ kanzow:approach, 30317 author = {C. Kanzow}, 30318 title = {A New Approach to Continuation Methods for Complementarity Problems with Uniform 30319 {P}-Functions}, 30320 journal = {Operations Research Letters}, 30321 volume = {20}, 30322 year = {1997}, 30323 pages = {85--92} 30324} 30325 30326@Article{ kanzow:equation-based, 30327 author = {C. Kanzow}, 30328 title = {Some Equation--Based Methods for the Nonlinear Complementarity Problem}, 30329 journal = {Optimization Methods and Software}, 30330 year = {1994}, 30331 volume = {3}, 30332 pages = {327--340} 30333} 30334 30335@Article{ kanzow:global, 30336 author = {C. Kanzow}, 30337 title = {Global Convergence Properties of Some Iterative Methods for Linear 30338 Complementarity Problems}, 30339 journal = {SIAM Journal on Optimization}, 30340 year = {1996}, 30341 volume = {6}, 30342 pages = {326--341} 30343} 30344 30345@Article{ kanzow:inexact, 30346 author = {C. Kanzow}, 30347 title = {An Inexact {QP}--based method for nonlinear complementarity problems}, 30348 journal = {Numerische Mathematik, forthcoming}, 30349 year = {1999} 30350} 30351 30352@Article{ kanzow:noninterior, 30353 author = {C. Kanzow}, 30354 title = {Some Noninterior Continuation Methods for Linear Complementarity Problems}, 30355 journal = {SIAM Journal on Matrix Analysis and Applications}, 30356 volume = {17}, 30357 pages = {851--868}, 30358 year = {1996} 30359} 30360 30361@Article{ kanzow:nonlinear, 30362 author = {C. Kanzow}, 30363 title = {Nonlinear Complementarity as Unconstrained Optimization}, 30364 journal = {Journal of Optimization Theory and Applications}, 30365 year = {1996}, 30366 volume = {88}, 30367 pages = {139--155} 30368} 30369 30370@TechReport{ kanzow:semismooth, 30371 author = {C. Kanzow}, 30372 title = {Semismooth {N}ewton-Type Methods for the Solution of Nonlinear Complementarity 30373 Problems}, 30374 institution = {Institute of Applied Mathematics, University of Hamburg}, 30375 year = {1997}, 30376 type = {Preprint}, 30377 address = {Hamburg, Germany} 30378} 30379 30380@TechReport{ kanzow:tools, 30381 annote = {This should be replaced by kanzow:noninterior}, 30382 author = {C. Kanzow}, 30383 title = {Some Tools Allowing Interior--Point Methods to Become Noninterior}, 30384 institution = {Institute of Applied Mathematics, University of Hamburg}, 30385 year = {1994}, 30386 address = {Germany} 30387} 30388 30389@Article{ kaplan.meier:nonparametric, 30390 author = {E. L. Kaplan and P. Meier}, 30391 title = {Nonparametric Estimation from Incomplete Observations}, 30392 journal = {J. Am. Stat. Assoc.}, 30393 year = {1958}, 30394 volume = {53}, 30395 pages = {457--481} 30396} 30397 30398@Article{ karamardian:complementarity, 30399 author = {S. Karamardian}, 30400 title = {The Complementarity Problem}, 30401 journal = {Mathematical Programming}, 30402 year = {1972}, 30403 volume = {2}, 30404 pages = {107--129} 30405} 30406 30407@Article{ karamardian:complementarity*1, 30408 author = {S. Karamardian}, 30409 title = {Complementarity Problems over {C}ones with Monotone and Pseudomonotone Maps}, 30410 journal = {Journal of Optimization Theory and Applications}, 30411 year = {1976}, 30412 volume = {18}, 30413 pages = {445--454} 30414} 30415 30416@Article{ karamardian:generalized, 30417 author = {S. Karamardian}, 30418 title = {Generalized Complementarity Problem}, 30419 journal = {Journal of Optimization Theory and Applications}, 30420 year = {1971}, 30421 volume = {8}, 30422 pages = {161--167} 30423} 30424 30425@Article{ karmarkar.karp.ea:probabilistic, 30426 author = {N. Karmarkar and R. M. Karp and G. S. Lueker and A. M. Odlyzko}, 30427 title = {Probabilistic Analysis of Optimum Partitioning}, 30428 journal = {Journal of Applied Probability}, 30429 year = {1986}, 30430 volume = {23}, 30431 pages = {626--645} 30432} 30433 30434@Article{ karmarkar:polynomial, 30435 author = {N. Karmarkar}, 30436 title = {A New Polynomial Time Algorithm for Linear Programming}, 30437 journal = {Combinatorica}, 30438 year = {1984}, 30439 volume = {4}, 30440 pages = {373--395} 30441} 30442 30443@Unpublished{ karp:probabilistic, 30444 author = {R. M. Karp}, 30445 title = {Probabilistic Analysis of Algorithms}, 30446 note = {(Lecture Notes)} 30447} 30448 30449@InCollection{ karp:reducibility, 30450 author = {R. M. Karp}, 30451 title = {Reducibility among Combinatorial Problems}, 30452 booktitle = {Complexity of Computer Computations}, 30453 year = {1972}, 30454 editor = {R. E. Miller and J. W. Thatcher}, 30455 publisher = {Plenum Press}, 30456 address = {New York}, 30457 pages = {85--103} 30458} 30459 30460@MastersThesis{ karush:minima, 30461 author = {W. Karush}, 30462 title = {Minima of Functions of Several Variables with Inequalities as Side Conditions}, 30463 year = {1939}, 30464 school = {Department of Mathematics, University of Chicago} 30465} 30466 30467@TechReport{ karypis.kumar:metis, 30468 author = {G. Karypis and V. Kumar}, 30469 title = {{METIS}: Unstructured Graph Partitioning and Sparse Matrix Ordering System, 30470 Version 2.0}, 30471 institution = {University of Minnesota, Department of Computer Science}, 30472 type = {Technical Report}, 30473 address = {Minnesota}, 30474 year = {1995} 30475} 30476 30477@TechReport{ karypis.kumar:multilevel, 30478 author = {G. Karypis and V. Kumar}, 30479 title = {Multilevel k-way Partitioning Scheme for Irregular Graphs}, 30480 institution = {University of Minnesota, Department of Computer Science}, 30481 type = {Technical Report}, 30482 number = {95-064}, 30483 address = {Minnesota}, 30484 year = {1995} 30485} 30486 30487@Article{ katukani:generalization, 30488 author = {S. Katukani}, 30489 title = {A Generalization of {B}rouwer's Fixed Point Theorem}, 30490 journal = {Duke Mathematical Journal}, 30491 year = {1941}, 30492 volume = {8}, 30493 pages = {457--459} 30494} 30495 30496@Article{ keifer.wolfowitz:stochastic, 30497 author = {J. Keifer and J. Wolfowitz}, 30498 title = {Stochastic Estimation of the Maximum of a Regression Function}, 30499 journal = {Annals of Mathematical Statistics}, 30500 year = {1952}, 30501 volume = {23}, 30502 pages = {462--466} 30503} 30504 30505@InCollection{ kellog.li.ea:method, 30506 author = {R. B. Kellog and T. Y. Li and J. A. Yorke}, 30507 title = {A Method of Continuation for Calculating a {B}rouwer Fixed Point}, 30508 booktitle = {Computing Fixed Points with Applications}, 30509 year = {1977}, 30510 editor = {S. Karamardian}, 30511 publisher = {Academic Press}, 30512 pages = {133--147} 30513} 30514 30515@Book{ kennington.helgason:algorithms, 30516 author = {J. L. Kennington and R. V. Helgason}, 30517 title = {Algorithms for Network Programming}, 30518 year = {1980}, 30519 publisher = {John Wiley \& Sons}, 30520 address = {New York} 30521} 30522 30523@Article{ kernighan.lin:efficient, 30524 author = {B. W. Kernighan and S. Lin}, 30525 title = {An Efficient Heuristic Procedure for Partitioning Graphs}, 30526 journal = {The Bell System Technical Journal}, 30527 pages = {291--307}, 30528 volume = {29}, 30529 year = {1970} 30530} 30531 30532@Article{ khachian:polynomial, 30533 author = {L. G. Khachian}, 30534 title = {A Polynomial Algorithm for Linear Programming}, 30535 journal = {Soviet Mathematics Doklady}, 30536 year = {1979}, 30537 volume = {20}, 30538 pages = {191--194} 30539} 30540 30541@Article{ khobotov:modification, 30542 author = {E. N. Khobotov}, 30543 title = {A Modification of the Extragradient Method for the Solution of Variational 30544 Inequalities and some Optimization Problems}, 30545 journal = {Zhurnal Vychislitel'noi Matematiki i Matematicheskoi Fiziki}, 30546 year = {1987}, 30547 volume = {27}, 30548 pages = {1462--1473} 30549} 30550 30551@Book{ khuri.cornell:response, 30552 author = {A. I. Khuri and J. A. Cornell}, 30553 title = {Response Surfaces: Designs and Analyses}, 30554 publisher = {Marcel Dekker}, 30555 year = {1987}, 30556 address = {New York} 30557} 30558 30559@Article{ kibardin:decomposition, 30560 author = {V. M. Kibardin}, 30561 title = {Decomposition into Functions in the Minimization Problems}, 30562 journal = {Automation and Remote Control}, 30563 year = {1980}, 30564 volume = {40}, 30565 pages = {1311--1323} 30566} 30567 30568@TechReport{ king:sposl, 30569 author = {A. J. King}, 30570 title = {{SP/OSL} Version 1.0 Stochastic Programming Interface Library User's Guide}, 30571 institution = {IBM T.J. Watson Research Center}, 30572 year = {1994}, 30573 number = {RC 19757}, 30574 address = {Yorktown Heights, New York} 30575} 30576 30577@Article{ kirkpatrick.gelatt.ea:optimization, 30578 author = {S. Kirkpatrick and C. D. Gelatt and M. P. {Vecchi Jr.}}, 30579 title = {Optimization by Simulated Annealing}, 30580 journal = {Science}, 30581 year = {1983}, 30582 volume = {220}, 30583 pages = {671--680} 30584} 30585 30586@Book{ kiwiel:methods, 30587 author = {K. C. Kiwiel}, 30588 title = {Methods of Descent for Nondifferentiable Optimization}, 30589 year = {1985}, 30590 publisher = {Springer-Verlag}, 30591 address = {Berlin}, 30592 series = {Lecture Notes in Mathematics}, 30593 number = {1133} 30594} 30595 30596@Article{ kiwiel:twice, 30597 author = {K. C. Kiwiel}, 30598 title = {On the Twice Differentiable Cubic Augmented {L}agrangian}, 30599 journal = {Journal of Optimization Theory and Applications}, 30600 year = {1996}, 30601 volume = {88}, 30602 pages = {233--236} 30603} 30604 30605@Article{ klarbring.bjorkman:mathematical, 30606 author = {A. Klarbring and G. Bj{\"{o}}rkman}, 30607 title = {A mathematical programming approach to contact problems with friction and varying 30608 contact surface}, 30609 journal = {Computers \& Structures}, 30610 volume = {30}, 30611 year = {1988}, 30612 pages = {1185--1198} 30613} 30614 30615@Article{ klarbring.bjorkman:solution, 30616 author = {A. Klarbring and G. Bj{\"{o}}rkman}, 30617 title = {Solution of large displacement contact problems with friction using {N}ewton's 30618 method for generalized equations}, 30619 journal = {International Journal for Numerical Methods in Engineering}, 30620 volume = {34}, 30621 year = {1992}, 30622 pages = {249--269} 30623} 30624 30625@Article{ klarbring.pang:existence, 30626 author = {A. Klarbring and J. S. Pang}, 30627 title = {Existence of solution to discrete semicoercive frictional contact problems}, 30628 journal = {{SIAM} Journal on Optimization, under review}, 30629 year = {1996} 30630} 30631 30632@Article{ klarbring:discrete, 30633 author = {A. Klarbring}, 30634 title = {On Discrete and Discretized Non-linear Elastic Structures in Unilateral Contact 30635 (Stability, Uniqueness and Variational Principles)}, 30636 journal = {International Journal on Solids and Structures}, 30637 volume = {24}, 30638 pages = {459--479}, 30639 year = {1988} 30640} 30641 30642@TechReport{ klarbring:large, 30643 author = {A. Klarbring}, 30644 title = {Large Displacement Frictional Contact: a Continuum Framework for Finite Element 30645 Discretization}, 30646 number = {LiTH-IKP-R-798}, 30647 institution = {Department of Mechanical Engineering, Link{\"o}ping Institute of Technology}, 30648 address = {Link{\"o}ping}, 30649 year = {1994} 30650} 30651 30652@Article{ klarbring:mathematical, 30653 author = {A. Klarbring}, 30654 title = {A mathematical programming approach to three dimensional contact problems with 30655 friction}, 30656 journal = {Computer Methods in Applied Mechanics and Engineering}, 30657 volume = {58}, 30658 year = {1986}, 30659 pages = {175--200} 30660} 30661 30662@InCollection{ klarbring:mathematical*1, 30663 author = {A. Klarbring}, 30664 title = {Mathematical programming and augmented {L}agrangian methods for frictional 30665 contact problems}, 30666 editor = {A. Curnier}, 30667 booktitle = {Proceedings Contact Mechanics International Symposium}, 30668 publisher = {Presse Polytechniques et Universitaires Romandes}, 30669 address = {Lausanne}, 30670 year = {1992}, 30671 pages = {409--422} 30672} 30673 30674@InCollection{ klarbring:mathematical*2, 30675 author = {A. Klarbring}, 30676 title = {Mathematical programming in contact problems}, 30677 editors = {M. H. Aliabadi and C. A. Brebbia}, 30678 booktitle = {Computational Methods for Contact Problems}, 30679 publisher = {Computational Mechanics Publications}, 30680 address = {Southampton}, 30681 year = {1993}, 30682 pages = {233--264} 30683} 30684 30685@Article{ klarbring:quadratic, 30686 author = {A. Klarbring}, 30687 title = {A quadratic program in frictionless contact problems}, 30688 journal = {International Journal of Engineering Science}, 30689 volume = {24}, 30690 pages = {1207--1217}, 30691 year = {1986} 30692} 30693 30694@InCollection{ klee.minty:how, 30695 author = {V. Klee and G. J. Minty}, 30696 title = {How Good is the Simplex Algorithm?}, 30697 booktitle = {Inequalities--III}, 30698 year = {1972}, 30699 publisher = {Academic Press}, 30700 pages = {159--175} 30701} 30702 30703@Article{ kleywegt.shapiro:sample, 30704 author = {A. Kleywegt and A. Shapiro}, 30705 title = {The Sample Average Approximation Method for Stochastic Discrete Optimization}, 30706 journal = {Stochastic Programming E-Print Series}, 30707 year = {1999}, 30708 note = {Available from dochost.rz.hu-berlin.de/speps} 30709} 30710 30711@Book{ knuth:art, 30712 author = {D. E. Knuth}, 30713 title = {The Art of Computer Programming}, 30714 publisher = {Addison-Wesley Longman Inc.}, 30715 address = {Reading, Massachusetts}, 30716 year = {1998}, 30717 edition = {Third}, 30718 volume = {2} 30719} 30720 30721@InProceedings{ kocvara.outrata:nonsmooth, 30722 author = {M. Ko\v{c}vara and J. V. Outrata}, 30723 title = {A nonsmooth approach to optimization problems with equilibrium constraints}, 30724 crossref = {ferris.pang:complementarity}, 30725 pages = {148--164} 30726} 30727 30728@Article{ kocvara.outrata:optimization, 30729 author = {M. Ko\v{c}vara and J. V. Outrata}, 30730 title = {On Optimization of Systems Governed by Implicit Complementarity Problems}, 30731 volume = {15}, 30732 journal = {Numerical Fucntional Analysis and Optimization}, 30733 year = {1994}, 30734 pages = {869--887} 30735} 30736 30737@InCollection{ kocvara.outrata:solution, 30738 author = {M. Ko\v{c}vara and J. V. Outrata}, 30739 title = {On the solution of optimum design problems with variational inequalities}, 30740 editors = {D. Z. Du and L. Qi and R. Womersley}, 30741 booktitle = {Recent Advances in Nonsmooth Optimization}, 30742 publisher = {World Scientific Publishers}, 30743 address = {Singapore}, 30744 year = {1995}, 30745 pages = {172--192} 30746} 30747 30748@Article{ kojima.hirabayashi:homotopy, 30749 author = {M. Kojima and R. Hirabayashi}, 30750 title = {Continuous deformation of nonlinear programs}, 30751 journal = {Mathematical Programming Study}, 30752 editor = {A.~V. Fiacco}, 30753 publisher = {North--Holland}, 30754 address = {Amsterdam}, 30755 year = {1984}, 30756 volume = {21}, 30757 pages = {150--198} 30758} 30759 30760@Article{ kojima.megiddo.ea:homotopy, 30761 author = {M. Kojima and N. Megiddo and T. Noma}, 30762 title = {Homotopy Continuation Methods for Nonlinear Complementarity Problems}, 30763 journal = {Mathematics of Operations Research}, 30764 year = {1991}, 30765 volume = {16}, 30766 pages = {754--774} 30767} 30768 30769@TechReport{ kojima.megiddo.ea:primal-dual, 30770 author = {M. Kojima and N. Megiddo and S. Mizuno}, 30771 title = {A primal-dual exterior point algorithm for linear programming}, 30772 institution = {IBM Alamaden Research Center}, 30773 year = {1991}, 30774 number = {RJ 8500}, 30775 address = {San Jose, California} 30776} 30777 30778@Book{ kojima.megiddo.ea:unified, 30779 author = {M. Kojima and N. Megiddo and T. Noma and A. Yoshise}, 30780 title = {A Unified Approach to Interior Point Algorithms for Linear Complementarity 30781 Problems}, 30782 year = {1991}, 30783 publisher = {Springer-Verlag}, 30784 address = {Berlin}, 30785 volume = {538}, 30786 series = {Lecture Notes in Computer Science} 30787} 30788 30789@Article{ kojima.mizuno.ea:continuation, 30790 author = {M. Kojima and S. Mizuno and T. Noma}, 30791 title = {A New Continuation Method for Complementarity Problems with Uniform 30792 {P}-function}, 30793 journal = {Mathematical Programming}, 30794 year = {1989}, 30795 volume = {43}, 30796 pages = {107--113} 30797} 30798 30799@TechReport{ kojima.mizuno.ea:infeasible, 30800 author = {M. Kojima and S. Mizuno and M. Todd}, 30801 title = {Infeasible interior-point primal-dual potential-reduction algorithms for linear 30802 programming}, 30803 institution = {School of Operations Research and Industrial Engineering, Cornell University}, 30804 year = {1992}, 30805 number = {1023}, 30806 address = {Ithaca, New York}, 30807 month = aug 30808} 30809 30810@Article{ kojima.mizuno.ea:onl, 30811 author = {M. Kojima and S. Mizuno and A. Yoshise}, 30812 title = {An ${O}(\sqrt{n}{L})$ iteration potential reduction algorithm for linear 30813 complementarity problems}, 30814 journal = {Mathematical Programming}, 30815 year = {1991}, 30816 volume = {50}, 30817 pages = {331--342} 30818} 30819 30820@Article{ kojima.mizuno.ea:polynomial-time, 30821 author = {M. Kojima and S. Mizuno and A. Yoshise}, 30822 title = {A Polynomial-Time Algorithm for a Class of Linear Complementarity Problems}, 30823 journal = {Mathematical Programming}, 30824 year = {1989}, 30825 volume = {44}, 30826 pages = {1--20} 30827} 30828 30829@Article{ kojima.noma.ea:global, 30830 author = {M. Kojima and T. Noma and A. Yoshise}, 30831 title = {Global Convergence in Infeasible Interior--Point Algorithms}, 30832 journal = {Mathematical Programming}, 30833 volume = {65}, 30834 pages = {43--72}, 30835 year = {1994} 30836} 30837 30838@Article{ kojima.shindo.ea:interior-point, 30839 author = {M. Kojima and S. Shindo and S. Hara}, 30840 title = {Interior--Point Methods for the Monotone Semidefinite Linear Complementarity 30841 Problem in Symmetric Matrices}, 30842 journal = {SIAM Journal on Optimization}, 30843 volume = {7}, 30844 pages = {86--125} 30845} 30846 30847@Article{ kojima.shindo:extensions, 30848 author = {M. Kojima and S. Shindo}, 30849 title = {Extensions of {N}ewton and Quasi-{N}ewton Methods to Systems of {PC}$^1$ 30850 Equations}, 30851 journal = {Journal of Operations Research Society of Japan}, 30852 year = {1986}, 30853 volume = {29}, 30854 pages = {352--374} 30855} 30856 30857@Article{ kojima:computational, 30858 author = {M. Kojima}, 30859 title = {Computational Methods for Solving the Nonlinear Complementarity Problem}, 30860 journal = {Keio Engineering Reports}, 30861 year = {1974}, 30862 volume = {27}, 30863 pages = {1--41} 30864} 30865 30866@Article{ kojima:recent, 30867 author = {M. Kojima}, 30868 title = {Recent advances in mathematical programming. {X}. Computation of fixed points by 30869 continuation methods}, 30870 journal = {Systems and Control}, 30871 year = {1981}, 30872 volume = {25}, 30873 pages = {421--430} 30874} 30875 30876@Article{ kolesar:branch, 30877 author = {P. J. Kolesar}, 30878 title = {A Branch and Bound Algorithm for the Knapsack Problem}, 30879 journal = {Management Science}, 30880 year = {1967}, 30881 volume = {13}, 30882 pages = {723--735} 30883} 30884 30885@Book{ kolman.beck:elementary, 30886 author = {B. Kolman and R. E. Beck}, 30887 title = {Elementary Linear Programming with Applications}, 30888 year = {1980}, 30889 publisher = {Academic Press} 30890} 30891 30892@Book{ koopmans:activity, 30893 editor = {T. C. Koopmans}, 30894 title = {Activity Analysis of Production and Allocation}, 30895 publisher = {John Wiley}, 30896 address = {New York}, 30897 year = {1951} 30898} 30899 30900@Article{ korpelevich:extragradient, 30901 author = {G. M. Korpelevich}, 30902 title = {The Extragradient Method for Finding Saddle Points and Other Problems}, 30903 journal = {Matecon}, 30904 year = {1976}, 30905 volume = {12}, 30906 pages = {747--756} 30907} 30908 30909@Article{ kortanek.shi:convergence, 30910 author = {K. O. Kortanek and M. Shi}, 30911 title = {Convergence Results and Numerical Experiments on a Linear Programming Hybrid 30912 Algorithm}, 30913 journal = {European Journal of Operational Research}, 30914 year = {1987}, 30915 volume = {32}, 30916 pages = {47--61} 30917} 30918 30919@TechReport{ kortanek.shi:remarks, 30920 author = {K. O. Kortanek and M. Shi}, 30921 title = {Remarks on `Convergence Results and Numerical Experiments on a Linear Programming 30922 Hybrid Algorithm 1985-6'}, 30923 institution = {College of Business Administration, University of Iowa}, 30924 year = {1987}, 30925 address = {Iowa City}, 30926 number = {87--1}, 30927 type = {Working Paper} 30928} 30929 30930@TechReport{ kortanek:vector-supercomputer, 30931 author = {K. O. Kortanek}, 30932 title = {Vector--Supercomputer Experiments with the Linear Programming Scaling Algorithm}, 30933 institution = {College of Business Administration, University of Iowa}, 30934 year = {1987}, 30935 address = {Iowa City}, 30936 number = {87--2}, 30937 type = {Working Paper} 30938} 30939 30940@Article{ kostreva:block, 30941 author = {M. M. Kostreva}, 30942 title = {Block Pivot Methods for Solving the Complementarity Problem}, 30943 journal = {Linear Algebra and Its Applications}, 30944 volume = {21}, 30945 pages = {207--215}, 30946 year = {1978} 30947} 30948 30949@Article{ kostreva:elasto-hydrodynamic, 30950 author = {M. M. Kostreva}, 30951 title = {Elasto-hydrodynamic Lubrication: {A} non-linear complementarity problem}, 30952 journal = {International Journal for Numerical Methods in Fluids}, 30953 year = {1984}, 30954 volume = {4}, 30955 pages = {377--397} 30956} 30957 30958@Article{ kostreva:recent, 30959 author = {M. M. Kostreva}, 30960 title = {Recent Results on Complementarity Models for Engineering and Economics}, 30961 journal = {Infor, Journal of the Canadian {OR} Society}, 30962 year = {1990}, 30963 volume = {28}, 30964 pages = {324--334} 30965} 30966 30967@Article{ kotiah.steinberg:occurrences, 30968 author = {T. C. T. Kotiah and D. I. Steinberg}, 30969 title = {Occurrences of Cycling and Other Phenomena Arising in a Class of Linear 30970 Programming Models}, 30971 journal = {Communications of the ACM}, 30972 volume = {20}, 30973 year = {1977}, 30974 pages = {107--112} 30975} 30976 30977@Article{ kotiah.steinberg:possibility, 30978 author = {T. C. T. Kotiah and D. I. Steinberg}, 30979 title = {On the Possibility of Cycling with the Simplex Method}, 30980 journal = {Operations Research}, 30981 volume = {26}, 30982 year = {1978}, 30983 pages = {374--376} 30984} 30985 30986@InCollection{ kuhn.tucker:nonlinear, 30987 author = {H. W. Kuhn and A. W. Tucker}, 30988 title = {Nonlinear Programming}, 30989 booktitle = {Proceedings of the Second Berkeley Symposium on Mathematical Statistics and 30990 Probability}, 30991 year = {1951}, 30992 editor = {J. Neyman}, 30993 publisher = {University of California Press}, 30994 address = {Berkeley and Los Angeles}, 30995 pages = {481--492} 30996} 30997 30998@Article{ kummer:metric, 30999 author = {B. Kummer}, 31000 title = {Metric regularity: characterizations, nonsmooth variations, and successive 31001 approximation}, 31002 journal = {Journal of Mathematical Analysis and its Applications}, 31003 year = {}, 31004 optkey = {}, 31005 optvolume = {}, 31006 optnumber = {}, 31007 optpages = {}, 31008 optmonth = {}, 31009 optnote = {}, 31010 optannote = {} 31011} 31012 31013@InCollection{ kummer:newtons, 31014 author = {B. Kummer}, 31015 title = {{N}ewton's Method for Non--Differentiable Functions}, 31016 booktitle = {Advances in Mathematical Optimization}, 31017 publisher = {Akademie--Verlag}, 31018 year = {1988}, 31019 editors = {J. Guddat et al.}, 31020 pages = {114--125}, 31021 address = {Berlin} 31022} 31023 31024@Unpublished{ kuntsevich.kappel:solvopt, 31025 author = {A. Kuntsevich and F. Kappel}, 31026 title = {{SolvOpt}: The Solver for Local Nonlinear Optimization Problems}, 31027 year = {1997}, 31028 note = {Institute for Mathematics, Karl-Franzens University of Graz}, 31029 url = {http://bedvgm.kfunigraz.ac.at:8001/alex/solvopt/solvopt.html} 31030} 31031 31032@Book{ kushner.clark:stochastic, 31033 author = {H. J. Kushner and D. S. Clark}, 31034 title = {Stochastic Approximation Methods for Constrained and Unconstrained Systems}, 31035 publisher = {Springer-Verlag}, 31036 year = {1978}, 31037 address = {New York} 31038} 31039 31040@Article{ kutcher.burman.ea:histogram, 31041 author = {G. J. Kutcher and C. Burman and L. Brewster and M. Goitein and R. Mohan}, 31042 title = {Histogram reduction method for calculating complication probabilities for 31043 three-dimensional treatment planning evaluation}, 31044 journal = {International Journal of Radiation Oncology, Biology and Physics}, 31045 year = {1991}, 31046 optvolume = {21}, 31047 optpages = {137-146} 31048} 31049 31050@Article{ kutcher.burman:calculation, 31051 author = {G. J. Kutcher and C. Burman}, 31052 title = {Calculation of Complication Probability Factors for Non-Uniform Normal Tissue 31053 Irradiation: The Effective Volume Method}, 31054 journal = {International Journal of Radiation Oncology, Biology and Physics}, 31055 year = {1989}, 31056 volume = {16}, 31057 pages = {1623--1630} 31058} 31059 31060@Article{ kwak.lee:complementarity, 31061 author = {B. M. Kwak and B. C. Lee.}, 31062 title = {A Complementarity Problem Formulation for Two-Dimensional Frictional Contact 31063 Problem}, 31064 journal = {Computers and Structures}, 31065 volume = {18}, 31066 pages = {469--480}, 31067 year = {1988} 31068} 31069 31070@Article{ kwak:complementarity, 31071 author = {B. M. Kwak}, 31072 title = {Complementarity Problem Formulation of Three-Dimensional Frictional Contact}, 31073 journal = {Journal of Applied Mechanics}, 31074 volume = {58}, 31075 pages = {134--140}, 31076 year = {1991} 31077} 31078 31079@Article{ lagarias.reeds.ea:convergence, 31080 author = {J. C. Lagarias and J. A. Reeds and M. H. Wright and P. E. Wright}, 31081 title = {Convergence of the {N}elder-{M}ead Simplex method in Low Dimensions}, 31082 journal = {SIAM Journal on Optimization}, 31083 year = {1998}, 31084 volume = {9}, 31085 pages = {112--147} 31086} 31087 31088@Article{ lahaye:methode, 31089 author = {E. Lahaye}, 31090 title = {Une {M}\'{e}thode de {R}\'{e}solution d'une Cat\'{e}gorie d'\'{E}quations 31091 transcendantes}, 31092 journal = {C. R. Acad. Sci. Paris}, 31093 year = {1934}, 31094 volume = {198}, 31095 pages = {1840--1842} 31096} 31097 31098@Article{ lahaye:solution, 31099 author = {E. Lahaye}, 31100 title = {Solution of Systems of Transcendental Equations}, 31101 journal = {Acad. Roy. Belg. Bull. Cl. Sci.}, 31102 year = {1948}, 31103 volume = {5}, 31104 pages = {805--822} 31105} 31106 31107@Article{ lahenbruch.mickey:estimation, 31108 author = {P. A. Lahenbruch and R. M. Mickey}, 31109 title = {Estimation of Error Rates in Discriminant Analysis}, 31110 journal = {Technometrics}, 31111 year = {1968}, 31112 volume = {10}, 31113 pages = {1--11} 31114} 31115 31116@Article{ lakshminarayan.lakshmanan.ea:optimal, 31117 author = {S. Lakshminarayan and R. Lakshmanan and R. L. Papineau and R. Rochette}, 31118 title = {Optimal Single--Machine Scheduling with Earliness and Tardiness}, 31119 journal = {Operations Research}, 31120 year = {1978}, 31121 volume = {26}, 31122 pages = {1079--1082} 31123} 31124 31125@Article{ land.doig:automatic, 31126 author = {A. H. Land and A. G. Doig}, 31127 title = {An Automatic Method for Solving Discrete Programming Problems}, 31128 journal = {Econometrica}, 31129 volume = {28}, 31130 year = {1960}, 31131 pages = {497-520} 31132} 31133 31134@Article{ langer.morrill:comparison, 31135 author = {M. Langer and S. Morrill}, 31136 title = {A comparison of mixed integer programming and fast simulated annealing for 31137 optimized beam weights in radiation therapy}, 31138 journal = {Medical Physics}, 31139 year = {1996}, 31140 volume = {23}, 31141 number = {6}, 31142 pages = {957--964} 31143} 31144 31145@Article{ larsson.patriksson:class, 31146 author = {T. Larsson and M. Patriksson}, 31147 title = {A Class of Gap Functions for Variational Inequalities}, 31148 journal = {Mathematical Programming}, 31149 year = {1994}, 31150 volume = {64}, 31151 pages = {53--79} 31152} 31153 31154@Article{ lasdon.waren.ea:solving, 31155 author = {L. S. Lasdon and A. Waren and S. Sarkar and F. Palacios}, 31156 title = {Solving the Pooling Problem Using Generalized Reduced Gradient and Successive 31157 Linear Programming Algorithms}, 31158 journal = {ACM SIGMAP Bulletin}, 31159 year = {1979}, 31160 volume = {27}, 31161 pages = {9--15} 31162} 31163 31164@TechReport{ lawler.lenstra.ea:sequencing, 31165 author = {E. L. Lawler and J. K. Lenstra and A. H. G. Rinnooy Kan and D. B. Shmoys}, 31166 title = {Sequencing and Scheduling: Algorithms and Complexity}, 31167 institution = {Centre for Mathematics and Computer Science}, 31168 year = {1989}, 31169 address = {P.O. Box 4079, 1009 AB Amsterdam, The Netherlands}, 31170 number = {BS--R89xx} 31171} 31172 31173@Article{ lawler:fast, 31174 author = {E. L. Lawler}, 31175 title = {Fast Approximations Algorithms for Knapsack Problems}, 31176 journal = {Mathematics of Operations Research}, 31177 year = {1979}, 31178 volume = {4}, 31179 pages = {339--356} 31180} 31181 31182@Book{ lawless:statistical, 31183 author = {J. F. Lawless}, 31184 title = {Statistical Models and Methods for Lifetime Data}, 31185 year = {1982}, 31186 publisher = {John Wiley and Sons}, 31187 address = {New York, NY} 31188} 31189 31190@Article{ lawrence.spingarn:fixed, 31191 author = {J. Lawrence and J. E. Spingarn}, 31192 title = {On fixed points of non-expansive piecewise isometric mappings}, 31193 journal = {Proceedings of the London Mathematical Society}, 31194 year = {1987}, 31195 volume = {55}, 31196 number = {3}, 31197 pages = {605--624} 31198} 31199 31200@Article{ leavitt.martin.ea:dynamic, 31201 author = {D. D. Leavitt and M. Martin and J. H. Moeller and W. L. Lee}, 31202 title = {Dynamic wedge field techniques through computer-controlled collimator motion and 31203 dose delivery}, 31204 journal = {Medical Physics}, 31205 year = {1990}, 31206 volume = {17}, 31207 number = {1}, 31208 pages = {87--92} 31209} 31210 31211@Article{ leblanc.morlok.ea:efficient, 31212 author = {L. J. LeBlanc and E. K. Morlok and W. P. Pierskalla}, 31213 title = {An Efficient Approach to Solving the Road Network Equilibrium Traffic Assignment 31214 Problem}, 31215 journal = {Transportation Research}, 31216 volume = {9}, 31217 year = {1975}, 31218 pages = {309--318} 31219} 31220 31221@Article{ lee:computational, 31222 author = {S. S. Lee}, 31223 title = {A computational method for frictional contact problem using finite element 31224 method}, 31225 journal = {International Journal for Numerical Methods in Engineering}, 31226 volume = {37}, 31227 year = {1994}, 31228 pages = {217--228} 31229} 31230 31231@PhDThesis{ lee:military, 31232 author = {D. K. Lee}, 31233 title = {Military Force Planning Problems Under Uncertainty}, 31234 school = {University of Wisconsin -- Madison}, 31235 year = {1996}, 31236 address = {Madison, Wisconsin} 31237} 31238 31239@Article{ leibel.kutcher.ea:improved, 31240 author = {S. A. Leibel and G. J. Kutcher and L. B. Harrison and D. E. Fass and C. Burman 31241 and M. Hunt and R. Mohan and L. J. Brewster and C. C. Ling and Z. Y. Fuks}, 31242 title = {Improved Dose Distributions For 3{D} Conformal Boost Treatments in Carcinoma of 31243 the Nasopharynx}, 31244 journal = {International Journal of Radiation Oncology, Biology and Physics}, 31245 year = {1991}, 31246 volume = {20}, 31247 pages = {823--833} 31248} 31249 31250@Article{ lee.gallagher.ea:treatment, 31251 author = {E. K. Lee and R. J. Gallagher and D. Silvern and C. S. Wuu and M. Zaider}, 31252 title = {Treatment Planning for Brachytherapy: an Integer Programming Model, Two 31253 Computational Approaches and Experiments with Permanent Prostate Implant 31254 Planning}, 31255 journal = {Physics in Medicine and Biology}, 31256 year = {1999}, 31257 volume = {44}, 31258 pages = {145--165} 31259} 31260 31261@Article{ lemarechal.nemirovskii.ea:variants, 31262 author = {C. Lemar\'{e}chal and A. Nemirovskii and Y. Nesterov}, 31263 title = {New Variants of Bundle Methods}, 31264 year = {1995}, 31265 journal = {Mathematical Programming}, 31266 volume = {69}, 31267 pages = {111--147} 31268} 31269 31270@InCollection{ lemarechal.strodiot.ea:bundle, 31271 author = {C. Lemar\'{e}chal and J. J. Strodiot and A. Bihain}, 31272 title = {On a Bundle Algorithm for Nonsmooth Optimization}, 31273 booktitle = {Nonlinear Programming}, 31274 year = {1981}, 31275 editor = {O. L. Mangasarian and R. R. Meyer and S. M. Robinson}, 31276 publisher = {Academic Press}, 31277 pages = {245--282}, 31278 volume = {4} 31279} 31280 31281@Article{ lemke.howson:equilibrium, 31282 author = {C. E. Lemke and J. T. Howson}, 31283 title = {Equilibrium Points of Bimatrix Games}, 31284 journal = {SIAM Journal on Applied Mathematics}, 31285 year = {1964}, 31286 volume = {12}, 31287 pages = {413--423} 31288} 31289 31290@Article{ lemke:bimatrix, 31291 author = {C. E. Lemke}, 31292 title = {Bimatrix Equilibrium Points and Mathematical Programming}, 31293 journal = {Management Science}, 31294 year = {1965}, 31295 volume = {11}, 31296 pages = {681--689} 31297} 31298 31299@InCollection{ lemke:complementary, 31300 author = {C. E. Lemke}, 31301 title = {On Complementary Pivot Theory}, 31302 booktitle = {Mathematics of the Decision Sciences: Part 1}, 31303 publisher = {American Mathematical Society}, 31304 year = {1968}, 31305 editor = {G. B. Dantzig and A. F. Veinott}, 31306 volume = {11}, 31307 series = {Lectures in Applied Mathematics}, 31308 address = {Providence}, 31309 pages = {95--114} 31310} 31311 31312@Article{ levenberg:method, 31313 author = {K. Levenberg}, 31314 title = {A Method for the Solution of Certain Nonlinear Problems in Least Squares}, 31315 journal = {Quarterly Applied Mathematics}, 31316 year = {1944}, 31317 volume = {2}, 31318 pages = {164--168} 31319} 31320 31321@Article{ levitin.polyak:constrained, 31322 author = {E. S. Levitin and B. T. Polyak}, 31323 title = {Constrained minimization methods}, 31324 journal = {Computational Mathematics and Mathematical Physics}, 31325 year = {1968}, 31326 volume = {6}, 31327 pages = {1--50}, 31328 note = {Translated from Russian} 31329} 31330 31331@Article{ li.swetis:linear, 31332 author = {W. Li and J. J. Swetits}, 31333 title = {The Linear $\ell_1$ Estimator and the {H}uber {M}-Estimator}, 31334 journal = {SIAM Journal on Optimization}, 31335 volume = {8}, 31336 pages = {457-475}, 31337 year = {1998} 31338} 31339 31340@TechReport{ li:error, 31341 author = {W. Li}, 31342 title = {Error Bounds for Piecewise Convex Quadratic Programs and Applications}, 31343 institution = {Department of Mathematics and Statistics, Old Dominion University}, 31344 year = {1993}, 31345 address = {Norfolk, VA 23529}, 31346 number = {TR93-1}, 31347 note = {SIAM Journal on Control and Optimization, to appear} 31348} 31349 31350@TechReport{ li:linearly, 31351 author = {W. Li}, 31352 title = {Linearly Convergent Descent Methods for Unconstrained Minimization of Convex 31353 Quadratic Splines}, 31354 institution = {Department of Mathematics and Statistics, Old Dominion University}, 31355 year = {1993}, 31356 address = {Norfolk, VA 23529}, 31357 number = {TR93-3}, 31358 note = {Journal of Optimization Theory and Applications, to appear} 31359} 31360 31361@InProceedings{ li:merit, 31362 author = {W. Li}, 31363 title = {A Merit Function and a {N}ewton-Type Method for Symmetric Linear Complementarity 31364 Problems}, 31365 crossref = {ferris.pang:complementarity} 31366} 31367 31368@Article{ li:remarks, 31369 author = {W. Li}, 31370 title = {Remarks on Convergence of Matrix Splitting Algorithm for the Symmetric Linear 31371 Complementarity Problem}, 31372 journal = {SIAM Journal on Optimization}, 31373 year = {1993}, 31374 volume = {3}, 31375 pages = {155--163} 31376} 31377 31378@TechReport{ li:sharp, 31379 author = {W. Li}, 31380 title = {Sharp {L}ipschitz Constants for Basic Optimal Solutions of Linear Programs}, 31381 institution = {Department of Mathematics and Statistics, Old Dominion University}, 31382 year = {1991}, 31383 address = {Norfolk, VA 23529}, 31384 number = {TR91-13}, 31385 note = {SIAM Journal on Control and Optimization, to appear} 31386} 31387 31388@Article{ lin.kernighan:efficient, 31389 author = {S. Lin and B. W. Kernighan}, 31390 title = {An Efficient Heuristic Algorithm for the Traveling Salesman Problem}, 31391 journal = {Operations Research}, 31392 year = {1973}, 31393 volume = {21}, 31394 pages = {498--516} 31395} 31396 31397@Article{ lin.pang:iterative, 31398 author = {Y. Y. Lin and J. S. Pang}, 31399 title = {Iterative Methods for Large Convex Quadratic Programs: {A} Survey}, 31400 journal = {SIAM Journal on Control and Optimization}, 31401 year = {1987}, 31402 volume = {25}, 31403 pages = {383--411} 31404} 31405 31406@Unpublished{ linderoth:branch, 31407 author = {J. Linderoth}, 31408 title = {A {B}ranch-and-{P}rice Approach to Stochastic Integer Programming}, 31409 institution = {Argonne National Laboratories}, 31410 year = {2000}, 31411 note = {Working Paper} 31412} 31413 31414@Article{ lions.stampacchia:variational, 31415 author = {J. L. Lions and G. Stampacchia}, 31416 title = {Variational Inequalities}, 31417 journal = {Communications on Pure and Applied Math}, 31418 year = {1967}, 31419 volume = {20}, 31420 pages = {493--19} 31421} 31422 31423@Article{ lions.mercier:splitting, 31424 author = {P.--L. Lions and B. Mercier}, 31425 title = {Splitting Methods for the Sum of Two Nonlinear Operators}, 31426 journal = {SIAM Journal on Numerical Analysis}, 31427 year = {1979}, 31428 volume = {16}, 31429 pages = {964--979} 31430} 31431 31432@Article{ lions:methode, 31433 author = {P.--L. Lions}, 31434 title = {Une {M}\'{e}thode it\'{e}rative de resolution d'une inequation variationnelle}, 31435 journal = {Israel Journal of Mathematics}, 31436 year = {1978}, 31437 volume = {31}, 31438 number = {2}, 31439 pages = {204--208} 31440} 31441 31442@InProceedings{ litzkow.livny.ea:condor, 31443 author = {M. J. Litzkow and M. Livny and M. W. Mutka}, 31444 title = {Condor: {A} Hunter of Idle Workstations}, 31445 booktitle = {Proceedings of the 8th International Conference on Distributed Computing 31446 Systems}, 31447 year = {1988}, 31448 pages = {104--111}, 31449 month = jun 31450} 31451 31452@Article{ liu.nocedal:limited, 31453 author = {D. C. Liu and J. Nocedal}, 31454 title = {On the Limited Memory Method for Large Scale Optimization}, 31455 journal = {Mathematical Programming}, 31456 year = {1989}, 31457 volume = {45}, 31458 pages = {503--528} 31459} 31460 31461@InBook{ livny.raman:high, 31462 author = {M. Livny and R. Raman}, 31463 title = {The Grid: Blueprint for a Future Computing Infrastructure}, 31464 chapter = {High Throughput Resource Management}, 31465 publisher = {Morgan Kaufmann Publishers}, 31466 year = {1999}, 31467 pages = {311--337} 31468} 31469 31470@Article{ llacer:inverse, 31471 author = {J. Llacer}, 31472 title = {Inverse Radiation Treatment Planning using the Dynamically Penalized Likelihood 31473 Method}, 31474 journal = {Medical Physics}, 31475 year = {1997}, 31476 volume = {24}, 31477 number = {11}, 31478 pages = {1751--1764} 31479} 31480 31481@Book{ lojasiewicz:ensembles, 31482 author = {M. S. Lojasiewicz}, 31483 title = {Ensembles semi-analytiques}, 31484 publisher = {Institut des Hautes Etudes Scientifiques}, 31485 year = {1964}, 31486 address = {Bures-sur-Yvette} 31487} 31488 31489@Article{ lootsma:logarithmic, 31490 author = {F. A. Lootsma}, 31491 title = {Logarithmic Programming: {A} Method of Solving Nonlinear Programming Problems}, 31492 journal = {Phillips Research Reports}, 31493 year = {1967}, 31494 volume = {22}, 31495 pages = {329--344} 31496} 31497 31498@InCollection{ lootsma:survey, 31499 author = {F. A. Lootsma}, 31500 title = {A Survey of Methods for Solving Constrained Minimization Problems via 31501 Unconstrained Minimization}, 31502 booktitle = {Numerical Methods for Nonlinear Optimization}, 31503 year = {1972}, 31504 editor = {F. A. Lootsma}, 31505 publisher = {Academic Press}, 31506 address = {London} 31507} 31508 31509@TechReport{ lopezdesilanes.markusen.ea:anti-competitive, 31510 author = {F. {Lopez-de-Silanes} and J. R. Markusen and T. F. Rutherford}, 31511 title = {Anti--Competitive and Rent--Shifting Aspects of Domestic--Content Provisions in 31512 Regional Trade Blocks}, 31513 institution = {National Bureau of Economic Research, Inc.}, 31514 year = {1993}, 31515 number = {4512}, 31516 address = {Cambridge, Massechusetts} 31517} 31518 31519@InCollection{ lopezdesilanes.markusen.ea:auto, 31520 author = {F. {Lopez-de-Silanes} and J. R. Markusen and T. F. Rutherford}, 31521 title = {The auto industry and the {N}orth {A}merican free-trade agreement}, 31522 year = {1994}, 31523 booktitle = {Modelling Trade Policy: AGE Assessments of North American Free Trade}, 31524 publisher = {Cambridge University Press}, 31525 editor = {C. Shields and J. Francois} 31526} 31527 31528@Article{ lopezdesilanes.markusen.ea:complementarity, 31529 author = {F. {Lopez-de-Silanes} and J. R. Markusen and T. F. Rutherford}, 31530 title = {Complementarity and Increasing Returns in Intermediate Inputs}, 31531 journal = {Journal of Development Economics}, 31532 year = {1994}, 31533 volume = {45}, 31534 pages = {133--151} 31535} 31536 31537@Article{ lopezdesilanes.markusen.ea:trade, 31538 author = {F. {Lopez-de-Silanes} and J. R. Markusen and T. F. Rutherford}, 31539 title = {Trade Policy Subtleties with Multinational Firms}, 31540 journal = {European Economic Review}, 31541 year = {1996} 31542} 31543 31544@Article{ lotstedt:coulomb, 31545 author = {P. L{\"{o}}tstedt}, 31546 title = {Coulomb friction in two-dimensional rigid body systems}, 31547 journal = {Zeitschrift f{\"{u}}r Angewandte Mathematik und Mechanik}, 31548 volume = {61}, 31549 year = {1981}, 31550 pages = {605--615} 31551} 31552 31553@Article{ lotstedt:mechanical, 31554 author = {P. L{\"{o}}tstedt}, 31555 title = {Mechanical systems of rigid bodies subject to unilateral constraints}, 31556 journal = {SIAM Journal on Applied Mathematics}, 31557 volume = {42}, 31558 year = {1982}, 31559 pages = {281--296} 31560} 31561 31562@Book{ luenberger:linear, 31563 author = {D. G. Luenberger}, 31564 title = {Linear and Nonlinear Programming}, 31565 year = {1984}, 31566 publisher = {Addison-Wesley}, 31567 edition = {Second} 31568} 31569 31570@Book{ luenberger:optimization, 31571 author = {D. G. Luenberger}, 31572 title = {Optimization by Vector Space Methods}, 31573 year = {1969}, 31574 publisher = {John Wiley \& Sons}, 31575 address = {New York} 31576} 31577 31578@Article{ lundy.mees:convergence, 31579 author = {M. Lundy and A. Mees}, 31580 title = {Convergence of an Annealing Algorithm}, 31581 journal = {Mathematical Programming}, 31582 year = {1986}, 31583 volume = {34}, 31584 pages = {111--124} 31585} 31586 31587@Article{ luo.luo:extension, 31588 author = {X.-D. Luo and Z.-Q. Luo}, 31589 title = {Extension of Hoffman's Error Bound to Polynomial Systems}, 31590 journal = {SIAM Journal on Optimization}, 31591 year = {1994}, 31592 volume = {4}, 31593 pages = {383--392} 31594} 31595 31596@Article{ luo.mangasarian.ea:error, 31597 author = {Z.-Q. Luo and O. L. Mangasarian and J. Ren and M. V. Solodov}, 31598 title = {New Error Bounds for the Linear Complementarity Problem}, 31599 journal = {Mathematics of Operations Research}, 31600 year = {1994}, 31601 pages = {880--892}, 31602 volume = {19} 31603} 31604 31605@Article{ luo.pang.ea:exact, 31606 author = {Z.-Q. Luo and J. S. Pang and D. Ralph and S.-Q. Wu}, 31607 title = {Exact Penalization and Stationarity Conditions of Mathematical Programs with 31608 Equilibrium Constraints}, 31609 journal = {Mathematical Programming}, 31610 volume = {75}, 31611 pages = {19--76}, 31612 year = {1996} 31613} 31614 31615@Book{ luo.pang.ea:mathematical, 31616 author = {Z.-Q. Luo and J. S. Pang and D. Ralph}, 31617 title = {Mathematical Programs with Equilibrium Constraints}, 31618 publisher = {Cambridge University Press}, 31619 year = {1996} 31620} 31621 31622@Article{ luo.pang:error, 31623 author = {Z.-Q. Luo and J. S. Pang}, 31624 title = {Error Bounds for Analytic Systems and their Applications}, 31625 journal = {Mathematical Programming}, 31626 year = {1994}, 31627 volume = {67}, 31628 pages = {1--28} 31629} 31630 31631@Article{ luo.shu.ea:optimizing, 31632 author = {L. Luo and H. Shu and W. Yu and Y. Yan and X. Bao and Y. Fu}, 31633 title = {Optimizing computerized treatment planning for the Gamma Knife by source 31634 culling}, 31635 journal = {International Journal of Radiation Oncology, Biology and Physics}, 31636 year = {1999}, 31637 volume = {45}, 31638 number = {5}, 31639 pages = {1339--1346} 31640} 31641 31642@InProceedings{ luo.tseng:class, 31643 author = {Z.-Q. Luo and P. Tseng}, 31644 title = {A New Class of Merit Functions for the Nonlinear Complementarity Problem}, 31645 crossref = {ferris.pang:complementarity}, 31646 pages = {204--225} 31647} 31648 31649@Article{ luo.tseng:convergence, 31650 author = {Z.-Q. Luo and P. Tseng}, 31651 title = {On the Convergence of the Coordinate Descent Method for Convex Differentiable 31652 Minimization}, 31653 journal = {Journal of Optimization Theory and Applications}, 31654 year = {1992}, 31655 volume = {72}, 31656 pages = {7--35} 31657} 31658 31659@Article{ luo.tseng:convergence*1, 31660 author = {Z.-Q. Luo and P. Tseng}, 31661 title = {On the Convergence of a Matrix Splitting Algorithm for the Symmetric Monotone 31662 Linear Complementarity Problem}, 31663 journal = {SIAM Journal on Control and Optimization}, 31664 year = {1991}, 31665 volume = {29}, 31666 pages = {1037--1060} 31667} 31668 31669@Article{ luo.tseng:convergence*2, 31670 author = {Z.-Q. Luo and P. Tseng}, 31671 title = {On the Convergence Rate of Dual Ascent Methods for Strictly Convex Minimization}, 31672 journal = {Mathematics of Operations Research}, 31673 year = {1993}, 31674 volume = {18}, 31675 pages = {846--867} 31676} 31677 31678@Article{ luo.tseng:error, 31679 author = {Z.--Q. Luo and P. Tseng}, 31680 title = {Error Bound and Convergence Analysis of Matrix Splitting Algorithms for the 31681 Affine Variational Inequality Problem}, 31682 journal = {SIAM Journal on Optimization}, 31683 year = {1992}, 31684 volume = {2}, 31685 pages = {43--54} 31686} 31687 31688@Article{ luo.tseng:error*1, 31689 author = {Z.-Q. Luo and P. Tseng}, 31690 title = {Error Bound and Reduced Gradient Projection Algorithms for Convex Minimization 31691 Over a Polyhedral Set}, 31692 journal = {SIAM Journal on Optimization}, 31693 year = {1993}, 31694 volume = {3}, 31695 pages = {43--59} 31696} 31697 31698@Article{ luo.tseng:error*2, 31699 author = {Z.-Q. Luo and P. Tseng}, 31700 title = {Error Bounds and Convergence Analysis of Feasible Descent Methods: {A} General 31701 Approach}, 31702 journal = {Annals of Operations Research}, 31703 year = {1993}, 31704 volume = {46}, 31705 pages = {157--178} 31706} 31707 31708@Article{ luo.tseng:global, 31709 author = {Z.-Q. Luo and P. Tseng}, 31710 title = {On Global Error Bound for a Class of Monotone Affine Variational Inequality 31711 Problems}, 31712 journal = {Operations Research Letters}, 31713 year = {1992}, 31714 volume = {11}, 31715 pages = {159--165} 31716} 31717 31718@Article{ luo.tseng:linear, 31719 author = {Z.-Q. Luo and P. Tseng}, 31720 title = {On the linear convergence of descent methods for convex essentially smooth 31721 minimization}, 31722 journal = {SIAM Journal on Control and Optimization}, 31723 year = {1992}, 31724 volume = {30}, 31725 pages = {408--425} 31726} 31727 31728@TechReport{ luo:convergence, 31729 author = {Z.-Q. Luo}, 31730 title = {Convergence Analysis of Primal--Dual Interior--Point Algorithms for Convex 31731 Quadratic Programs}, 31732 institution = {Communications Research Laboratory, McMaster University}, 31733 year = {1992}, 31734 address = {Hamilton, Ontario} 31735} 31736 31737@Article{ lustig.marsten.ea:computational, 31738 author = {I. J. Lustig and R. E. Marsten and D. F. Shanno}, 31739 title = {Computational Experience with a Primal-Dual Interior Point Method for Linear 31740 Programming}, 31741 journal = {Linear Algebra and Its Applications}, 31742 year = {1991}, 31743 volume = {152}, 31744 pages = {191--222} 31745} 31746 31747@Article{ lustig.marsten.ea:implementing, 31748 author = {I. J. Lustig and R. E. Marsten and D. F. Shanno}, 31749 title = {On implementing {M}ehrotra's predictor-corrector interior point method for linear 31750 programming}, 31751 journal = {SIAM Journal on Optimization}, 31752 year = {1992}, 31753 volume = {2}, 31754 pages = {435--449} 31755} 31756 31757@Article{ lustig.marsten.ea:interior-point, 31758 author = {I. J. Lustig and R. E. Marsten and D. F. Shanno}, 31759 title = {Interior-Point Methods for Linear Programming: Computational State of the Art}, 31760 journal = {ORSA Journal on Computing}, 31761 year = {1994}, 31762 volume = {6}, 31763 number = {1}, 31764 pages = {1--38} 31765} 31766 31767@Article{ lyman.wolbarst:optimization, 31768 author = {J. T. Lyman and A. B. Wolbarst}, 31769 title = {Optimization of Radiation Therapy {IV}: {A} Dose Volume Histogram Reduction 31770 Algorithm}, 31771 journal = {International Journal of Radiation Oncology, Biology and Physics}, 31772 year = {1989}, 31773 volume = {17}, 31774 pages = {433--436} 31775} 31776 31777@Article{ mackie.holmes.ea:tomotherapy*1, 31778 author = {T. R. Mackie and T. Holmes and S. Swerdloff and P. Reckwerdt and J. O. Deasy and 31779 J. Yang and B. Paliwal and T. Kinsella}, 31780 title = {Tomotherapy: a new concept for the delivery of dynamic conformal radiotherapy}, 31781 journal = {Medical Physics}, 31782 year = {1993}, 31783 volume = {20}, 31784 number = {6}, 31785 pages = {1709--1719} 31786} 31787 31788@Article{ mackie.holmes.ea:tomotherapy*2, 31789 author = {T. R. Mackie and T. W. Holmes and P. J. Reckwerdt and J. Yang}, 31790 title = {Tomotherapy: Optimized Planning and Delivery of Radiation Therapy}, 31791 journal = {Int. J. of Imaging Systems and Technology}, 31792 year = {1995}, 31793 volume = {6}, 31794 pages = {43--55} 31795} 31796 31797@Article{ mackie.scrimger.ea:convolution, 31798 author = {T. R. Mackie and J. W. Scrimger and J. J. Batista}, 31799 title = {A convolution method of calculating dose from 15 Me{V} x-rays}, 31800 journal = {Medical Physics}, 31801 year = {1985}, 31802 volume = {12}, 31803 pages = {188--196} 31804} 31805 31806@Article{ mackinnon:technique, 31807 author = {James G. Mac{K}innon}, 31808 title = {A Technique for the Solution of Spatial Equilibrium Models}, 31809 journal = {Journal of Regional Science}, 31810 year = {1976}, 31811 volume = {16}, 31812 pages = {293--307} 31813} 31814 31815@PhDThesis{ madsen:minimization, 31816 author = {K. Madsen}, 31817 title = {Minimization of Nonlinear Approximation Functions}, 31818 year = {1985}, 31819 address = {Lyngby, Denmark}, 31820 school = {Institute of Numerical Analysis, Technical University of Denmark}, 31821 annote = {Dissertation} 31822} 31823 31824@Book{ magill.quinzii:theory, 31825 author = {M. Magill and M. Quinzii}, 31826 title = {Theory of Incomplete Markets}, 31827 publisher = {MIT Press}, 31828 year = {1996} 31829} 31830 31831@InCollection{ magnanti:models, 31832 author = {T. L. Magnanti}, 31833 title = {Models and Algorithms for Predicting Urban Traffic Equilibria}, 31834 booktitle = {Transportation Planning Models}, 31835 year = {1984}, 31836 editor = {M. Florian}, 31837 publisher = {North Holland}, 31838 pages = {153--186} 31839} 31840 31841@InCollection{ maguregui:modified, 31842 author = {J. Maguregui}, 31843 title = {A modified {N}ewton algorithm for functions over convex sets}, 31844 crossref = {mangasarian.meyer.ea:nonlinear*3}, 31845 pages = {461--473} 31846} 31847 31848@PhDThesis{ maguregui:regular, 31849 author = {J. Maguregui}, 31850 title = {Regular Multivalued Functions and Algorithmic Applications}, 31851 year = {1977}, 31852 address = {Madison, Wisconsin}, 31853 school = {Computer Sciences Department, University of Wisconsin} 31854} 31855 31856@Article{ mahey.oualibouch.ea:proximal, 31857 author = {P. Mahey and S. Oualibouch and D. T. Pham}, 31858 title = {Proximal Decomposition on the Graph of a Maximal Monotone Operator}, 31859 journal = {SIAM Journal on Optimization}, 31860 year = {1995}, 31861 volume = {5}, 31862 pages = {454--466} 31863} 31864 31865@Article{ mahey.pham:partial, 31866 author = {P. Mahey and D. T. Pham}, 31867 title = {Partial Regularization of the Sum of Two Maximal Monotone Operators}, 31868 journal = {{RAIRO} Mod\'{e}lisation et Analyse Num\'{e}rique}, 31869 year = {1993}, 31870 volume = {27}, 31871 pages = {375--392} 31872} 31873 31874@InCollection{ maier.novati:shakedown, 31875 author = {G. Maier and G. Novati}, 31876 title = {A shakedown and bounding theory allowing for nonlinear hardening and second order 31877 geometric effects with reference to discrete structural models}, 31878 editors = {J. A. K{\"{o}}nig and M. Kleiber}, 31879 booktitle = {Inelastic Solids and Structures, A. Sawczuk memorial volume}, 31880 publisher = {Pineridge Press}, 31881 address = {Swansea}, 31882 year = {1990}, 31883 pages = {451--471} 31884} 31885 31886@Article{ maier:incremental, 31887 author = {G. Maier}, 31888 title = {Incremental Plastic Analysis in the Presence of Large Displacement and Physical 31889 Instabilizing Effects}, 31890 journal = {International Journal of Solids and Structures}, 31891 volume = {7}, 31892 year = {1971}, 31893 pages = {345--372} 31894} 31895 31896@InCollection{ maier:inverse, 31897 author = {G. Maier}, 31898 title = {Inverse Problems in Engineering Plasticity: {A} Quadratic Programming Approach}, 31899 booktitle = {Serie VIII}, 31900 publisher = {Academia Nazionale dei Lincei}, 31901 year = {1981}, 31902 volume = {LXX}, 31903 pages = {203--209} 31904} 31905 31906@Article{ maier:matrix, 31907 author = {G. Maier}, 31908 title = {A matrix structural theory of piecewise linear elastoplasticity with interacting 31909 yield planes}, 31910 journal = {Meccanica}, 31911 volume = {5}, 31912 year = {1970}, 31913 pages = {54--66} 31914} 31915 31916@Article{ maier:quadratic, 31917 author = {G. Maier}, 31918 title = {A quadratic programming approach for certain classes of nonlinear structural 31919 problems}, 31920 journal = {Meccanica}, 31921 volume = {3}, 31922 year = {1968}, 31923 pages = {121--130} 31924} 31925 31926@Book{ manber:introduction, 31927 author = {U. Manber}, 31928 title = {Introduction to Algorithms: {A} Creative Approach}, 31929 year = {1989}, 31930 publisher = {Addison-Wesley} 31931} 31932 31933@Article{ mangasarian.deleone:error, 31934 author = {O. L. Mangasarian and R. {De~Leone}}, 31935 title = {Error Bounds for Strongly Convex Programs and (Super)linearly Convergent 31936 Iterative Schemes for the Least 2--norm Solution of Linear Programs}, 31937 journal = {Applied Mathematics and Optimization}, 31938 year = {1988}, 31939 volume = {17}, 31940 pages = {1--14} 31941} 31942 31943@Article{ mangasarian.deleone:parallel, 31944 author = {O. L. Mangasarian and R. {De~Leone}}, 31945 title = {Parallel Successive Overrelaxation Methods for Symmetric Linear Complementarity 31946 Problems and Linear Programs}, 31947 journal = {Journal of Optimization Theory and Applications}, 31948 year = {1987}, 31949 volume = {54}, 31950 pages = {437--446} 31951} 31952 31953@Article{ mangasarian.fromovitz:fritz, 31954 author = {O. L. Mangasarian and S. Fromovitz}, 31955 title = {The {F}ritz {J}ohn necessary optimality conditions in the presence of equality 31956 and inequality constraints}, 31957 journal = {Journal of Mathematical Analysis and its Applications}, 31958 year = {1967}, 31959 volume = {17}, 31960 pages = {37--47} 31961} 31962 31963@Article{ mangasarian.mclinden:simple, 31964 author = {O. L. Mangasarian and L. McLinden}, 31965 title = {Simple Bounds for Solutions of Monotone Complementarity Problems and Convex 31966 Programs}, 31967 journal = {Mathematical Programming}, 31968 year = {1985}, 31969 volume = {32}, 31970 pages = {32--40} 31971} 31972 31973@Article{ mangasarian.meyer:nonlinear, 31974 author = {O. L. Mangasarian and R. R. Meyer}, 31975 title = {Nonlinear Perturbation of Linear Programs}, 31976 journal = {SIAM Journal on Control and Optimization}, 31977 year = {1979}, 31978 volume = {17}, 31979 pages = {745--752} 31980} 31981 31982@TechReport{ mangasarian.musicant:active, 31983 author = {O. L. Mangasarian and David R. Musicant}, 31984 title = {Active Set Support Vector Machine Classification}, 31985 institution = {Data Mining Institute, Computer Sciences Department, University of Wisconsin}, 31986 year = {2000}, 31987 number = {00-04}, 31988 address = {Madison, Wisconsin} 31989} 31990 31991@TechReport{ mangasarian.musicant:lagrangian, 31992 author = {O. L. Mangasarian and D. R. Musicant}, 31993 title = {Lagrangian Support Vector Machines}, 31994 institution = {Data Mining Institute, Computer Sciences Department, University of Wisconsin}, 31995 year = {2000}, 31996 number = {00-06}, 31997 address = {Madison, Wisconsin} 31998} 31999 32000@TechReport{ mangasarian.musicant:robust, 32001 author = {O. L. Mangasarian and David R. Musicant}, 32002 title = {Robust Linear and Support Vector Regression}, 32003 institution = {Data Mining Institute, Computer Sciences Department, University of Wisconsin}, 32004 year = {1999}, 32005 number = {99-09}, 32006 address = {Madison, Wisconsin} 32007} 32008 32009@Article{ mangasarian.musicant:successive, 32010 author = {O. L. Mangasarian and David R. Musicant}, 32011 title = {Successive Overrelaxation for Support Vector Machines}, 32012 journal = {IEEE Transactions on Neural Networks}, 32013 volume = {10}, 32014 year = {1999}, 32015 pages = {1032-1037} 32016} 32017 32018@Article{ mangasarian.pang:exact, 32019 author = {O. L. Mangasarian and J. S. Pang}, 32020 title = {Exact Penalty Functions for Mathematical Programs with Linear Complementarity 32021 Constraints}, 32022 journal = {Optimization}, 32023 year = {1997}, 32024 volume = {42}, 32025 pages = {1--8} 32026} 32027 32028@Article{ mangasarian.pang:extended, 32029 author = {O. L. Mangasarian and J. S. Pang}, 32030 title = {The Extended Linear Complementarity Problem}, 32031 journal = {SIAM Journal on Matrix Analysis and Applications}, 32032 year = {1994}, 32033 volume = {16} 32034} 32035 32036@Article{ mangasarian.ren:error, 32037 author = {O. L. Mangasarian and J. Ren}, 32038 title = {New error bounds for the nonlinear complementarity problem}, 32039 year = {1994}, 32040 volume = {1}, 32041 pages = {49--56}, 32042 journal = {Communications on Applied Nonlinear Analysis} 32043} 32044 32045@Article{ mangasarian.ren:improved, 32046 author = {O. L. Mangasarian and J. Ren}, 32047 title = {New Improved Error Bounds for the Linear Complementarity Problem}, 32048 year = {1994}, 32049 volume = {66}, 32050 journal = {Mathematical Programming}, 32051 pages = {241--255} 32052} 32053 32054@InProceedings{ mangasarian.setiono.ea:pattern, 32055 crossref = {coleman.li:large-scale}, 32056 author = {O. L. Mangasarian and R. Setiono and W. H. Wolberg}, 32057 title = {Pattern Recognition via Linear Programming: Theory and Application to Medical 32058 Diagnosis}, 32059 pages = {22--31} 32060} 32061 32062@Article{ mangasarian.shiau:error, 32063 author = {O. L. Mangasarian and T.--H. Shiau}, 32064 title = {Error Bounds for Monotone Linear Complementarity Problems}, 32065 journal = {Mathematical Programming}, 32066 year = {1986}, 32067 volume = {36}, 32068 pages = {81--89} 32069} 32070 32071@Article{ mangasarian.shiau:lipschitz, 32072 author = {O. L. Mangasarian and T.--H. Shiau}, 32073 title = {{L}ipschitz Continuity of Solutions of Linear Inequalities, Programs and 32074 Complementarity Problems}, 32075 journal = {SIAM Journal on Control and Optimization}, 32076 year = {1987}, 32077 volume = {25}, 32078 pages = {583--595} 32079} 32080 32081@Article{ mangasarian.solodov:nonlinear, 32082 author = {O. L. Mangasarian and M. V. Solodov}, 32083 title = {Nonlinear Complementarity as Unconstrained and Constrained Minimization}, 32084 journal = {Mathematical Programming}, 32085 year = {1993}, 32086 volume = {62}, 32087 pages = {277--298} 32088} 32089 32090@Article{ mangasarian.solodov:serial, 32091 author = {O. L. Mangasarian and M. V. Solodov}, 32092 title = {Serial and Parallel Backpropagation Convergence via Nonmonotone Perturbed 32093 Minimization}, 32094 year = {1994}, 32095 journal = {Optimization Methods and Software}, 32096 volume = {4}, 32097 pages = {103--116} 32098} 32099 32100@Article{ mangasarian.street.ea:breast, 32101 author = {O. L. Mangasarian and W. N. Street and W. H. Wolberg}, 32102 title = {Breast Cancer Diagnosis and Prognosis via Linear Programming}, 32103 journal = {Operations Research}, 32104 year = {1995}, 32105 volume = {43}, 32106 pages = {570--577} 32107} 32108 32109@Article{ mangasarian.wolberg:cancer, 32110 author = {O. L. Mangasarian and W. H. Wolberg}, 32111 title = {Cancer Diagnosis via Linear Programming}, 32112 journal = {SIAM News}, 32113 year = {1990}, 32114 volume = {23}, 32115 pages = {1 \& 18} 32116} 32117 32118@InCollection{ mangasarian:applications, 32119 author = {O. L. Mangasarian}, 32120 title = {Some Applications of Penalty Functions in Mathematical Programming}, 32121 booktitle = {Optimization and Related Fields}, 32122 year = {1986}, 32123 editor = {R. Conti and E. De~Giorgi and F. Giannessi}, 32124 publisher = {Springer-Verlag}, 32125 address = {Heidelberg}, 32126 pages = {307--329}, 32127 note = {Lecture Notes in Mathematics 1190} 32128} 32129 32130@Article{ mangasarian:characterization, 32131 author = {O. L. Mangasarian}, 32132 title = {Characterization of linear complementarity problems as linear programs}, 32133 journal = {Mathematical Programming Study}, 32134 year = {1978}, 32135 volume = {7}, 32136 pages = {74--87} 32137} 32138 32139@InProceedings{ mangasarian:condition, 32140 author = {O. L. Mangasarian}, 32141 title = {A condition number for linear inequalities and linear programs}, 32142 booktitle = {Proceedings of 6. Symposium uber Operations Research, Augsburg, 7-9 September 32143 1981}, 32144 year = {1981}, 32145 editor = {G. Bamberg and O. Opitz}, 32146 publisher = {Verlagsgruppe Athenaum/Hain/Scriptor/Hanstein}, 32147 address = {Konigstein}, 32148 pages = {3--15} 32149} 32150 32151@Article{ mangasarian:convergence, 32152 author = {O. L. Mangasarian}, 32153 title = {On the Convergence of Iterates of an Inexact Matrix Splitting Algorithm for the 32154 Symmetric Monotone Linear Complementarity Problem}, 32155 journal = {SIAM Journal on Optimization}, 32156 volume = {1}, 32157 pages = {114--122}, 32158 year = {1991} 32159} 32160 32161@Article{ mangasarian:equivalence, 32162 author = {O. L. Mangasarian}, 32163 title = {Equivalence of the Complementarity Problem to a System of Nonlinear Equations}, 32164 journal = {SIAM Journal on Applied Mathematics}, 32165 year = {1976}, 32166 volume = {31}, 32167 pages = {89--92} 32168} 32169 32170@Article{ mangasarian:error, 32171 author = {O. L. Mangasarian}, 32172 title = {Error Bounds for Inconsistent Linear Inequalities and Programs}, 32173 journal = {ORSA Journal on Computing}, 32174 volume = {15}, 32175 pages = {187--192}, 32176 year = {1994} 32177} 32178 32179@Article{ mangasarian:error*1, 32180 author = {O. L. Mangasarian}, 32181 title = {Error Bounds for Nondegenerate Monotone Linear Complementarity Problems}, 32182 journal = {Mathematical Programming}, 32183 year = {1990}, 32184 volume = {48}, 32185 pages = {437--445} 32186} 32187 32188@Article{ mangasarian:generalized, 32189 author = {O. L. Mangasarian}, 32190 title = {Generalized Linear Complementarity Problems as Linear Programs}, 32191 journal = {Methods of Operations Research}, 32192 year = {1979}, 32193 editor = {W. Oettli and F. Steffens}, 32194 volume = {31}, 32195 pages = {393--402} 32196} 32197 32198@InCollection{ mangasarian:generalized*1, 32199 author = {O. L. Mangasarian}, 32200 title = {Generalized Support Vector Machines}, 32201 year = {2000}, 32202 pages = {135-146}, 32203 booktitle = {Advances in Large Margin Classifiers}, 32204 editor = {A. Smola and P.~Bartlett and B.~Sch{\"o}lkopf and D.~Schuurmans}, 32205 publisher = {MIT Press}, 32206 address = {Cambridge, MA} 32207} 32208 32209@Article{ mangasarian:global, 32210 author = {O. L. Mangasarian}, 32211 title = {Global error bounds for monotone affine variational inequality problems}, 32212 journal = {Linear Algebra and Its Applications}, 32213 year = {1992}, 32214 pages = {153--164} 32215} 32216 32217@InCollection{ mangasarian:least, 32218 author = {O. L. Mangasarian}, 32219 title = {Least Norm Solution of Non--Monotone Complementarity Problems}, 32220 booktitle = {Functional Analysis, Optimization and Mathematical Economics}, 32221 year = {1990}, 32222 publisher = {Oxford University Press}, 32223 address = {New York}, 32224 pages = {217--221} 32225} 32226 32227@Article{ mangasarian:least-norm, 32228 author = {O. L. Mangasarian}, 32229 title = {Least--Norm Linear Programming Solution as an Unconstrained Minimization 32230 Problem}, 32231 journal = {Journal of Mathematical Analysis and Applications}, 32232 year = {1983}, 32233 volume = {92}, 32234 pages = {240--251} 32235} 32236 32237@Article{ mangasarian:linear, 32238 author = {O. L. Mangasarian}, 32239 title = {Linear Complementarity Problems Solvable by a Single Linear Program}, 32240 journal = {Mathematical Programming}, 32241 year = {1976}, 32242 volume = {10}, 32243 pages = {263--270} 32244} 32245 32246@Article{ mangasarian:linear*1, 32247 author = {O. L. Mangasarian}, 32248 title = {Linear and Nonlinear Separation of Patterns by Linear Programming}, 32249 journal = {Operations Research}, 32250 year = {1965}, 32251 volume = {13}, 32252 pages = {444--452} 32253} 32254 32255@Article{ mangasarian:locally, 32256 author = {O. L. Mangasarian}, 32257 title = {Locally Unique Solutions of Quadratic Programs, Linear and Nonlinear 32258 Complementarity Problems}, 32259 journal = {Mathematical Programming}, 32260 year = {1980}, 32261 volume = {19}, 32262 pages = {200--212} 32263} 32264 32265@InCollection{ mangasarian:machine, 32266 author = {O. L. Mangasarian}, 32267 title = {Machine Learning via Polyhedral Concave Minimization}, 32268 editor = {H. Fischer and B. Riedmueller and S. Schaeffler}, 32269 booktitle = {Applied Mathematics and Parallel Computing - Festschrift for Klaus Ritter}, 32270 pages = {175-188}, 32271 year = {1996}, 32272 address = {Heidelberg}, 32273 publisher = {Physica-Verlag A Springer-Verlag Company} 32274} 32275 32276@Article{ mangasarian:mathematical, 32277 author = {O. L. Mangasarian}, 32278 title = {Mathematical Programming in Neural Networks}, 32279 journal = {ORSA Journal on Computing}, 32280 volume = {5}, 32281 pages = {349--360}, 32282 year = {1993} 32283} 32284 32285@InProceedings{ mangasarian:mathematical*1, 32286 author = {O. L. Mangasarian}, 32287 title = {Mathematical Programming in Machine Learning}, 32288 booktitle = {Nonlinear Optimization and Applications}, 32289 editor = {G. Di Pillo and F. Giannessi}, 32290 publisher = {Plenum Publishing}, 32291 address = {New York}, 32292 pages = {283--295}, 32293 year = {1996} 32294} 32295 32296@Article{ mangasarian:mathematical*2, 32297 author = {O. L. Mangasarian}, 32298 title = {Mathematical Programming in Data Mining}, 32299 journal = {Data Mining and Knowledge Discovery}, 32300 volume = {1}, 32301 year = {1997}, 32302 pages = {183-201} 32303} 32304 32305@Article{ mangasarian:multi-surface, 32306 author = {O. L. Mangasarian}, 32307 title = {Multi-surface Method of Pattern Separation}, 32308 journal = {IEEE Transactions on Information Theory}, 32309 year = {1968}, 32310 volume = {IT-14}, 32311 pages = {801--807} 32312} 32313 32314@Book{ mangasarian:nonlinear, 32315 author = {O. L. Mangasarian}, 32316 title = {Nonlinear Programming}, 32317 year = {1969}, 32318 publisher = {McGraw--Hill}, 32319 address = {New York}, 32320 note = {SIAM Classics in Applied Mathematics 10, SIAM, Philadelphia, 1994} 32321} 32322 32323@Article{ mangasarian:normal, 32324 author = {O. L. Mangasarian}, 32325 title = {Normal Solutions of Linear Programs}, 32326 journal = {Mathematical Programming Study}, 32327 year = {1984}, 32328 volume = {22}, 32329 pages = {206--216} 32330} 32331 32332@Article{ mangasarian:optimal, 32333 author = {O. L. Mangasarian}, 32334 title = {Optimal Simplex Tableau Characterization of Unique and Bounded Solutions of 32335 Linear Programs}, 32336 journal = {Journal of Optimization Theory and Applications}, 32337 year = {1981}, 32338 volume = {35}, 32339 pages = {123--128} 32340} 32341 32342@Article{ mangasarian:parallel, 32343 author = {O. L. Mangasarian}, 32344 title = {Parallel Gradient Distribution in Unconstrained Optimization}, 32345 journal = {SIAM Journal on Control and Optimization}, 32346 volume = {33}, 32347 pages = {1916--1925}, 32348 year = {1995} 32349} 32350 32351@TechReport{ mangasarian:regularized, 32352 author = {O. L. Mangasarian}, 32353 title = {Regularized Linear Programs with Equilibrium Constraints}, 32354 institution = {Computer Sciences Department, University of Wisconsin}, 32355 year = {1997}, 32356 address = {Madison, Wisconsin}, 32357 type = {Mathematical Programming Technical Report}, 32358 number = {97--13}, 32359 url = {ftp: //ftp.cs.wisc.edu/math-prog/tech-reports/97-13.ps} 32360} 32361 32362@Article{ mangasarian:simple, 32363 author = {O. L. Mangasarian}, 32364 title = {A Simple Characterization of Solution Sets of Convex Programs}, 32365 journal = {Operations Research Letters}, 32366 year = {1988}, 32367 volume = {7}, 32368 pages = {21--26} 32369} 32370 32371@Article{ mangasarian:solution, 32372 author = {O. L. Mangasarian}, 32373 title = {Solution of Symmetric Linear Complementarity Problems by Iterative Methods}, 32374 journal = {Journal of Optimization Theory and Applications}, 32375 year = {1977}, 32376 month = aug, 32377 volume = {22}, 32378 pages = {465--485} 32379} 32380 32381@Article{ mangasarian:stable, 32382 author = {O. L. Mangasarian}, 32383 title = {A Stable Theorem of the Alternative: An Extension of the {G}ordan Theorem}, 32384 journal = {Linear Algebra and Its Applications}, 32385 year = {1981}, 32386 volume = {41}, 32387 pages = {209--223} 32388} 32389 32390@Article{ mangasarian:sufficiency, 32391 author = {O. L. Mangasarian}, 32392 title = {Sufficiency of Exact Penalty Minimization}, 32393 journal = {SIAM Journal on Control and Optimization}, 32394 year = {1985}, 32395 month = jan, 32396 volume = {23}, 32397 pages = {30--37} 32398} 32399 32400@Article{ mangasarian:unconstrained, 32401 author = {O. L. Mangasarian}, 32402 title = {Unconstrained {L}agrangians in Nonlinear Programming}, 32403 journal = {SIAM Journal on Control and Optimization}, 32404 year = {1975}, 32405 volume = {13}, 32406 pages = {772--791} 32407} 32408 32409@Book{ manne.richels:buying, 32410 author = {A. S. Manne and R. G. Richels}, 32411 title = {Buying Greenhouse Insurance: The Economics of Carbon Dioxide Emission Limits}, 32412 publisher = {MIT Press}, 32413 year = {1992}, 32414 address = {Cambridge MA} 32415} 32416 32417@Article{ manne.richels:global, 32418 author = {A. S. Manne and R. G. Richels}, 32419 title = {Global {CO2} Emission Reductions - the Impacts of Rising Energy Costs}, 32420 journal = {The Energy Journal}, 32421 year = {1991}, 32422 volume = {12}, 32423 pages = {87--107} 32424} 32425 32426@Article{ manne.richels:international, 32427 author = {A. S. Manne and R. G. Richels}, 32428 title = {International Trade in Carbon Emission Rights: {A} Decomposition Procedure}, 32429 journal = {Economic Review}, 32430 year = {1991}, 32431 volume = {81}, 32432 pages = {135--139} 32433} 32434 32435@Article{ manne.rutherford:international, 32436 author = {A. S. Manne and T. F. Rutherford}, 32437 title = {International Trade in Oil, Gas and Carbon Emission Rights: An Intertemporal 32438 General Equilibrium Model}, 32439 journal = {The Energy Journal}, 32440 year = {1993}, 32441 volume = {14}, 32442 pages = {1--20} 32443} 32444 32445@InCollection{ manne:eta-macro, 32446 author = {A. S. Manne}, 32447 title = {{ETA}-{M}acro: {A} {M}odel of Energy-Economy Interactions}, 32448 booktitle = {Modeling Energy-Economy Interactions}, 32449 year = {1977}, 32450 editor = {C. J. Hitch}, 32451 publisher = {Resources for the Future}, 32452 address = {Washington DC} 32453} 32454 32455@PhDThesis{ maratos:exact, 32456 author = {N. Maratos}, 32457 title = {Exact Penalty Function Algorithms for Finite Dimensional and Control Optimization 32458 Problems}, 32459 year = {1978}, 32460 school = {Imperial College, University of London} 32461} 32462 32463@Article{ marcotte.dussault:note, 32464 author = {P. Marcotte and J.--P. Dussault}, 32465 title = {A Note on a Globally Convergent {N}ewton Method for Solving Monotone Variational 32466 Inequalities}, 32467 journal = {Operations Research Letters}, 32468 year = {1987}, 32469 volume = {6}, 32470 pages = {35--42} 32471} 32472 32473@Article{ marcotte.zhu:exact, 32474 author = {P. Marcotte and D. L. Zhu}, 32475 title = {Exact and Inexact Penalty Methods for the Generalized Bilevel Programming 32476 Problem}, 32477 journal = {Mathematical Programming}, 32478 year = {1996}, 32479 volume = {74}, 32480 pages = {141--158} 32481} 32482 32483@Article{ marcotte:algorithm, 32484 author = {P. Marcotte}, 32485 title = {A New Algorithm for Solving Variational Inequalities with Application to the 32486 Traffic Assignment Problem}, 32487 journal = {Mathematical Programming}, 32488 year = {1985}, 32489 volume = {33}, 32490 pages = {339--351} 32491} 32492 32493@Article{ marcotte:application, 32494 author = {P. Marcotte}, 32495 title = {Application of {K}hobotov's Algorithm to Variational Inequalities and Network 32496 Equilibrium Problems}, 32497 journal = {Information Systems and Operational Research}, 32498 year = {1991}, 32499 volume = {29}, 32500 pages = {258--270} 32501} 32502 32503@Article{ marcotte:network, 32504 author = {P. Marcotte}, 32505 title = {Network Design Problem with Congestion Effects: {A} Case of Bilevel Programming}, 32506 journal = {Mathematical Programming}, 32507 year = {1986}, 32508 volume = {34}, 32509 pages = {142--162} 32510} 32511 32512@Article{ markusen.rutherford.ea:el, 32513 author = {J. R. Markusen and T. F. Rutherford and L. Hunter}, 32514 title = {El libre comercio en {A}merica del {N}orte y la produccion de automoviles}, 32515 journal = {Cuadernos Economicos de Ice}, 32516 year = {1995}, 32517 volume = {59}, 32518 pages = {57--68} 32519} 32520 32521@Article{ markusen.rutherford.ea:trade, 32522 author = {J. R. Markusen and T. F. Rutherford and L. Hunter}, 32523 title = {Trade liberalization in a multinational-dominated industry}, 32524 journal = {Journal of International Economics}, 32525 year = {1995}, 32526 volume = {38}, 32527 pages = {95--118} 32528} 32529 32530@Article{ markusen.rutherford:discrete, 32531 author = {J. R. Markusen and T. F. Rutherford}, 32532 title = {Discrete plant-location decisions in an applied general equilibrium model of 32533 trade liberalization}, 32534 journal = {Weltwirtshchaftliches Archiv}, 32535 year = {1994} 32536} 32537 32538@Article{ markusen.wigle:nash, 32539 author = {J. Markusen and R. Wigle}, 32540 title = {Nash Equilibrium Tariffs for the {U}nited {S}tates and {C}anada: The Roles of 32541 Country Size, Scale Economies and Capital Mobility}, 32542 journal = {Journal of Political Mobility}, 32543 year = {1989}, 32544 volume = {97}, 32545 pages = {368--386} 32546} 32547 32548@Article{ marquardt:algorithm, 32549 author = {D. W. Marquardt}, 32550 title = {An Algorithm for Least--Squares Estimation of Nonlinear Parameters}, 32551 journal = {SIAM Journal on Applied Mathematics}, 32552 year = {1963}, 32553 volume = {11}, 32554 pages = {431--441} 32555} 32556 32557@Article{ martello.toth:algorithm, 32558 author = {S. Martello and P. Toth}, 32559 title = {A New Algorithm for the 0--1 Knapsack Problem}, 32560 journal = {Management Science}, 32561 year = {1988}, 32562 volume = {34}, 32563 pages = {633--644} 32564} 32565 32566@InCollection{ martello.toth:algorithms, 32567 author = {S. Martello and P. Toth}, 32568 title = {Algorithms for Knapsack Problems}, 32569 booktitle = {Surveys in Combinatorial Optimization}, 32570 year = {1987}, 32571 editor = {S. Martello and G. Laporte and M. Minoux and C. Ribeiro}, 32572 publisher = {Annals of Discrete Mathematics 31, North--Holland}, 32573 address = {Amsterdam} 32574} 32575 32576@Article{ martello.toth:mixture, 32577 author = {S. Martello and P. Toth}, 32578 title = {A Mixture of Dynamic Programming and Branch--and--Bound for the Subset--Sum 32579 Problem}, 32580 journal = {Management Science}, 32581 year = {1984}, 32582 volume = {30}, 32583 pages = {765--771} 32584} 32585 32586@Article{ martello.toth:worst-case, 32587 author = {S. Martello and P. Toth}, 32588 title = {Worst--Case Analysis of Greedy Algorithms for the Subset Sum Problem}, 32589 journal = {Mathematical Programming}, 32590 year = {1984}, 32591 volume = {28}, 32592 pages = {198--205} 32593} 32594 32595@Article{ martinet:regularisation, 32596 author = {Bernard Martinet}, 32597 title = {Regularisation d'Inequations Variationelles par Approximations Successives}, 32598 journal = {Revue Fran\c{c}aise d'Informatique et Recherche Operationelle}, 32599 year = {1970}, 32600 volume = {4}, 32601 pages = {154--159} 32602} 32603 32604@Article{ maskin.tirole:theory, 32605 author = {E. Maskin and J. Tirole}, 32606 title = {A theory of Dynamic Oligopoly, {I}: Overview and quantity competition with large 32607 fixed costs}, 32608 journal = {Econometrica}, 32609 volume = {56}, 32610 year = {1988}, 32611 pages = {549--569} 32612} 32613 32614@Article{ maskin.tirole:theory*1, 32615 author = {E. Maskin and J. Tirole}, 32616 title = {A theory of Dynamic Oligopoly, {II}: Price competition, Kinked demand curves, and 32617 Edgeworth cycles}, 32618 journal = {Econometrica}, 32619 volume = {56}, 32620 year = {1988}, 32621 pages = {571--579} 32622} 32623 32624@Article{ maskus.rutherford.ea:economic, 32625 author = {K. Maskus and T. F. Rutherford and S. Selby}, 32626 title = {Economic Implications of Changes in Labor Standards: a Computational Analysis for 32627 {M}exico}, 32628 journal = {North American Journal of Economics and Finance}, 32629 year = {1996} 32630} 32631 32632@Article{ mastor:experimental, 32633 author = {A. A. Mastor}, 32634 title = {An Experimental Investigation and Comparative Evaluation of Production Line 32635 Balancing Techniques}, 32636 journal = {Management Science}, 32637 year = {1970}, 32638 volume = {16}, 32639 pages = {728--746} 32640} 32641 32642@Article{ mathias.pang:error, 32643 author = {R. Mathias and J. S. Pang}, 32644 title = {Error bounds for the linear complementarity problem with a {P}-matrix}, 32645 journal = {Linear Algebra and Its Applications}, 32646 year = {1990}, 32647 volume = {132}, 32648 pages = {123--136} 32649} 32650 32651@Article{ mathiesen:algorithm, 32652 author = {L. Mathiesen}, 32653 title = {An Algorithm based on a Sequence of Linear Complementarity Problems applied to a 32654 {W}alrasian Equilibrium Model: An Example}, 32655 journal = {Mathematical Programming}, 32656 year = {1987}, 32657 volume = {37}, 32658 pages = {1--18} 32659} 32660 32661@Article{ mathiesen:computation, 32662 author = {L. Mathiesen}, 32663 title = {Computation of Economic Equilibria by a Sequence of Linear Complementarity 32664 Problems}, 32665 journal = {Mathematical Programming Study}, 32666 year = {1985}, 32667 volume = {23}, 32668 pages = {144--162} 32669} 32670 32671@Article{ mathiesen:computational, 32672 author = {L. Mathiesen}, 32673 title = {Computational Experience in Solving Equilibrium Models by a Sequence of Linear 32674 Complementarity Problems}, 32675 journal = {Operations Research}, 32676 year = {1985}, 32677 volume = {33}, 32678 pages = {1225--1250} 32679} 32680 32681@Book{ matlab:users, 32682 author = {{MATLAB}}, 32683 title = {User's Guide}, 32684 year = {1992}, 32685 publisher = {The MathWorks, Inc.} 32686} 32687 32688@Book{ mcclelland.rummelhart:explorations, 32689 author = {J. L. McClelland and D. E. Rummelhart}, 32690 title = {Explorations in Parallel Distributed Processing: {A} Handbook of Models, 32691 Programs, and Exercises}, 32692 year = {1987}, 32693 publisher = {MIT Press}, 32694 address = {Cambridge, Massachusetts} 32695} 32696 32697@Article{ mccormick:modification, 32698 author = {G. P. McCormick}, 32699 title = {A Modification of {A}rmijo's Step--Size Rule for Negative Curvature}, 32700 journal = {Mathematical Programming}, 32701 year = {1977}, 32702 volume = {13}, 32703 pages = {111--115} 32704} 32705 32706@Book{ mccormick:nonlinear, 32707 author = {G. P. McCormick}, 32708 title = {Nonlinear Programming: Theory, Algorithms and Applications}, 32709 year = {1983}, 32710 publisher = {John Wiley \& Sons}, 32711 address = {New York} 32712} 32713 32714@Article{ mcculloch.pitts:logical, 32715 author = {W. McCulloch and W. Pitts}, 32716 title = {A Logical Calculus of the Ideas Immanent in Nervous Activity}, 32717 journal = {Bulletin of Mathematical Biophysics}, 32718 year = {1943}, 32719 volume = {7}, 32720 pages = {115--133} 32721} 32722 32723@TechReport{ mckenna.zenios:optimal, 32724 author = {M. McKenna and S. A. Zenios}, 32725 title = {An Optimal Parallel Implementation of a Quadratic Transportation Algorithm}, 32726 institution = {Thinking Machines Corporation}, 32727 year = {1990}, 32728 type = {Working Paper}, 32729 address = {Cambridge, MA} 32730} 32731 32732@Article{ mckinnon:convergence, 32733 author = {K. I. M. McKinnon}, 32734 title = {Convergence of the {N}elder-{M}ead Simplex Method to a Nonstationary Point}, 32735 journal = {SIAM Journal on Optimization}, 32736 year = {1998}, 32737 volume = {9}, 32738 pages = {148--158} 32739} 32740 32741@Article{ mcshane.monma.ea:implementation, 32742 author = {K. A. McShane and C. L. Monma and D. F. Shanno}, 32743 title = {An implementation of a primal-dual interior point method for linear programming}, 32744 journal = {ORSA Journal of Computing}, 32745 year = {1989}, 32746 volume = {1}, 32747 pages = {70--83} 32748} 32749 32750@PhDThesis{ medhi:decomposition, 32751 author = {D. Medhi}, 32752 title = {Decomposition of Structured Large--Scale Optimization Problems and Parallel 32753 Optimization}, 32754 school = {Computer Sciences Department, University of Wisconsin}, 32755 year = {1987}, 32756 address = {Madison, Wisconsin}, 32757 note = {Technical Report 718} 32758} 32759 32760@Article{ medhi:parallel, 32761 author = {D. Medhi}, 32762 title = {Parallel Bundle-Based Decomposition for Large-Scale Structured Mathematical 32763 Programming Problems}, 32764 journal = {Annals of Operations Research}, 32765 year = {1990}, 32766 volume = {22}, 32767 pages = {101--127} 32768} 32769 32770@Article{ megiddo:complexity, 32771 author = {N. Megiddo}, 32772 title = {On the complexity of polyhedral separability}, 32773 journal = {Discrete and Computational Geometry}, 32774 year = {1988}, 32775 volume = {3}, 32776 pages = {325--337} 32777} 32778 32779@Article{ megiddo:finding, 32780 author = {N. Megiddo}, 32781 title = {On Finding Primal-- and Dual--Optimal Bases}, 32782 journal = {ORSA Journal on Computing}, 32783 year = {1991}, 32784 volume = {3}, 32785 pages = {63--65} 32786} 32787 32788@Article{ mehrotra:implementation, 32789 author = {S. Mehrotra}, 32790 title = {On the implementation of a primal-dual interior point method}, 32791 journal = {SIAM Journal on Optimization}, 32792 year = {1992}, 32793 volume = {2}, 32794 pages = {575--601} 32795} 32796 32797@PhDThesis{ merrill:applications, 32798 author = {O. H. Merrill}, 32799 title = {Application and Extensions of an Algorithm that Computes Fixed Points of Upper 32800 Semicontinuous Point to Set Mappings}, 32801 year = {1972}, 32802 school = {University of Michigan} 32803} 32804 32805@Article{ merten.muller:variance, 32806 author = {A. G. Merten and M. E. Muller}, 32807 title = {Variance Minimization in Single Machine Sequencing Problems}, 32808 journal = {Management Science}, 32809 year = {1972}, 32810 volume = {18}, 32811 pages = {518--528} 32812} 32813 32814@TechReport{ meyer:continuity, 32815 author = {R. R. Meyer}, 32816 title = {Continuity Properties of Linear Programs}, 32817 institution = {Computer Sciences Department, University of Wisconsin}, 32818 year = {1979}, 32819 address = {Madison, Wisconsin}, 32820 number = {373} 32821} 32822 32823@Article{ miersemann.mittelmann:continuation, 32824 author = {E. Miersemann and H. D. Mittelmann}, 32825 title = {Continuation for Parametrized Nonlinear Variational Inequalities}, 32826 journal = {Journal of Computational and Applied Mathematics}, 32827 year = {1989}, 32828 volume = {26}, 32829 pages = {23--34} 32830} 32831 32832@Article{ mifflin:semismooth, 32833 author = {R. Mifflin}, 32834 title = {Semismooth and semiconvex functions in constrained optimization}, 32835 journal = {SIAM Journal on Control and Optimization}, 32836 year = {1977}, 32837 volume = {15}, 32838 pages = {957--972} 32839} 32840 32841@Article{ mifflin:stable, 32842 author = {R. Mifflin}, 32843 title = {A Stable Method for Solving Certain Constrained Least Squares Problems}, 32844 journal = {Mathematical Programming}, 32845 vol = {16}, 32846 pages = {141--158}, 32847 year = {1979} 32848} 32849 32850@Book{ miller:survival, 32851 author = {Jr. R. G. Miller}, 32852 title = {Survival Analysis}, 32853 year = {1981}, 32854 publisher = {John Wiley \& Sons}, 32855 address = {New York} 32856} 32857 32858@Book{ minsky.papert:perceptrons, 32859 author = {M. Minsky and S. Papert}, 32860 title = {Perceptrons: An Introduction to Computational Geometry}, 32861 year = {1969}, 32862 publisher = {MIT Press}, 32863 address = {Cambridge, Massachusetts} 32864} 32865 32866@Article{ minty:monotone, 32867 author = {G. J. Minty}, 32868 title = {Monotone (Nonlinear) Operators in {H}ilbert Space}, 32869 journal = {Duke Mathematics Journal}, 32870 year = {1962}, 32871 volume = {29}, 32872 pages = {341--346} 32873} 32874 32875@Article{ minty:monotonicity, 32876 author = {G. J. Minty}, 32877 title = {On the Monotonicity of the Gradient of a Convex Function}, 32878 journal = {Pacific Journal of Mathematics}, 32879 year = {1964}, 32880 volume = {14}, 32881 pages = {243--247} 32882} 32883 32884@TechReport{ mizuno.jarre.ea:unified, 32885 author = {S. Mizuno and F. Jarre and J. Stoer}, 32886 title = {A Unified approach to infeasible--interior--point algorithms via geometrical 32887 linear complementarity problems}, 32888 institution = {Mathematische Institut der Universit{\"{a}}t W{\"{u}}rzburg}, 32889 address = {W{\"{u}}rzburg, Germany}, 32890 year = {1994}, 32891 number = {Nr. 213}, 32892 type = {Preprint} 32893} 32894 32895@TechReport{ mizuno:polynomiality, 32896 author = {S. Mizuno}, 32897 title = {Polynomiality of {K}ojima-{M}egiddo-{M}izuno infeasible-interior-point algorithm 32898 for linear programming}, 32899 institution = {School of Operations Research and Industrial Engineering, Cornell University}, 32900 year = {1993}, 32901 number = {1006}, 32902 address = {Ithaca, New York}, 32903 month = jan 32904} 32905 32906@Article{ mohan.mageras.ea:clinically, 32907 author = {R. Mohan and G. S. Mageras and B. Baldwin and L. J. Brewster and G. J. Kutcher 32908 and S. Leibel and C. M. Burman and C. C. Ling and Z. Fuks}, 32909 title = {Clinically Relevant Optimization of 3-{D} Conformal Treatments}, 32910 journal = {Medical Physics}, 32911 year = {1992}, 32912 volume = {19}, 32913 number = {4}, 32914 pages = {933--944} 32915} 32916 32917@Article{ mohan:field, 32918 author = {R. Mohan}, 32919 title = {Field Shaping for Three-Dimensional Conformal Radiation Therapy and Multileaf 32920 Collimation}, 32921 journal = {Seminars in Radiation Oncology}, 32922 year = {1995}, 32923 volume = {5}, 32924 number = {2}, 32925 pages = {86--99} 32926} 32927 32928@Article{ monteiro.pang.ea:positive, 32929 author = {R. D. C. Monteiro and J. S. Pang and T. Wang}, 32930 title = {A Positive Algorithm for the Nonlinear Complementarity Problem}, 32931 journal = {SIAM Journal on Optimization}, 32932 year = {1995}, 32933 volume = {5}, 32934 pages = {129--148} 32935} 32936 32937@Article{ monteiro.tsuchiya:limiting, 32938 author = {R. D. C. Monteiro and T. Tsuchiya}, 32939 title = {Limiting Behavior of the Derivatives of Certain Trajectories Associated with a 32940 Monotone Horizontal Linear Complementarity Problem}, 32941 year = {1996}, 32942 journal = {Mathematics of Operations Research}, 32943 pages = {793--814}, 32944 volume = {21} 32945} 32946 32947@Article{ monteiro.wright:local, 32948 author = {R. D. C. Monteiro and S. J. Wright}, 32949 title = {Local Convergence of Interior--Point Algorithms for Degenerate {LCP}}, 32950 journal = {Computational Optimization and Applications}, 32951 year = {1994}, 32952 volume = {3}, 32953 pages = {131--155} 32954} 32955 32956@Article{ monteiro.wright:superlinear, 32957 author = {R. D. C. Monteiro and S. J. Wright}, 32958 title = {A Superlinear Infeasible-Interior-Point Affine Scaling Algorithm for {LCP}}, 32959 year = {1996}, 32960 journal = {SIAM Journal on Optimization}, 32961 volume = {6}, 32962 pages = {1--18} 32963} 32964 32965@Article{ monteiro.wright:superlinear*1, 32966 author = {R. D. C. Monteiro and S. J. Wright}, 32967 title = {Superlinear Primal-Dual Affine Scaling Algorithms for {LCP}}, 32968 journal = {Mathematical Programming}, 32969 year = {1995}, 32970 volume = {69}, 32971 pages = {311--333} 32972} 32973 32974@Article{ more.garbow.ea:testing, 32975 author = {J. J. Mor\'{e} and B. S. Garbow and K. E. Hillstrom}, 32976 title = {Testing Unconstrained Optimization Software}, 32977 journal = {ACM Transactions on Mathematical Software}, 32978 year = {1981}, 32979 volume = {7}, 32980 pages = {17--41} 32981} 32982 32983@Article{ more.rheinboldt:p, 32984 author = {J. J. Mor\'{e} and W. C. Rheinboldt}, 32985 title = {On {P}-- and {S}--functions and Related Classes of {N}--Dimensional Nonlinear 32986 Mappings}, 32987 journal = {Linear Algebra and Its Applications}, 32988 year = {1973}, 32989 volume = {6}, 32990 pages = {45--68} 32991} 32992 32993@Article{ more.sorensen:use, 32994 author = {J. J. Mor\'{e} and D. C. Sorensen}, 32995 title = {On the use of Directions of Negative Curvature in a Modified {N}ewton Method}, 32996 journal = {Mathematical Programming}, 32997 year = {1979}, 32998 volume = {16}, 32999 pages = {1--20} 33000} 33001 33002@Article{ more.sorensen:computing, 33003 author = {J. J. Mor\'{e} and D. C. Sorensen}, 33004 title = {Computing a Trust Region Step}, 33005 journal = {SIAM Journal on Scientific and Statistical Computing}, 33006 year = {1983}, 33007 volume = {4}, 33008 pages = {553--572} 33009} 33010 33011@Article{ more.toraldo:solution, 33012 author = {J. J. Mor\'e and G. Toraldo}, 33013 title = {On the Solution of Large Quadratic Programming Problems with Bound Constraints}, 33014 journal = {SIAM Journal on Optimization}, 33015 year = {1991}, 33016 volume = {1}, 33017 pages = {93--113} 33018} 33019 33020@TechReport{ more.vavasis:solution, 33021 author = {J. J. Mor\'{e} and S. A. Vavasis}, 33022 title = {On the Solution of Concave Knapsack Problems}, 33023 institution = {Argonne National Laboratory}, 33024 year = {1988}, 33025 address = {Argonne, Illinois}, 33026 number = {ANL/MCS--P40--1288}, 33027 type = {Mathematics and Computer Science Division Report} 33028} 33029 33030@Book{ more.wright:optimization, 33031 author = {J. J. Mor\'{e} and S. J. Wright}, 33032 title = {Optimization Software Guide}, 33033 publisher = {SIAM}, 33034 address = {Philadelphia, Pennsylvania}, 33035 series = {Frontiers in Applied Mathematics}, 33036 number = {14}, 33037 year = {1993} 33038} 33039 33040@TechReport{ more.wu:global, 33041 author = {J. J. Mor\'{e} and Z. Wu}, 33042 title = {Global Continuation for Distance Geometry Problems}, 33043 institution = {Argonne National Laboratory}, 33044 year = {1995}, 33045 type = {Preprint}, 33046 number = {MCS-P505-0395}, 33047 address = {Argonne, Illinois} 33048} 33049 33050@TechReport{ more.wu:issues, 33051 author = {J. J. Mor\'{e} and Z. Wu}, 33052 title = {Issues in Large-Scale Global Molecular Optimization}, 33053 institution = {Argonne National Laboratory}, 33054 year = {1995}, 33055 type = {Preprint}, 33056 number = {MCS-P539-1095}, 33057 address = {Argonne, Illinois} 33058} 33059 33060@TechReport{ more:collection, 33061 author = {J. J. Mor\'e}, 33062 title = {A Collection of Nonlinear Model Problems}, 33063 institution = {Argonne National Laboratory}, 33064 year = {1989}, 33065 type = {Preprint}, 33066 address = {Argonne, Illinois}, 33067 number = {MCS-P60-0289} 33068} 33069 33070@Article{ more:global, 33071 author = {J. J. Mor\'e}, 33072 title = {Global Methods for Nonlinear Complementarity Problems}, 33073 year = {1996}, 33074 journal = {Mathematics of Operations Research}, 33075 pages = {589--614}, 33076 volume = {21} 33077} 33078 33079@Article{ moreau:proximite, 33080 author = {J.--J. Moreau}, 33081 title = {Proximit\'{e} et Dualit\'{e} dans un Espace {H}ilbertien}, 33082 journal = {Bulletin de la Soci\'{e}t\'{e} Math\'{e}matique de France}, 33083 year = {1965}, 33084 volume = {93}, 33085 pages = {273--299} 33086} 33087 33088@Article{ morrill.lane.ea:dose-volume, 33089 author = {S. Morrill and R. Lane and J. Wong and I. Rosen}, 33090 title = {Dose-volume considerations with linear programming}, 33091 journal = {Medical Physics}, 33092 year = {1991}, 33093 volume = {18}, 33094 number = {6}, 33095 pages = {1201--1210} 33096} 33097 33098@Article{ morrill:very, 33099 author = {S. M. Morrill and K. S. Lam and R. G. Lane and M. Langer and I. I. Rosen}, 33100 title = {Very Fast Simulated Annealing in Radiation Therapy Treatment Plan Optimization}, 33101 journal = {International Journal of Radiation Oncology, Biology and Physics}, 33102 year = {1995}, 33103 volume = {31}, 33104 pages = {179--188} 33105} 33106 33107@TechReport{ morshedi.tapia:karmarkar, 33108 author = {A. M. Morshedi and R. A. Tapia}, 33109 title = {Karmarkar as a Classical Method}, 33110 institution = {Department of Mathematical Sciences, Rice University}, 33111 year = {1987}, 33112 number = {87--7}, 33113 type = {Technical Report} 33114} 33115 33116@Article{ mosco:dual, 33117 author = {U. Mosco}, 33118 title = {Dual Variational Inequalities}, 33119 journal = {Journal of Mathematical Analysis and its Applications}, 33120 year = {1972}, 33121 volume = {40}, 33122 pages = {202--206} 33123} 33124 33125@Article{ motzkin.schoenberg:relaxation, 33126 author = {T. S. Motzkin and I. J. Schoenberg}, 33127 title = {The relaxation method for linear inequalities}, 33128 journal = {Canadian Journal of Mathematics}, 33129 year = {1954}, 33130 volume = {6}, 33131 pages = {393--404} 33132} 33133 33134@InProceedings{ muhlenbein:parallel, 33135 crossref = {schaeffer:third}, 33136 author = {H. M{\"{}u}hlenbein}, 33137 title = {Parallel Genetic Algorithms, Population Genetics and Combinatorial Optimization}, 33138 pages = {416--421} 33139} 33140 33141@Article{ mukhopadhyay.roy.ea:polynomial, 33142 author = {S. Mukhopadhyay and A. Roy and S. Govil}, 33143 title = {A polynomial time algorithm for generating neural networks for pattern 33144 classification: Its stability properties and some test results}, 33145 journal = {Neural Computation}, 33146 year = {1993}, 33147 volume = {5}, 33148 pages = {317--330} 33149} 33150 33151@Article{ mulvey.ruszczynski:diagonal, 33152 author = {J. M. Mulvey and A. Ruszczynski}, 33153 title = {A Diagonal Quadratic Approximation Methods for Large Scale Linear Programs}, 33154 journal = {Operations Research Letters}, 33155 year = {1992}, 33156 volume = {12}, 33157 pages = {205--215} 33158} 33159 33160@TechReport{ mulvey.ruszczynski:scenario, 33161 author = {J. M. Mulvey and A. Ruszczynski}, 33162 title = {A New Scenario Decomposition Method for Large--Scale Stochastic Optimization}, 33163 institution = {Department of Civil Engineering and Operations Research, Princeton University}, 33164 year = {1991}, 33165 address = {Princeton, New Jersey}, 33166 number = {SOR 91-19}, 33167 type = {Technical Report} 33168} 33169 33170@PhDThesis{ munson:algorithms, 33171 author = {T. S. Munson}, 33172 title = {Algorithms and Environments for Complementarity}, 33173 school = {University of Wisconsin--Madison}, 33174 year = {2000}, 33175 address = {Madison, Wisconsin}, 33176 month = aug, 33177 url = {ftp: //ftp.cs.wisc.edu/math-prog/tech-reports/00-02.ps} 33178} 33179 33180@Article{ munson.facchinei.ea:semismooth, 33181 author = {T. S. Munson and F. Facchinei and M. C. Ferris and A. Fischer and C. Kanzow}, 33182 title = {The Semismooth Algorithm for Large Scale Complementarity Problems}, 33183 journal = {INFORMS Journal on Computing}, 33184 year = {2001}, 33185 volume = {forthcoming} 33186} 33187 33188@Article{ murchland:braess, 33189 author = {J. D. Murchland}, 33190 title = {Braess' Paradox of Traffic Flow}, 33191 journal = {Transportation Research}, 33192 year = {1970}, 33193 volume = {4}, 33194 pages = {391--394} 33195} 33196 33197@Unpublished{ murphy.aha:uci, 33198 author = {P. M. Murphy and D. W. Aha}, 33199 title = {{UCI} Repository of Machine Learning Databases}, 33200 year = {1992}, 33201 note = {Department of Information and Computer Science, University of California, Irvine, 33202 California, http://www.ics.uci.edu/AI/ML/MLDBRepository.html} 33203} 33204 33205@Book{ murphy.lawrence.ea:american, 33206 editor = {G. P. Murphy and W. L. Lawrence and R. E. Lenhard}, 33207 title = {American Cancer Society Textbook of Clinical Oncology}, 33208 publisher = {The American Cancer Society, Inc.}, 33209 address = {Atlanta, Georgia}, 33210 year = {1995} 33211} 33212 33213@Article{ murphy.sherali.ea:mathematical, 33214 author = {Frederic H. Murphy and Hanif D. Sherali and Allen L. Soyster}, 33215 title = {A Mathematical Programming Approach for Determining Oligopolistic Market 33216 Equilibrium}, 33217 journal = {Mathematical Programming}, 33218 year = {1982}, 33219 volume = {24}, 33220 pages = {92--106} 33221} 33222 33223@TechReport{ murtagh.saunders:minos, 33224 author = {B. A. Murtagh and M. A. Saunders}, 33225 title = {{MINOS} 5.0 User's Guide}, 33226 institution = {Stanford University}, 33227 address = {Stanford, California}, 33228 year = {1983}, 33229 number = {{SOL} 83.20}, 33230 type = {Technical Report} 33231} 33232 33233@InProceedings{ murthy.kasif.ea:oc1, 33234 author = {S. Murthy and S. Kasif and S. Salzberg and R. Beigel}, 33235 title = {{OC1}: Randomized Induction of Oblique Decision Trees}, 33236 booktitle = {Proceedings of the Eleventh National Conference on Artificial Intelligence}, 33237 year = {1993}, 33238 publisher = {The AAAI Press/The MIT Press}, 33239 address = {Cambridge, MA 02142}, 33240 pages = {322--327} 33241} 33242 33243@Book{ murty:linear, 33244 author = {K. G. Murty}, 33245 title = {Linear Complementarity, Linear and Nonlinear Programming}, 33246 year = {1988}, 33247 publisher = {Helderman-Verlag}, 33248 address = {Berlin} 33249} 33250 33251@Book{ murty:linear*1, 33252 author = {K. G. Murty}, 33253 title = {Linear Programming}, 33254 year = {1983}, 33255 publisher = {John Wiley \& Sons}, 33256 address = {New York} 33257} 33258 33259@Article{ murty:number, 33260 author = {K. G. Murty}, 33261 title = {On the number of solutions of the complementarity problem and spanning properties 33262 of cones}, 33263 journal = {Linear Algebra and Its Applications}, 33264 year = {1972}, 33265 volume = {5}, 33266 pages = {65--108} 33267} 33268 33269@Book{ murty:linear*2, 33270 author = {K. G. Murty}, 33271 title = {Linear and Combinatorial Programming}, 33272 year = {1976}, 33273 publisher = {John Wiley \& Sons}, 33274 address = {New York} 33275} 33276 33277@Book{ nagurney:network, 33278 author = {A. Nagurney}, 33279 title = {Network Economics -- {A} Variational Inequality Approach}, 33280 publisher = {Kluwer Academic Publishers}, 33281 year = {1993}, 33282 address = {Dordrecht, The Netherlands} 33283} 33284 33285@Article{ nash.nocedal:numerical, 33286 author = {S. G. Nash and J. Nocedal}, 33287 title = {A Numerical Study of the Limited Memory {BFGS} Method and the Truncated-{N}ewton 33288 Method for Large Scale Optimization}, 33289 journal = {SIAM Journal on Optimization}, 33290 year = {1991}, 33291 volume = {3}, 33292 pages = {358--372} 33293} 33294 33295@Article{ nash:equilibrium, 33296 author = {J. F. Nash}, 33297 title = {Equilibrium Points in {N}--Person Games}, 33298 journal = {Proceedings of the National Academy of Sciences}, 33299 year = {1950}, 33300 volume = {36}, 33301 pages = {48--49} 33302} 33303 33304@Article{ nash:non-cooperative, 33305 author = {J. F. Nash}, 33306 title = {Non-cooperative games}, 33307 journal = {Annals of Mathematics}, 33308 year = {1951}, 33309 volume = {54}, 33310 pages = {286--295} 33311} 33312 33313@Article{ nash:newton-type, 33314 author = {S. G. Nash}, 33315 title = {{N}ewton--Type Minimization via {L}anczos Method}, 33316 journal = {SIAM Journal on Numerical Analysis}, 33317 year = {1984}, 33318 volume = {21}, 33319 pages = {770--788} 33320} 33321 33322@Article{ nauss:efficient, 33323 author = {R. M. Nauss}, 33324 title = {An Efficient Algorithm for the 0--1 Knapsack Problem}, 33325 journal = {Management Science}, 33326 year = {1976}, 33327 volume = {23}, 33328 pages = {27--31} 33329} 33330 33331@Book{ nazareth:computer, 33332 author = {J. L. Nazareth}, 33333 title = {Computer Solution of Linear Programs}, 33334 year = {1987}, 33335 publisher = {Oxford University Press}, 33336 address = {Oxford} 33337} 33338 33339@Article{ nelder.mead:simplex, 33340 title = {A Simplex Method for Function Minimization}, 33341 author = {J. A. Nelder and R. Mead}, 33342 journal = {Computer Journal}, 33343 volume = {7}, 33344 pages = {308--313}, 33345 year = {1965} 33346} 33347 33348@Article{ nemhauser.savelsbergh.ea:minto, 33349 author = {G. L. Nemhauser and M. W. P. Savelsbergh and G. S. Sigismondi}, 33350 title = {{MINTO}, {A} Mixed Integer Optimizer}, 33351 journal = {Operations Research Letters}, 33352 year = {1994}, 33353 optkey = {}, 33354 optvolume = {15}, 33355 optnumber = {}, 33356 optpages = {47--58}, 33357 optmonth = {}, 33358 optnote = {}, 33359 optannote = {} 33360} 33361 33362@Book{ nemhauser.wolsey:integer, 33363 author = {G. L. Nemhauser and L. A. Wolsey}, 33364 title = {Integer and Combinatorial Optimization}, 33365 publisher = {John Wiley \& Sons}, 33366 year = {1988}, 33367 address = {New York, NY} 33368} 33369 33370@Article{ nestor.pasurka:alternative, 33371 author = {D. Vaughn Nestor and C. Pasurka}, 33372 title = {Alternative Specifications for Environmental Control Costs in a General 33373 Equilibrium Framework}, 33374 journal = {Economics Letters}, 33375 year = {1995}, 33376 volume = {48}, 33377 pages = {273--280} 33378} 33379 33380@Article{ nestor.pasurka:cge, 33381 author = {D. Vaughn Nestor and C. Pasurka}, 33382 title = {{CGE} Model of Pollution Abatement Processes for Assessing the Economic Effects 33383 of Environmental Policy}, 33384 journal = {Economic Modelling}, 33385 year = {1995}, 33386 volume = {12}, 33387 pages = {53--59} 33388} 33389 33390@Article{ newman.shapiro:theorems, 33391 author = {D. J. Newman and H. S. Shapiro}, 33392 title = {Some Theorems on \v{C}eby\v{s}ev Approximation}, 33393 journal = {Duke Mathematical Journal}, 33394 year = {1963}, 33395 volume = {30}, 33396 pages = {673--682} 33397} 33398 33399@Article{ ng.peyton:block, 33400 author = {E. Ng and B. Peyton}, 33401 title = {Block Sparse Cholesky Algorithms on Advanced Uniprocessor Computers}, 33402 journal = {SIAM Journal on Scientific and Statistical Computing}, 33403 year = {1993}, 33404 volume = {14}, 33405 pages = {1034--1056} 33406} 33407 33408@TechReport{ nielsen.zenios:solving, 33409 author = {S. S. Nielsen and S. A. Zenios}, 33410 title = {Solving Linear Stochastic Network Programs using Massively Parallel Proximal 33411 Algorithms}, 33412 institution = {Decision Sciences Department, The Wharton School, University of Pennsylvania}, 33413 year = {1992}, 33414 address = {Philadelphia}, 33415 number = {92-01-05} 33416} 33417 33418@Article{ niemierko:optimization, 33419 author = {A. Niemierko}, 33420 title = {Optimization of 3{D} Radiation Therapy With Both Physical and Biological End 33421 Points and Constraints}, 33422 journal = {International Journal of Radiation Oncology, Biology and Physics}, 33423 year = {1992}, 33424 volume = {23}, 33425 pages = {99--108} 33426} 33427 33428@InCollection{ niemierko:treatment, 33429 author = {A. Niemierko}, 33430 title = {Treatment Plan Optimization}, 33431 booktitle = {3-D Radiation Treatment Planning and Conformal Therapy}, 33432 editor = {J. A. Purdy and B. Emami}, 33433 publisher = {Medical Physics Publishing}, 33434 year = {1993}, 33435 pages = {49--55}, 33436 address = {St. Louis, Missouri} 33437} 33438 33439@Article{ niemireko:optimization, 33440 author = {A. Niemierko}, 33441 title = {Optimization of intensity modulated beams: Local or global optimum?}, 33442 journal = {Medical Physics}, 33443 year = {1996}, 33444 optvolume = {23}, 33445 optpages = {1072} 33446} 33447 33448@Manual{ nih:radiation, 33449 title = {Radiation Therapy and You - {A} Guide to Self-Help During Treatment}, 33450 author = {N. C. I. National Institutes of Health}, 33451 organization = {NIH Publication}, 33452 address = {Bethesda, Maryland}, 33453 edition = {97-2227}, 33454 year = {1997} 33455} 33456 33457@Book{ nilsson:learning, 33458 author = {N. J. Nilsson}, 33459 title = {Learning Machines}, 33460 year = {1966}, 33461 publisher = {MIT Press}, 33462 address = {Cambridge, Massachusetts} 33463} 33464 33465@Article{ nocedal:theory, 33466 author = {J. Nocedal}, 33467 title = {Theory of Algorithms for Unconstrained Optimization}, 33468 journal = {Acta Numerica}, 33469 year = {1992}, 33470 pages = {199--242} 33471} 33472 33473@InProceedings{ noyes:neural, 33474 author = {J. L. Noyes}, 33475 title = {Neural Network Optimization Methods}, 33476 booktitle = {Proceedings of the Fourth Conference on Neural Networks and Parallel Distributed 33477 Processing}, 33478 year = {1991}, 33479 publisher = {Indiana-Purdue University}, 33480 address = {Fort Wayne, Indiana}, 33481 pages = {1--12} 33482} 33483 33484@Article{ nygard.juell.ea:neural, 33485 author = {K. E. Nygard and P. Juell and N. Kadaba}, 33486 title = {Neural Networks for Selecting Vehicle Routing Heuristics}, 33487 journal = {ORSA Journal on Computing}, 33488 year = {1990}, 33489 volume = {4}, 33490 pages = {353--364} 33491} 33492 33493@Article{ oh.goenka:elastohydrodynamic, 33494 author = {K. P. Oh and P. K. Goenka}, 33495 title = {The Elastohydrodynamic Solution of Journal Bearings under Dynamic Loading}, 33496 journal = {Transactions of the {ASME}, Journal of Tribology}, 33497 volume = {107}, 33498 year = {1985}, 33499 pages = {389--395} 33500} 33501 33502@Article{ oh.li.ea:elastohydrodynamic, 33503 author = {K. P. Oh and C. H. Li and P. K. Goenka}, 33504 title = {Elastohydrodynamic Lubrication of Piston Skirts}, 33505 journal = {Transactions of the {ASME}, Journal of Tribology}, 33506 volume = {109}, 33507 pages = {356--362}, 33508 year = {1987} 33509} 33510 33511@Article{ oh:analysis, 33512 author = {K. P. Oh}, 33513 title = {Analysis of a Needle Bearing}, 33514 journal = {Transactions of the {ASME}, Journal of Tribology}, 33515 volume = {106}, 33516 pages = {78--87}, 33517 year = {1984} 33518} 33519 33520@Article{ oh:formulation, 33521 author = {K. P. Oh}, 33522 title = {The Formulation of the Mixed Lubrication Problem as a Generalized Nonlinear 33523 Complementarity Problem}, 33524 journal = {Transactions of the {ASME}, Journal of Tribology}, 33525 volume = {108}, 33526 year = {1986}, 33527 pages = {598--604} 33528} 33529 33530@Article{ oh:numerical, 33531 author = {K. P. Oh}, 33532 title = {The Numerical Solution of Dynamically Loaded Elastohydrodynamic Contact as a 33533 Nonlinear Complementarity Problem}, 33534 journal = {Transactions of the {ASME}, Journal of Tribology}, 33535 volume = {106}, 33536 year = {1984}, 33537 pages = {88--95} 33538} 33539 33540@Article{ olivera.shepard.ea:maximum, 33541 author = {G. H. Olivera and D. M. Shepard and P. J. Reckwerdt and K. Ruchala and J. Zachman 33542 and E. E. Fitchard and T. R. Mackie}, 33543 title = {Maximum Likelihood as a Common Computational Framework in Tomotherapy}, 33544 journal = {Physics in Medicine and Biology}, 33545 year = {1998}, 33546 pages = {3277--3294} 33547} 33548 33549@Article{ opial:weak, 33550 author = {Z. Opial}, 33551 title = {Weak Convergence of the Sequence of Successive Approximations for Nonexpansive 33552 Mappings}, 33553 journal = {Bulletin of the American Mathematical Society}, 33554 year = {1967}, 33555 volume = {73}, 33556 pages = {591--597} 33557} 33558 33559@Book{ orchard-hays:advanced, 33560 author = {W. Orchard--Hays}, 33561 title = {Advanced Linear Programming Computing Techniques}, 33562 year = {1968}, 33563 publisher = {McGraw--Hill}, 33564 address = {New York} 33565} 33566 33567@Article{ orourke.taylor.ea:factor, 33568 author = {K. O'Rourke and A. M. Taylor and J. G. Williamson}, 33569 title = {Factor price convergence in the late nineteenth century}, 33570 journal = {International Economic Review}, 33571 year = {1996} 33572} 33573 33574@Article{ orourke.williamson:open, 33575 author = {K. O'Rourke and J. G. Williamson}, 33576 title = {Open economy forces and late 19th century {S}wedish catch-up: a quantitative 33577 accounting}, 33578 journal = {Scandinavian Economic and Social History}, 33579 year = {1995}, 33580 volume = {XLIII}, 33581 pages = {171--203} 33582} 33583 33584@Article{ orourke:costs, 33585 author = {K. O'Rourke}, 33586 title = {The costs of international economic disintegration: {I}reland in the 1930's}, 33587 journal = {Research in Economic History}, 33588 year = {1995}, 33589 volume = {15}, 33590 pages = {215--259} 33591} 33592 33593@Article{ orourke:industrial, 33594 author = {K. O'Rourke}, 33595 title = {Industrial policy, employment policy and the non-traded sector}, 33596 journal = {Journal of the Statistical and Social Inquiry Society of Ireland}, 33597 year = {1996} 33598} 33599 33600@Article{ orourke:measuring, 33601 author = {K. O'Rourke}, 33602 title = {Measuring protection: a cautionary tale}, 33603 journal = {Journal of Development Economics}, 33604 year = {1996} 33605} 33606 33607@Book{ ortega.rheinboldt:iterative, 33608 author = {J. M. Ortega and W. C. Rheinboldt}, 33609 title = {Iterative Solution of Nonlinear Equations in Several Variables}, 33610 year = {1970}, 33611 publisher = {Academic Press}, 33612 address = {San Diego, California} 33613} 33614 33615@Book{ ortega:introduction, 33616 author = {J. M. Ortega}, 33617 title = {Introduction to Parallel and Vector Solution of Linear Systems}, 33618 year = {1988}, 33619 publisher = {Plenum Press}, 33620 address = {New York} 33621} 33622 33623@Book{ ortega:numerical, 33624 author = {J. M. Ortega}, 33625 title = {Numerical Analysis, {A} Second Course}, 33626 year = {1972}, 33627 publisher = {Academic Press} 33628} 33629 33630@Article{ osborne.womersley:strong, 33631 author = {M. R. Osborne and R. S. Womersley}, 33632 title = {Strong uniqueness in sequential linear programming}, 33633 journal = {Journal of the Australian Mathematical Society, Series B}, 33634 year = {1990}, 33635 volume = {31}, 33636 pages = {379--384} 33637} 33638 33639@InCollection{ osborne:strong, 33640 author = {M. R. Osborne}, 33641 title = {Strong uniqueness in nonlinear approximation}, 33642 booktitle = {The numerical solution of nonlinear problems}, 33643 year = {1981}, 33644 editor = {C. T. H. Baker and C. Phillips}, 33645 publisher = {Clarendon Press}, 33646 address = {Oxford} 33647} 33648 33649@Book{ outrata.kocvara.ea:nonsmooth, 33650 author = {J. Outrata and M. Ko\v{c}vara and J. Zowe}, 33651 title = {Nonsmooth Approach to Optimization Problems with Equilibrium Constraints}, 33652 publisher = {Kluwer Academic Publishers}, 33653 year = {1998}, 33654 address = {Dordrecht, The Netherlands} 33655} 33656 33657@Article{ outrata.zowe:numerical, 33658 author = {J. V. Outrata and J. Zowe}, 33659 title = {A Numerical Approach to Optimization Problems with Variational Inequality 33660 Constraints}, 33661 journal = {Mathematical Programming}, 33662 year = {1995}, 33663 volume = {68}, 33664 pages = {105--130} 33665} 33666 33667@Article{ outrata:necessary, 33668 author = {J. V. Outrata}, 33669 title = {On Necessary Optimality Conditions for {S}tackelberg Problems}, 33670 journal = {Journal of Optimization Theory and Applications}, 33671 volume = {76}, 33672 year = {1993}, 33673 pages = {305--320} 33674} 33675 33676@Article{ outrata:numerical, 33677 author = {J. V. Outrata}, 33678 title = {On the Numerical Solution of a Class of {S}tackelberg Problems}, 33679 journal = {Zeitschrift f{\"{u}}r Operations Research}, 33680 volume = {4}, 33681 year = {1990}, 33682 pages = {255--278} 33683} 33684 33685@Article{ outrata:optimization, 33686 author = {J. V. Outrata}, 33687 title = {On Optimization Problems with Variational Inequality Constraints}, 33688 journal = {SIAM Journal on Optimization}, 33689 volume = {4}, 33690 year = {1994}, 33691 pages = {340--357} 33692} 33693 33694@Article{ paige.saunders:lsqr, 33695 author = {C. C. Paige and M. A. Saunders}, 33696 title = {{LSQR}: An Algorithm for Sparse Linear Equations and Sparse Least Squares}, 33697 journal = {{ACM} Transactions on Mathematical Software}, 33698 year = {1982}, 33699 volume = {8}, 33700 pages = {43--71} 33701} 33702 33703@Article{ paige.saunders:solution, 33704 author = {C. C. Paige and M. A. Saunders}, 33705 title = {Solution of Sparse Indefinite Systems of Linear Equations}, 33706 journal = {SIAM Journal on Numerical Analysis}, 33707 year = {1975}, 33708 volume = {12}, 33709 pages = {617--629} 33710} 33711 33712@Article{ palacios-gomez.lasdon.ea:nonlinear, 33713 author = {F. Palacios--Gomez and L. Lasdon and M. Engquist}, 33714 title = {Nonlinear Optimization by Successive Linear Programming}, 33715 journal = {Management Science}, 33716 year = {1982}, 33717 volume = {28}, 33718 pages = {1106--1120} 33719} 33720 33721@Article{ palomares.mangasarian:superlinearly, 33722 author = {U. M. Garcia Palomares and O. L. Mangasarian}, 33723 title = {Superlinearly Convergent {Q}uasi--{N}ewton Algorithms for Nonlinearly Constrained 33724 Optimization Problems}, 33725 journal = {Mathematical Programming}, 33726 year = {1976}, 33727 volume = {11}, 33728 pages = {1--13} 33729} 33730 33731@Article{ panagiotopoulos.al-fahed:robot, 33732 author = {P. D. Panagiotopoulos and A. M. Al-Fahed}, 33733 title = {Robot Hand Grasping and Related Problems: Optimal Contol and Identification}, 33734 journal = {The International Journal of Robotics Research}, 33735 year = {1994}, 33736 volume = {13}, 33737 pages = {127--136} 33738} 33739 33740@Book{ panagiotopoulos:hemivariational, 33741 author = {P. D. Panagiotopoulos}, 33742 title = {Hemivariational Inequalities}, 33743 publisher = {Springer-Verlag}, 33744 address = {Berlin}, 33745 year = {1993} 33746} 33747 33748@Book{ panagiotopoulos:inequality, 33749 author = {P. D. Panagiotopoulos}, 33750 title = {Inequality Problems in Mechanics and Applications}, 33751 publisher = {Birkh{\"{a}}user}, 33752 address = {Boston}, 33753 year = {1985} 33754} 33755 33756@Article{ pang.chan:iterative, 33757 author = {J. S. Pang and D. Chan}, 33758 title = {Iterative Methods for Variational and Complementarity Problems}, 33759 journal = {Mathematical Programming}, 33760 year = {1982}, 33761 volume = {24}, 33762 pages = {284--313} 33763} 33764 33765@Article{ pang.gabriel:nesqp, 33766 author = {J. S. Pang and S. A. Gabriel}, 33767 title = {{NE/SQP}: {A} Robust Algorithm for the Nonlinear Complementarity Problem}, 33768 journal = {Mathematical Programming}, 33769 year = {1993}, 33770 volume = {60}, 33771 pages = {295--338} 33772} 33773 33774@Article{ pang.han.ea:minimization, 33775 author = {J. S. Pang and S.--P. Han and N. Rangaraj}, 33776 title = {Minimization of Locally {L}ipschitzian Functions}, 33777 journal = {SIAM Journal on Optimization}, 33778 year = {1991}, 33779 volume = {1}, 33780 pages = {57--82} 33781} 33782 33783@Article{ pang.qi:nonsmooth, 33784 author = {J. S. Pang and L. Qi}, 33785 title = {Nonsmooth Equations: Motivation and Algorithms}, 33786 journal = {SIAM Journal on Optimization}, 33787 year = {1993}, 33788 volume = {3}, 33789 pages = {443--465} 33790} 33791 33792@Article{ pang.trinkle.ea:complementarity, 33793 author = {J. S. Pang and J. C. Trinkle and G. Lo}, 33794 title = {A Complementarity Approach to a Quasistatic Multi-Rigid-Body Contact Problem}, 33795 journal = {Computational Optimization and Applications}, 33796 volume = {5}, 33797 pages = {97--138}, 33798 year = {1996} 33799} 33800 33801@Article{ pang.trinkle:complementarity, 33802 author = {J. S. Pang and J. C. Trinkle}, 33803 title = {Complementarity Formulations and Existence of Solutions of Multi-Rigid-Body 33804 Contact Problems with {C}oulomb Friction}, 33805 year = {1996}, 33806 journal = {Mathematical Programming}, 33807 volume = {73}, 33808 pages = {199--226} 33809} 33810 33811@TechReport{ pang.wang:embedding, 33812 author = {J. S. Pang and Z. P. Wang}, 33813 title = {Embedding Methods for Variational Inequality and Nonlinear Complementarity 33814 Problems}, 33815 institution = {Department of Mathematical Sciences, The Johns Hopkins University}, 33816 year = {1990}, 33817 address = {Baltimore, Maryland} 33818} 33819 33820@TechReport{ pang.yang:parallel, 33821 author = {J. S. Pang and J. M. Yang}, 33822 title = {Parallel {N}ewton Methods for the Nonlinear Complementarity Problem}, 33823 institution = {Department of Mathematical Sciences, The Johns Hopkins University}, 33824 year = {1987}, 33825 address = {Baltimore, Maryland}, 33826 type = {Manuscript} 33827} 33828 33829@Article{ pang.yu:linearized, 33830 author = {J. S. Pang and C. S. Yu}, 33831 title = {Linearized Simplicial Decomposition Methods for Computing Traffic Equilibria on 33832 Networks}, 33833 journal = {Networks}, 33834 volume = {14}, 33835 pages = {427--438}, 33836 year = {1984} 33837} 33838 33839@Article{ pang:b-differentiable, 33840 author = {J. S. Pang}, 33841 title = {A {B}--Differentiable Equation Based, Globally and Locally Quadratically 33842 Convergent Algorithm for Nonlinear Programs, Complementarity and Variational 33843 Inequality Problems}, 33844 journal = {Mathematical Programming}, 33845 year = {1991}, 33846 volume = {51}, 33847 pages = {101--132} 33848} 33849 33850@InCollection{ pang:complementarity, 33851 author = {J. S. Pang}, 33852 title = {Complementarity Problems}, 33853 booktitle = {Handbook in Global Optimization}, 33854 publisher = {Kluwer Academic Publishers}, 33855 year = {1994}, 33856 editor = {R. Horst and P. Pardalos}, 33857 address = {Boston} 33858} 33859 33860@Article{ pang:convergence, 33861 author = {J. S. Pang}, 33862 title = {On the Convergence of a Basic Iterative Method for the Implicit Complementarity 33863 Problem}, 33864 journal = {Journal of Optimization Theory and Applications}, 33865 year = {1982}, 33866 volume = {37}, 33867 pages = {149--162} 33868} 33869 33870@Article{ pang:convergence*1, 33871 author = {J. S. Pang}, 33872 title = {Convergence of Splitting and {N}ewton Methods for Complementarity Problems: An 33873 Application of some Sensitivity Results}, 33874 journal = {Mathematical Programming}, 33875 year = {1993}, 33876 volume = {58}, 33877 pages = {149--160} 33878} 33879 33880@Article{ pang:inexact, 33881 author = {J. S. Pang}, 33882 title = {Inexact {N}ewton Methods for the Nonlinear Complementarity Problem}, 33883 journal = {Mathematical Programming}, 33884 year = {1986}, 33885 volume = {36}, 33886 pages = {54--71} 33887} 33888 33889@Article{ pang:more, 33890 author = {J. S. Pang}, 33891 title = {More Results on the Convergence of Iterative Methods for the Symmetric Linear 33892 Complementarity Problem}, 33893 journal = {Journal of Optimization Theory and Applications}, 33894 year = {1986}, 33895 volume = {49}, 33896 pages = {107--134} 33897} 33898 33899@Article{ pang:more*1, 33900 author = {J. S. Pang}, 33901 title = {More Results on the Convergence of Iterative Methods for Symmetric Linear 33902 Complementarity Problems}, 33903 journal = {Journal of Optimization Theory and Applications}, 33904 year = {1986}, 33905 volume = {49}, 33906 pages = {107--134} 33907} 33908 33909@Article{ pang:necessary, 33910 author = {J. S. Pang}, 33911 title = {Necessary and Sufficient Conditions for the Convergence of Iterative Methods for 33912 the Linear Complementarity Problem}, 33913 journal = {Journal of Optimization Theory and Applications}, 33914 year = {1984}, 33915 volume = {42}, 33916 pages = {1--17} 33917} 33918 33919@Article{ pang:newtons, 33920 author = {J. S. Pang}, 33921 title = {{N}ewton's Method for {B}--Differentiable Equations}, 33922 journal = {Mathematics of Operations Research}, 33923 year = {1990}, 33924 volume = {15}, 33925 pages = {311--341} 33926} 33927 33928@Article{ pang:posteriori, 33929 author = {J. S. Pang}, 33930 title = {A Posteriori Error Bound for the Linearly--Constrained Variational Inequality 33931 Problem}, 33932 journal = {Mathematics of Operations Research}, 33933 year = {1987}, 33934 volume = {12}, 33935 pages = {474--484} 33936} 33937 33938@Article{ pantoja.mayne:sequential, 33939 author = {J. F. A. D. Pantoja and D. Q. Mayne}, 33940 title = {Sequential Quadratic Programming Algorithm for Discrete Optimal Control Problems 33941 with Control Inequality Constraints}, 33942 journal = {International Journal on Control}, 33943 year = {1991}, 33944 volume = {53}, 33945 pages = {823--836} 33946} 33947 33948@Book{ papadimitriou.steiglitz:combinatorial, 33949 author = {C. H. Papadimitriou and K. Steiglitz}, 33950 title = {Combinatorial Optimization: Algorithms and Complexity}, 33951 year = {1982}, 33952 publisher = {Prentice-Hall, Inc}, 33953 address = {Englewood Cliffs, New Jersey} 33954} 33955 33956@Article{ papanikolau.mackie.ea:investigation, 33957 author = {N. Papanikolaou and T. R. Mackie and C. Meger-Wells and M. Gehring and P. 33958 Reckwerdt}, 33959 title = {Investigation of the convolution method for polyenergetic spectra}, 33960 journal = {Medical Physics}, 33961 year = {1993}, 33962 volume = {20}, 33963 number = {5}, 33964 pages = {1327--1336} 33965} 33966 33967@Article{ parisot:resolution, 33968 author = {G. R. Parisot}, 33969 title = {{R}\'{e}solution Num\'{e}rique Approach\'{e}e du Probl\`{e}me de Programmation 33970 Lin\'{e}aire par Application de la Programmation Logarithmique}, 33971 journal = {Revue Fran\c{c}aise Recherche Op\'{e}rationnelle}, 33972 year = {1961}, 33973 volume = {20}, 33974 pages = {227--259} 33975} 33976 33977@Article{ parker.cave.ea:comparison, 33978 author = {L. R. Parker and M. R. Cave and R. M. Barnes}, 33979 title = {Comparison of Simplex Algorithms}, 33980 journal = {Analytica Chimica Acta}, 33981 year = {1985}, 33982 volume = {175}, 33983 pages = {231--237} 33984} 33985 33986@InProceedings{ parker:optimal, 33987 author = {D. Parker}, 33988 title = {Optimal Algorithms for Adaptive Networks: Second Order Direct Propagation, and 33989 Second Order Hebbian Learning}, 33990 booktitle = {Proceedings of the IEEE First International Conference on Neural Networks: Volume 33991 II}, 33992 year = {1987}, 33993 address = {San Diego:IEEE}, 33994 pages = {593--600} 33995} 33996 33997@Book{ pascali.sburlan:nonlinear, 33998 author = {D. Pascali and S. Sburlan}, 33999 title = {Nonlinear Mappings of Monotone Type}, 34000 publisher = {Editura Academeie}, 34001 year = {1978} 34002} 34003 34004@Article{ passty:ergodic, 34005 author = {G. B. Passty}, 34006 title = {Ergodic convergence to a zero of the sum of monotone operators in {H}ilbert 34007 space}, 34008 journal = {Journal of Mathematical Analysis and Applications}, 34009 year = {1979}, 34010 volume = {72}, 34011 pages = {383--390} 34012} 34013 34014@Article{ peaceman.rachford:numerical, 34015 author = {D. W. Peaceman and H. H. Rachford}, 34016 title = {The numerical solution of parabolic and elliptic differential equations}, 34017 journal = {SIAM Journal}, 34018 year = {1955}, 34019 volume = {3}, 34020 pages = {28--41} 34021} 34022 34023@Book{ peck.tiesberg:global, 34024 author = {S. Peck and T. Tiesberg}, 34025 title = {Global Warming Uncertainties and the Value of Information: An Analysis Using 34026 {CETA}}, 34027 publisher = {The Electric Power Institute}, 34028 year = {1992}, 34029 address = {Paolo Alto CA} 34030} 34031 34032@TechReport{ peng:convexity, 34033 author = {J. -M. Peng}, 34034 title = {The Convexity of the Implicit {L}agrangian}, 34035 institution = {State Key Laboratory of Scientific and Engineering Computing, Academic Sinica}, 34036 year = {1995}, 34037 type = {Technical Report}, 34038 address = {Beijing} 34039} 34040 34041@Article{ peng:equivalence, 34042 author = {J. -M. Peng}, 34043 title = {Equivalence of Variational Inequality Problems to Unconstrained Optimization}, 34044 journal = {Mathematical Programming}, 34045 year = {1997}, 34046 volume = {78}, 34047 pages = {347--356} 34048} 34049 34050@Article{ pennisi:taking, 34051 author = {E. Pennisi}, 34052 title = {Taking a structured approach to understanding proteins}, 34053 journal = {Science}, 34054 year = {1998}, 34055 volume = {279}, 34056 pages = {978--979} 34057} 34058 34059@Article{ penot:regularity, 34060 author = {J. P. Penot}, 34061 title = {On regularity conditions in mathematical programming}, 34062 journal = {Mathematical Programming Study}, 34063 year = {1982}, 34064 volume = {17}, 34065 pages = {28--66} 34066} 34067 34068@Book{ perez:principles, 34069 author = {C. A. Perez and L. W. Brady}, 34070 title = {Principles and practice of radiotherapy}, 34071 publisher = {Lippincott-Raven}, 34072 year = {1998}, 34073 address = {Philadelphia}, 34074 edition = {3rd} 34075} 34076 34077@Article{ perroni.rutherford:international, 34078 author = {C. Perroni and T. Rutherford}, 34079 title = {International Trade in Carbon Emission Rights and Basic Materials: General 34080 Equilibrium Calculations for 2020}, 34081 journal = {Scandinavian Journal of Economics}, 34082 year = {1993} 34083} 34084 34085@Article{ perroni.rutherford:regular, 34086 author = {C. Perroni and T. Rutherford}, 34087 title = {Regular Flexibility of Nested {CES} Functions}, 34088 journal = {European Economic Review}, 34089 year = {1995}, 34090 volume = {39}, 34091 pages = {335--343} 34092} 34093 34094@InCollection{ perroni.wigle:environmental, 34095 author = {C. Perroni and R. M. Wigle}, 34096 title = {Environmental Policy Modeling}, 34097 booktitle = {Global Trade Analysis: Modeling and Applications}, 34098 publisher = {Cambridge University Press}, 34099 year = {1996}, 34100 editor = {T. Hertel} 34101} 34102 34103@Article{ peterson:review, 34104 author = {D. W. Peterson}, 34105 title = {A Review of Constraint Qualifications in Finite--Dimensional Spaces}, 34106 journal = {SIAM Review}, 34107 year = {1973}, 34108 volume = {15}, 34109 pages = {639--654} 34110} 34111 34112@PhDThesis{ petersson:optimization, 34113 author = {J. Petersson}, 34114 title = {Optimization of Structures in Unilateral Contact}, 34115 type = {{L}ink{\"o}ping Studies in Science and Technology, Dissertations}, 34116 number = {397}, 34117 school = {Division of Mechanics, Department of Mechanical Engineering, Link{\"o}ping 34118 University}, 34119 address = {Link{\"o}ping, Sweden}, 34120 year = {1995} 34121} 34122 34123@Book{ petri:modelling, 34124 author = {P. Petri}, 34125 title = {Modelling {J}apanese--{A}merican Trade, {A} Study of Asymmetric Interdependence}, 34126 publisher = {Harvard University Press}, 34127 year = {1984} 34128} 34129 34130@InProceedings{ petrzykowski:application, 34131 author = {T. Petrzykowski}, 34132 title = {Application of the Steepest Ascent Method to Concave Programming}, 34133 booktitle = {Proceedings of the {IFIPS} Congress, Munich, 1962}, 34134 year = {1962}, 34135 publisher = {North--Holland}, 34136 address = {Amsterdam}, 34137 pages = {185--189} 34138} 34139 34140@InProceedings{ pettey.leuze.ea:parallel, 34141 crossref = {grefenstette:genetic}, 34142 author = {C. C. Pettey and M. R. Leuze and J. J. Grefenstette}, 34143 title = {A Parallel Genetic Algorithm}, 34144 pages = {155--161} 34145} 34146 34147@InProceedings{ pettey.leuze:theoretical, 34148 crossref = {schaeffer:third}, 34149 author = {C. C. Pettey and M. R. Leuze}, 34150 title = {A Theoretical Investigation of a Parallel Genetic Algorithm}, 34151 pages = {398--405} 34152} 34153 34154@Book{ pfeiffer.glocker:multibody, 34155 author = {F. Pfeiffer and C. Glocker}, 34156 title = {Multibody Dynamics with Unilateral Contact}, 34157 year = {1996}, 34158 publisher = {John Wiley \& Sons} 34159} 34160 34161@TechReport{ pierro.iusem:convergence, 34162 author = {A. R. de Pierro and A. N. Iusem}, 34163 title = {Convergence Properties of Iterative Methods for Symmetric Positive Semidefinite 34164 Linear Complementarity Problems}, 34165 institution = {Instituto de Matematica, Elasticita e Ciencia da Computacao}, 34166 year = {1990}, 34167 address = {Universidade Estadual de Campinas, CP 6065, Campinas, 13081, SP, Brazil} 34168} 34169 34170@InCollection{ pillo.grippo.ea:class, 34171 author = {G. Di Pillo and L. Grippo and F. Lampariello}, 34172 title = {A Class of Methods for the Solution of Optimization Problems with Inequalities}, 34173 booktitle = {System Modelling and Optimization}, 34174 year = {1981}, 34175 editor = {R. F. Drenick and F. Kozin}, 34176 publisher = {Springer-Verlag}, 34177 address = {Berlin} 34178} 34179 34180@Article{ pillo.grippo:augmented, 34181 author = {G. Di Pillo and L. Grippo}, 34182 title = {An Augmented {L}agrangian for Inequality Constraints in Nonlinear Programming 34183 Problems}, 34184 journal = {Journal of Optimization Theory and Applications}, 34185 year = {1982}, 34186 volume = {36}, 34187 pages = {495--519} 34188} 34189 34190@Article{ pillo.grippo:class, 34191 author = {G. Di Pillo and L. Grippo}, 34192 title = {A New Class of Augmented {L}agrangians in Nonlinear Programming}, 34193 journal = {SIAM Journal on Control and Optimization}, 34194 year = {1979}, 34195 volume = {17}, 34196 pages = {618--628} 34197} 34198 34199@Article{ pillo.grippo:continuously, 34200 author = {G. Di Pillo and L. Grippo}, 34201 title = {A Continuously Differentiable Exact Penalty Function for Nonlinear Programming 34202 Problems with Inequality Constraints}, 34203 journal = {SIAM Journal on Control and Optimization}, 34204 year = {1985}, 34205 volume = {23}, 34206 pages = {72--84} 34207} 34208 34209@Article{ pillo.grippo:exact, 34210 author = {G. Di Pillo and L. Grippo}, 34211 title = {An Exact Penalty Method with Global Convergence Properties for Nonlinear 34212 Programming Problems}, 34213 journal = {Mathematical Programming}, 34214 year = {1986}, 34215 volume = {36}, 34216 pages = {1--18} 34217} 34218 34219@InProceedings{ plambeck.fu.ea:throughput, 34220 author = {E. L. Plambeck and B. --R. Fu and S.M. Robinson and R. Suri}, 34221 title = {Throughput Optimization in Tandem Production Lines via Nonsmooth Programming}, 34222 booktitle = {Proceedings of the 1993 Summer Computer Simulation Conference}, 34223 editor = {J. Schoen}, 34224 year = {1993}, 34225 publisher = {Society for Computer Simulation}, 34226 address = {San Diego, CA}, 34227 pages = {70--75} 34228} 34229 34230@Article{ plambeck.fu.ea:sample-path, 34231 author = {E. L. Plambeck and B. --R. Fu and S.M. Robinson and R. Suri}, 34232 title = {Sample-Path Optimization of Convex Stochastic Performance Functions}, 34233 journal = {Mathematical Programming}, 34234 year = {1996}, 34235 volume = {75}, 34236 pages = {137--176} 34237} 34238 34239@InProceedings{ platt:sequential, 34240 author = {J. Platt}, 34241 title = {Sequential Minimal Optimization: A Fast Algorithm for Training Support Vector 34242 Machines}, 34243 editor = {Bernhard {Sch\"olkopf} and Christopher J. C. Burges and Alexander J. Smola}, 34244 booktitle = {Advances in Kernel Methods {-} Support Vector Learning}, 34245 publisher = {MIT Press}, 34246 pages = {185-208}, 34247 year = {1999} 34248} 34249 34250@Book{ poincare:sur, 34251 author = {H. Poincar\'{e}}, 34252 title = {Sur les Courbes {D}\'{e}fin\'{e}es par une \'{E}quation Differentielle {I}}, 34253 year = {1881}, 34254 publisher = {Oeuvres I}, 34255 address = {Gauthier--Villars, Paris} 34256} 34257 34258@Article{ polak.ribiere:note, 34259 author = {E. Polak and G. Ribi\`{e}re}, 34260 title = {Note sur la convergence de m\'{e}thodes de directions conjug\'{e}es}, 34261 journal = {Revue Francaise Informatique et Recherche Op\'{e}rationelle}, 34262 year = {1969}, 34263 volume = {16-R1}, 34264 pages = {35--43} 34265} 34266 34267@Book{ polak:computational, 34268 author = {E. Polak}, 34269 title = {Computational Methods in Optimization; {A} Unified Approach}, 34270 year = {1971}, 34271 publisher = {Academic Press}, 34272 address = {New York} 34273} 34274 34275@Article{ polak:global, 34276 author = {E. Polak}, 34277 title = {On the Global Stabilization of Locally Convergent Algorithms}, 34278 journal = {Automatica}, 34279 year = {1976}, 34280 volume = {12}, 34281 pages = {337--349} 34282} 34283 34284@Article{ polyak.tretiyakov:concerning, 34285 author = {B. T. Polyak and N. V. Tretiyakov}, 34286 title = {Concerning an Iterative Method for Linear Programming and its Economic 34287 Interpretation}, 34288 journal = {Economics and Mathematical Methods}, 34289 year = {1972}, 34290 volume = {8}, 34291 pages = {740--751}, 34292 note = {(Russian)} 34293} 34294 34295@Article{ polyak.tretiyakov:method, 34296 author = {B. T. Polyak and N. V. Tretiyakov}, 34297 title = {The Method of Penalty Estimates for Conditional Extremeum Problems}, 34298 journal = {U.S.S.R. Computational Mathematics and Mathematical Physics}, 34299 year = {1973}, 34300 volume = {13}, 34301 pages = {42--58} 34302} 34303 34304@Article{ polyak:conjugate, 34305 author = {B. T. Polyak}, 34306 title = {The conjugate gradient method in extremal problems}, 34307 journal = {USSR Computational Mathematics and Mathematical Physics}, 34308 year = {1969}, 34309 volume = {9}, 34310 pages = {94--112}, 34311 note = {Translated from Russian} 34312} 34313 34314@Book{ polyak:introduction, 34315 author = {B. T. Polyak}, 34316 title = {Introduction to Optimization}, 34317 year = {1987}, 34318 publisher = {Optimization Software, Inc.}, 34319 address = {Publications Division, New York} 34320} 34321 34322@Unpublished{ polyak:methods, 34323 author = {R. A. Polyak}, 34324 title = {On the Methods of Centers}, 34325 year = {1988}, 34326 note = {Unpublished manuscript} 34327} 34328 34329@Unpublished{ polyak:sharp, 34330 author = {B. T. Polyak}, 34331 title = {Sharp Minima}, 34332 year = {1979}, 34333 note = {A Talk given at the {IIASA} Workshop on Generalized {L}agrangians and their 34334 Applications, {IIASA}, Laxenburg, Austria} 34335} 34336 34337@InProceedings{ polyak:smooth, 34338 author = {R. A. Polyak}, 34339 title = {Smooth Optimization Methods for Solving Nonlinear Extremal and Equilibrium 34340 Problems with Constraints}, 34341 booktitle = {Abstracts of the Papers of the 11th International Symposium on Mathematical 34342 Programming}, 34343 year = {1982}, 34344 address = {Bonn} 34345} 34346 34347@Article{ polychronopoulos.tsitsiklis:analysis, 34348 author = {G. H. Polychronopoulos and J. N. Tsitsiklis}, 34349 title = {Stochastic Shortest Path Problems with Recourse}, 34350 journal = {Networks}, 34351 year = {1996}, 34352 volume = {27}, 34353 pages = {133--143} 34354} 34355 34356@TechReport{ potra.bonnans:infeasible, 34357 author = {F. A. Potra and J. F. Bonnans}, 34358 title = {Infeasible path following algorithms for linear complementarity problems}, 34359 institution = {INRIA}, 34360 year = {1994}, 34361 month = dec, 34362 number = {RR--2445}, 34363 type = {Research Report} 34364} 34365 34366@Article{ potra.sheng:large-step, 34367 author = {F. A. Potra and R. Sheng}, 34368 title = {A Large--Step Infeasible--Interior--Point Method for the ${P}_*$--Matrix {LCP}}, 34369 year = {1997}, 34370 journal = {SIAM Journal on Optimization}, 34371 volume = {7}, 34372 pages = {318--335} 34373} 34374 34375@Article{ potra:infeasible, 34376 author = {F. A. Potra}, 34377 title = {An infeasible interior-point predictor-corrector algorithm for linear 34378 programming}, 34379 journal = {SIAM Journal on Optimization}, 34380 year = {1996}, 34381 volume = {6}, 34382 pages = {19--32} 34383} 34384 34385@TechReport{ potra:onl, 34386 author = {F. A. Potra}, 34387 title = {An ${O}(n{L})$ infeasible--interior--point algorithm for {LCP} with quadratic 34388 convergence.}, 34389 institution = {Department of Mathematics, The University of Iowa}, 34390 address = {Iowa City, Iowa}, 34391 year = {1994}, 34392 number = {50}, 34393 type = {Reports on Computational Mathematics} 34394} 34395 34396@TechReport{ potra:predictor-corrector, 34397 author = {F. A. Potra}, 34398 title = {On a predictor-corrector method for solving linear programs from infeasible 34399 starting points}, 34400 institution = {Department of Mathematics, University of Iowa}, 34401 address = {Iowa City, Iowa}, 34402 year = {1992}, 34403 number = {34}, 34404 type = {Reports on Computational Mathematics} 34405} 34406 34407@TechReport{ potra:quadratically, 34408 author = {F. A. Potra}, 34409 title = {A quadratically convergent infeasible interior-point algorithm for linear 34410 programming}, 34411 institution = {Department of Mathematics, University of Iowa}, 34412 year = {1992}, 34413 number = {28}, 34414 address = {Iowa City, Iowa}, 34415 month = jul 34416} 34417 34418@InCollection{ powell:convergence, 34419 author = {M. J. D. Powell}, 34420 title = {The Convergence of Variable Metric Methods for Nonlinearly Constrained 34421 Optimization Calculations}, 34422 crossref = {mangasarian.meyer.ea:nonlinear*3}, 34423 pages = {27--63} 34424} 34425 34426@InProceedings{ powell:direct, 34427 author = {M. J. D. Powell}, 34428 title = {A Direct Search Optimization Method that Models the Objective and Constraint 34429 Functions by Linear Interpolation}, 34430 booktitle = {Advances in Optimization and Numerical Analysis, Proceedings of the Sixth 34431 Workshop on Optimization and Numerical Analysis, Oaxaca, Mexico}, 34432 volume = {275}, 34433 year = {1994}, 34434 publisher = {Kluwer Academic Publishers}, 34435 pages = {51--67}, 34436 address = {Dordrecht, The Netherlands} 34437} 34438 34439@Article{ powell:efficient, 34440 author = {M. J. D. Powell}, 34441 title = {An Efficient Method for Finding the Minimum of a Function of Several Variables 34442 without Calculating Derivatives}, 34443 journal = {Computer Journal}, 34444 year = {1964}, 34445 volume = {17}, 34446 pages = {155--162} 34447} 34448 34449@InCollection{ powell:general, 34450 author = {M. J. D. Powell}, 34451 title = {General Algorithm for Discrete Nonlinear Approximation Calculations}, 34452 booktitle = {Approximation Theory IV}, 34453 year = {1983}, 34454 editor = {L. L. Schumaker C. K. Chui and J. D. Ward}, 34455 publisher = {Academic Press}, 34456 address = {New York}, 34457 pages = {187--218} 34458} 34459 34460@InCollection{ powell:hybrid, 34461 author = {M. J. D. Powell}, 34462 title = {A hybrid method for nonlinear equations}, 34463 booktitle = {Numerical Methods for Nonlinear Algebraic Equations}, 34464 publisher = {Gordon and Breach}, 34465 year = {1970}, 34466 editor = {P. Rabinowitz} 34467} 34468 34469@TechReport{ powell:karmarkars, 34470 author = {M. J. D. Powell}, 34471 title = {{K}armarkar's algorithm: a view from nonlinear programming}, 34472 institution = {Department of Applied Mathematics and Theoretical Physics, University of 34473 Cambridge}, 34474 year = {1989}, 34475 month = nov, 34476 address = {Cambridge, CB3 9EW, England} 34477} 34478 34479@InCollection{ powell:method, 34480 author = {M. J. D. Powell}, 34481 title = {A Method for Nonlinear Constraints in Minimization Problems}, 34482 booktitle = {Optimization}, 34483 year = {1969}, 34484 editor = {R. Fletcher}, 34485 publisher = {Academic Press}, 34486 address = {London}, 34487 pages = {283--298} 34488} 34489 34490@Book{ prekopa:stochastic, 34491 author = {A. Pr{\'{e}}kopa}, 34492 title = {Stochastic Programming}, 34493 publisher = {Kluwer Academic Publishers}, 34494 year = {1995}, 34495 address = {Dordrecht, The Netherlands} 34496} 34497 34498@Book{ press.flannery.ea:numerical, 34499 author = {William H. Press and Brian P. Flannery and Saul A. Teukolsky and William T. 34500 Vetterling}, 34501 title = {Numerical Recipes : the Art of Scientific Computing}, 34502 publisher = {Cambridge University Press}, 34503 year = {1988} 34504} 34505 34506@Article{ pruyne.livny:interfacing, 34507 author = {J. Pruyne and M. Livny}, 34508 title = {Interfacing {C}ondor and {PVM} to Harness the Cycles of Workstation Clusters}, 34509 journal = {Journal on Future Generations of Computer Systems}, 34510 volume = {12}, 34511 year = {1996}, 34512 pages = {67--85} 34513} 34514 34515@InCollection{ pruyne.livny:parallel, 34516 author = {J. Pruyne and M. Livny}, 34517 title = {Parallel Processing on Dynamic Resources using {CARMI}}, 34518 booktitle = {Job Scheduling Strategies for Parallel Processing}, 34519 publisher = {Springer-Verlag}, 34520 year = {1995}, 34521 editor = {D. G. Feitelson and L. Rudolph}, 34522 volume = {949}, 34523 series = {Lecture Notes in Computer Science} 34524} 34525 34526@PhDThesis{ pruyne:resource, 34527 author = {J. C. Pruyne}, 34528 title = {Resource Management Services for Parallel Applications}, 34529 school = {University of Wisconsin--Madison}, 34530 year = {1996}, 34531 address = {Madison, Wisconsin} 34532} 34533 34534@Book{ pshenichny.danilin:numerical, 34535 author = {B. N. Pshenichny and Yu. M. Danilin}, 34536 title = {Numerical Methods in Extremal Problems}, 34537 year = {1978}, 34538 publisher = {MIR Publishers}, 34539 address = {Moscow} 34540} 34541 34542@TechReport{ qi.chen:globally, 34543 author = {L. Qi and X. Chen}, 34544 title = {A Globally Convergent Successive Approximation Method for Nonsmooth Equations}, 34545 institution = {School of Mathematics, University of New South Wales}, 34546 year = {1993}, 34547 annote = {revised}, 34548 address = {Sydney} 34549} 34550 34551@Article{ qi.jiang:semismooth, 34552 author = {L. Qi and H. Jiang}, 34553 title = {Semismooth {K}arush--{K}uhn--{T}ucker Equations and Convergence Analysis of 34554 {N}ewton Methods and Quasi--{N}ewton Methods for Solving these Equations}, 34555 journal = {Mathematics of Operations Research}, 34556 volume = {22}, 34557 pages = {301--325}, 34558 year = {1997} 34559} 34560 34561@TechReport{ qi.peng:unconstrained, 34562 author = {H. -D. Qi and J. -M. Peng}, 34563 title = {A New Unconstrained Optimization Approach for Nonlinear Complementarity 34564 Problems}, 34565 institution = {State Key Laboratory of Scientific and Engineering Computing, Academic Sinica}, 34566 year = {1996}, 34567 type = {Technical Report}, 34568 address = {Beijing} 34569} 34570 34571@InCollection{ qi.sun:survey, 34572 author = {L. Qi and D. Sun}, 34573 title = {A Survey of Some Nonsmooth Equations and Smoothing {N}ewton Methods}, 34574 year = {1999}, 34575 editor = {A. Eberhard and B. Glover and R. Hill and D. Ralph}, 34576 booktitle = {Progress in Optimization}, 34577 pages = {121--146}, 34578 series = {Applied Optimization}, 34579 volume = {30}, 34580 publisher = {Kluwer Academic Publishers}, 34581 address = {Dordrecht} 34582} 34583 34584@Article{ qi.sun:nonsmooth, 34585 author = {L. Qi and J. Sun}, 34586 title = {A Nonsmooth Version of {N}ewton's Method}, 34587 journal = {Mathematical Programming}, 34588 year = {1993}, 34589 volume = {58}, 34590 pages = {353--368} 34591} 34592 34593@Article{ qi:convergence, 34594 author = {L. Qi}, 34595 title = {Convergence Analysis of Some Algorithms for Solving Nonsmooth Equations}, 34596 journal = {Mathematics of Operations Research}, 34597 year = {1993}, 34598 volume = {18}, 34599 pages = {227--244} 34600} 34601 34602@TechReport{ qi:regular, 34603 author = {L. Qi}, 34604 title = {Regular pseudo-smooth {NCP} and {BVIP} functions and globally and quadratically 34605 convergent generalized {N}ewton methods for complementarity and variational 34606 inequality problems}, 34607 institution = {School of Mathematics, University of New South Wales}, 34608 year = {1997}, 34609 type = {Applied Mathematics Report}, 34610 number = {AMR 97/14}, 34611 address = {Sydney, Australia} 34612} 34613 34614@Article{ radner:competitive, 34615 author = {R. Radner}, 34616 title = {Competitive Equilibrium under Uncertainty}, 34617 journal = {Econometrica}, 34618 year = {1968}, 34619 volume = {36}, 34620 pages = {31--58} 34621} 34622 34623@Article{ radstrom:embedding, 34624 author = {H. R{\aa}dstr{\"{o}}m}, 34625 title = {An embedding theorem for spaces of convex sets}, 34626 journal = {Proc. Amer. Math. Soc.}, 34627 year = {1952}, 34628 volume = {3}, 34629 pages = {165--169} 34630} 34631 34632@Article{ raghavachari:connections, 34633 author = {M. Raghavachari}, 34634 title = {On Connections between Zero--One Integer Programming and Concave Programming 34635 Under Linear Constraints}, 34636 journal = {Operations Research}, 34637 year = {1969}, 34638 volume = {17}, 34639 pages = {680--684} 34640} 34641 34642@Article{ rajan.burridge.ea:dynamics, 34643 author = {V. T. Rajan and R. Burridge and J. T. Schwartz}, 34644 title = {Dynamics of a rigid body in frictional contact with rigid walls}, 34645 journal = {IEEE International Conference on Robotics and Automation, Raleigh NC}, 34646 month = mar, 34647 year = {1987}, 34648 pages = {671--677} 34649} 34650 34651@Article{ ralph:branching, 34652 author = {D. Ralph}, 34653 title = {On Branching Numbers of Normal Manifolds}, 34654 journal = {Nonlinear Analysis, Theory, Methods and Applications}, 34655 volume = {22}, 34656 pages = {1041--1050}, 34657 year = {1994} 34658} 34659 34660@Article{ ralph:global, 34661 author = {D. Ralph}, 34662 title = {Global Convergence of Damped {N}ewton's Method for Nonsmooth Equations, via the 34663 Path Search}, 34664 journal = {Mathematics of Operations Research}, 34665 year = {1994}, 34666 volume = {19}, 34667 pages = {352--389} 34668} 34669 34670@InProceedings{ ralph:piecewise, 34671 author = {D. Ralph}, 34672 title = {A Piecewise Sequential Quadratic Programming Method for Mathematical Programs 34673 with Linear Complementarity Constraints}, 34674 booktitle = {Proceedings of the Seventh Conference on Computational Techniques and 34675 Applications (CTAC95)}, 34676 year = {1996} 34677} 34678 34679@PhDThesis{ raman:integration, 34680 author = {R. Raman}, 34681 title = {Integration of logic and heuristic knowledge in discrete optimization techniques 34682 for process systems.}, 34683 address = {Pittsburgh, Pennsylvania}, 34684 year = {1993}, 34685 school = {Department of Chemical Engineering, Carnegie Mellon University} 34686} 34687 34688@PhDThesis{ rangaraj:nonsmooth, 34689 author = {Narayan Rangaraj}, 34690 title = {Nonsmooth Optimization: Algorithms and Applications}, 34691 year = {1990}, 34692 address = {Baltimore, MD}, 34693 school = {Department of Mathematical Sciences, The Johns Hopkins University} 34694} 34695 34696@InProceedings{ reckwerdt.mackie.ea:three-dimensional, 34697 author = {P. J. Reckwerdt and T. R. Mackie and J. P. Balog and T. R. McNutt}, 34698 title = {Three-Dimensional Inverse Treatment Optimization for Tomotherapy}, 34699 booktitle = {Proceedings of the XII International Conference on the Use of Computers in 34700 Radiation Therapy, Salt Lake City}, 34701 year = {1997}, 34702 editor = {D. D. Leavitt and G. Starkshall}, 34703 publisher = {Medical Physics Publishing}, 34704 address = {St. Louis, Missouri}, 34705 pages = {420--422} 34706} 34707 34708@Article{ reid:sparsity-exploiting, 34709 author = {J. K. Reid}, 34710 title = {A Sparsity-Exploiting Variant of the {B}artels-{G}olub Decompostion for Linear 34711 Programming Bases}, 34712 journal = {Mathematical Programming}, 34713 year = {1982}, 34714 volume = {24}, 34715 pages = {55--69} 34716} 34717 34718@Book{ reingold.nievergelt.ea:combinatorial, 34719 author = {E. Reingold and J. Nievergelt and N. Deo}, 34720 title = {Combinatorial Algorithms: Theory and Practice}, 34721 publisher = {Prentice-Hall, Inc}, 34722 address = {Englewood Cliffs, New Jersey} 34723} 34724 34725@PhDThesis{ reinoza:degree, 34726 author = {J. A. Reinoza}, 34727 title = {A Degree for Generalized Equations}, 34728 year = {1979}, 34729 address = {Madison, Wisconsin}, 34730 school = {University of Wisconsin} 34731} 34732 34733@Article{ reinoza:solving, 34734 author = {A. Reinoza}, 34735 title = {Solving Generalized Equations via Homotopies}, 34736 journal = {Mathematical Programming}, 34737 year = {1985}, 34738 volume = {31}, 34739 pages = {307--320} 34740} 34741 34742@PhDThesis{ ren:computable, 34743 author = {J. Ren}, 34744 title = {Computable Error Bounds in Mathematical Programming}, 34745 school = {Computer Sciences Department, University of Wisconsin}, 34746 year = {1993}, 34747 address = {Madison, Wisconsin}, 34748 note = {Technical Report 1173} 34749} 34750 34751@Article{ renegar:polynomial-time, 34752 author = {J. Renegar}, 34753 title = {A Polynomial--Time Algorithm, based on {N}ewton's method, for Linear 34754 Programming}, 34755 journal = {Mathematical Programming}, 34756 year = {1988}, 34757 volume = {40}, 34758 pages = {59--94} 34759} 34760 34761@Article{ robbins.monro:stochastic, 34762 author = {H. Robbins and S. Monro}, 34763 title = {A Stochastic Approximation Method}, 34764 journal = {Annals of Mathematical Statistics}, 34765 year = {1951}, 34766 volume = {22}, 34767 pages = {400--407} 34768} 34769 34770@Article{ robinson:analysis, 34771 author = {S. M. Robinson}, 34772 title = {Analysis of Sample-Path Optimization}, 34773 journal = {Mathematics of Operations Research}, 34774 year = {1996}, 34775 volume = {21}, 34776 pages = {513--528} 34777} 34778 34779@InCollection{ robinson:bundle-based, 34780 author = {S. M. Robinson}, 34781 title = {Bundle-Based Decomposition: Conditions for Convergence}, 34782 booktitle = {Analyse Non Lin\'{e}aire}, 34783 year = {1989}, 34784 editor = {H. Attouch and J. P. Aubin and F. Clarke and I. Ekeland}, 34785 publisher = {Gauthier-Villaars}, 34786 address = {Paris}, 34787 pages = {435--447} 34788} 34789 34790@InCollection{ robinson:bundle-based*1, 34791 author = {S. M. Robinson}, 34792 title = {Bundle-Based Decomposition: Description and Preliminary Results}, 34793 booktitle = {System Modeling and Optimization}, 34794 year = {1986}, 34795 editor = {A Pr\'{e}kopa and J. Szelezc\'{a}n and B. Straazicky}, 34796 publisher = {Springer-Verlag}, 34797 address = {Berlin}, 34798 pages = {751--756}, 34799 volume = {84}, 34800 series = {Lecture Notes in Control and Information Sciences} 34801} 34802 34803@Article{ robinson:continuity, 34804 author = {S. M. Robinson}, 34805 title = {Some Continuity Properties of Polyhedral Multifunctions}, 34806 journal = {Mathematical Programming Study}, 34807 year = {1981}, 34808 volume = {14}, 34809 pages = {206--214} 34810} 34811 34812@Article{ robinson:extension, 34813 author = {S. M. Robinson}, 34814 title = {Extension of {N}ewton's Method to Nonlinear Functions with Values in a Cone}, 34815 journal = {Numerische Mathematik}, 34816 year = {1972}, 34817 volume = {19}, 34818 pages = {341--347} 34819} 34820 34821@InCollection{ robinson:generalized, 34822 crossref = {bachem.grotschel.ea:mathematical}, 34823 author = {S. M. Robinson}, 34824 title = {Generalized Equations}, 34825 pages = {346--367} 34826} 34827 34828@Article{ robinson:generalized*1, 34829 author = {S. M. Robinson}, 34830 title = {Generalized Equations and their Solution: {P}art {I}: Basic Theory}, 34831 journal = {Mathematical Programming Study}, 34832 year = {1979}, 34833 volume = {10}, 34834 pages = {128--141} 34835} 34836 34837@InCollection{ robinson:homeomorphism, 34838 author = {S. M. Robinson}, 34839 title = {Homeomorphism Conditions for Normal Maps of Polyhedra}, 34840 booktitle = {Optimization and Nonlinear Analysis}, 34841 year = {1992}, 34842 editor = {A. Ioffe and M. Marcus and S. Reich}, 34843 publisher = {Longman}, 34844 address = {Harlow, Essex, England}, 34845 pages = {240--248}, 34846 series = {Pitman Research Notes in Mathematics Series No. 244} 34847} 34848 34849@Article{ robinson:implicit-function, 34850 author = {S. M. Robinson}, 34851 title = {An Implicit--Function Theorem for a Class of Nonsmooth Functions}, 34852 journal = {Mathematics of Operations Research}, 34853 year = {1991}, 34854 volume = {16}, 34855 pages = {292--309} 34856} 34857 34858@Article{ robinson:local*1, 34859 author = {S. M. Robinson}, 34860 title = {Local Epi--Continuity and Local Optimization}, 34861 journal = {Mathematical Programming}, 34862 year = {1987}, 34863 volume = {37}, 34864 pages = {208--222} 34865} 34866 34867@Article{ robinson:local*2, 34868 author = {S. M. Robinson}, 34869 title = {Local Structure of Feasible Sets in Nonlinear Programming, {P}art~{II}: 34870 Nondegeneracy}, 34871 journal = {Mathematical Programming Study}, 34872 year = {1984}, 34873 volume = {22}, 34874 pages = {217--230} 34875} 34876 34877@Article{ robinson:local*3, 34878 author = {S. M. Robinson}, 34879 title = {Local Structure of Feasible Sets in Nonlinear Programming, {P}art~{III}: 34880 Stability and Sensitivity}, 34881 journal = {Mathematical Programming Study}, 34882 year = {1987}, 34883 volume = {30}, 34884 pages = {45--66} 34885} 34886 34887@Article{ robinson:mathematical, 34888 author = {S. M. Robinson}, 34889 title = {Mathematical Foundations of Nonsmooth Embedding Methods}, 34890 journal = {Mathematical Programming}, 34891 year = {1990}, 34892 volume = {48}, 34893 pages = {221--229} 34894} 34895 34896@Article{ robinson:newtons, 34897 author = {S. M. Robinson}, 34898 title = {{N}ewton's Method for a Class of Nonsmooth Functions}, 34899 journal = {Set Valued Analysis}, 34900 year = {1994}, 34901 volume = {2}, 34902 pages = {291--305} 34903} 34904 34905@Article{ robinson:nonsingularity, 34906 author = {S. M. Robinson}, 34907 title = {Nonsingularity and Symmetry for Linear Normal Maps}, 34908 journal = {Mathematical Programming}, 34909 year = {1993}, 34910 volume = {62}, 34911 pages = {415--425} 34912} 34913 34914@InCollection{ robinson:nonsmooth, 34915 author = {S. M. Robinson}, 34916 title = {Nonsmooth Continuation for Generalized Equations}, 34917 year = {1997}, 34918 pages = {282--291}, 34919 editors = {P. Gritzmann and R. Horst and E. Sachs and R. Tichatschke}, 34920 booktitle = {Recent Advances in Optimization}, 34921 series = {Lecture Notes in Economics and Mathematical Systems}, 34922 volume = {452}, 34923 publisher = {Springer-Verlag}, 34924 address = {Heidelberg} 34925} 34926 34927@Article{ robinson:normal, 34928 author = {S. M. Robinson}, 34929 title = {Normal Maps Induced by Linear Transformations}, 34930 journal = {Mathematics of Operations Research}, 34931 year = {1992}, 34932 volume = {17}, 34933 pages = {691--714} 34934} 34935 34936@Article{ robinson:normed, 34937 author = {S. M. Robinson}, 34938 title = {Normed Convex Processes}, 34939 journal = {Transactions of the American Mathematical Society}, 34940 year = {1972}, 34941 volume = {174}, 34942 pages = {127--140} 34943} 34944 34945@Article{ robinson:reduction, 34946 author = {S. M. Robinson}, 34947 title = {A reduction method for variational inequalities}, 34948 journal = {Mathematical Programming}, 34949 year = {1998}, 34950 volume = {80}, 34951 pages = {161--169} 34952} 34953 34954@Article{ robinson:regularity, 34955 author = {S. M. Robinson}, 34956 title = {Regularity and stability for convex multivalued functions}, 34957 journal = {Mathematics of Operations Research}, 34958 year = {1976}, 34959 volume = {1}, 34960 pages = {130--143} 34961} 34962 34963@Unpublished{ robinson:shadow, 34964 author = {S. M. Robinson}, 34965 title = {Shadow {JUNK} for biblio file}, 34966 year = {1800} 34967} 34968 34969@Article{ robinson:shadow*1, 34970 author = {S. M. Robinson}, 34971 title = {Shadow Prices for Measures of Effectiveness {I}: Linear Model}, 34972 journal = {Operations Research}, 34973 year = {1993}, 34974 volume = {41}, 34975 pages = {518--535} 34976} 34977 34978@Article{ robinson:shadow*2, 34979 author = {S. M. Robinson}, 34980 title = {Shadow Prices for Measures of Effectiveness {II}: General Model}, 34981 journal = {Operations Research}, 34982 year = {1993}, 34983 volume = {41}, 34984 pages = {536--548} 34985} 34986 34987@Unpublished{ robinson:stability, 34988 author = {S. M. Robinson}, 34989 title = {Stability {JUNK} for biblio file}, 34990 year = {1800} 34991} 34992 34993@Article{ robinson:stability*1, 34994 author = {S. M. Robinson}, 34995 title = {Stability theory for systems of inequalities, {P}art {I}: linear systems}, 34996 journal = {SIAM Journal on Numerical Analysis}, 34997 year = {1975}, 34998 volume = {12}, 34999 pages = {754--769} 35000} 35001 35002@Article{ robinson:stability*2, 35003 author = {S. M. Robinson}, 35004 title = {Stability theory for systems of inequalities, {P}art {II}: Differentiable 35005 Nonlinear Systems}, 35006 journal = {SIAM Journal on Numerical Analysis}, 35007 year = {1976}, 35008 volume = {13}, 35009 pages = {497--513} 35010} 35011 35012@Article{ robinson:strongly, 35013 author = {S. M. Robinson}, 35014 title = {Strongly Regular Generalized Equations}, 35015 journal = {Mathematics of Operations Research}, 35016 year = {1980}, 35017 volume = {5}, 35018 pages = {43--62} 35019} 35020 35021@Article{ rockafellar.wets:generalized, 35022 author = {R. T. Rockafellar and R. J.--B. Wets}, 35023 title = {Generalized Linear-Quadratic Problems of Deterministic and Stochastic Optimal 35024 Control in Discrete Time}, 35025 journal = {SIAM Journal on Control and Optimization}, 35026 year = {1990}, 35027 volume = {28}, 35028 pages = {810--822} 35029} 35030 35031@Article{ rockafellar.wets:lagrangian, 35032 author = {R. T. Rockafellar and R. J.--B. Wets}, 35033 title = {A {L}agrangian Finite Generation Technique for Solving Linear-Quadratic Problems 35034 in Stochastic Programming}, 35035 journal = {Mathematical Programming Study}, 35036 year = {1986}, 35037 volume = {28}, 35038 pages = {63--93} 35039} 35040 35041@InCollection{ rockafellar.wets:linear-quadratic, 35042 author = {R. T. Rockafellar and R. J.--B. Wets}, 35043 title = {Linear-Quadratic Programming Problems with Stochastic Penalties: the Finite 35044 Generation Algorithm}, 35045 booktitle = {Stochastic Optimization}, 35046 publisher = {Springer-Verlag}, 35047 year = {1987}, 35048 editor = {V. I. Arkin and A. Shiraer and R. J.--B. Wets}, 35049 series = {Lecture Notes in Control and Information Sciences, IIASA Series No. 81}, 35050 pages = {545--560}, 35051 address = {New York, Berlin} 35052} 35053 35054@Article{ rockafellar.wets:scenarios, 35055 author = {R. T. Rockafellar and R. J.--B. Wets}, 35056 title = {Scenarios and Policy Aggregation in Optimization under Uncertainty}, 35057 journal = {Mathematics of Operations Research}, 35058 year = {1991}, 35059 volume = {10}, 35060 pages = {119--147} 35061} 35062 35063@InProceedings{ rockafellar:applications, 35064 author = {R. T. Rockafellar}, 35065 title = {New Applications of Duality in Convex Programming}, 35066 booktitle = {Proceedings of the Fourth Conference on Probability}, 35067 year = {1971}, 35068 address = {Brasov, Romania} 35069} 35070 35071@Article{ rockafellar:augmented, 35072 author = {R. T. Rockafellar}, 35073 title = {Augmented {L}agrange Multiplier Functions and Duality in Nonconvex Programming}, 35074 journal = {SIAM Journal on Control and Optimization}, 35075 year = {1974}, 35076 volume = {12}, 35077 pages = {268--285} 35078} 35079 35080@Article{ rockafellar:augmented*1, 35081 author = {R. T. Rockafellar}, 35082 title = {Augmented {L}agrangians and Applications of the Proximal Point Algorithm in 35083 Convex Programming}, 35084 journal = {Mathematics of Operations Research}, 35085 year = {1976}, 35086 volume = {1}, 35087 pages = {97--116} 35088} 35089 35090@Article{ rockafellar:characterization, 35091 author = {R. T. Rockafellar}, 35092 title = {Characterization of the subdifferentials of convex functions}, 35093 journal = {Pacific Journal of Mathematics}, 35094 year = {1966}, 35095 volume = {17}, 35096 number = {3}, 35097 pages = {497--510} 35098} 35099 35100@Article{ rockafellar:computational, 35101 author = {R. T. Rockafellar}, 35102 title = {Computational Schemes for Large--Scale Problems in Extended Linear--Quadratic 35103 Programming}, 35104 journal = {Mathematical Programming}, 35105 year = {1990}, 35106 volume = {48}, 35107 pages = {447--474} 35108} 35109 35110@Book{ rockafellar:conjugate, 35111 author = {R. T. Rockafellar}, 35112 title = {Conjugate Duality and Optimization}, 35113 year = {1974}, 35114 publisher = {SIAM}, 35115 address = {Philadelphia, Pennsylvania}, 35116 volume = {16}, 35117 series = {Conference Board of the Mathematical Sciences} 35118} 35119 35120@Book{ rockafellar:convex, 35121 author = {R. T. Rockafellar}, 35122 title = {Convex Analysis}, 35123 year = {1970}, 35124 publisher = {Princeton University Press}, 35125 address = {Princeton, New Jersey} 35126} 35127 35128@Article{ rockafellar:first-, 35129 author = {R. T. Rockafellar}, 35130 title = {First-- and Second--Order Epi--Differentiabilty in Nonlinear Programming}, 35131 journal = {Transactions of the American Mathematical Society}, 35132 year = {1988}, 35133 volume = {307}, 35134 pages = {75--108} 35135} 35136 35137@InProceedings{ rockafellar:generalized, 35138 author = {R. T. Rockafellar}, 35139 title = {A Generalized Approach to Linear-Quadratic Programming}, 35140 booktitle = {Proceedings of the International Conference on Numerical Optimization and 35141 Applications}, 35142 year = {1986}, 35143 pages = {58--66}, 35144 note = {(Xi'an, China)} 35145} 35146 35147@InProceedings{ rockafellar:generalized*1, 35148 crossref = {bachem.grotschel.ea:mathematical}, 35149 author = {R. T. Rockafellar}, 35150 title = {Generalized Subgradients in Mathematical Programming}, 35151 pages = {368--390} 35152} 35153 35154@InCollection{ rockafellar:large-scale, 35155 author = {R. T. Rockafellar}, 35156 title = {Large-Scale Extended Linear-Quadratic Programming and Multistage Optimization}, 35157 booktitle = {Advances in Numerical Partial Differential Equations and Optimization}, 35158 chapter = {15}, 35159 year = {1991}, 35160 editor = {S. Gomez and J. P. Hennart and R. A. Tapia}, 35161 publisher = {SIAM Publications}, 35162 pages = {247--261} 35163} 35164 35165@Article{ rockafellar:linear-quadratic, 35166 author = {R. T. Rockafellar}, 35167 title = {Linear-Quadratic Programming and Optimal Control}, 35168 journal = {SIAM Journal on Control and Optimization}, 35169 year = {1987}, 35170 volume = {25}, 35171 pages = {781--814} 35172} 35173 35174@Article{ rockafellar:maximality, 35175 author = {R. T. Rockafellar}, 35176 title = {On the Maximality of Sums of Nonlinear Monotone Operators}, 35177 journal = {Transactions of the American Mathematical Society}, 35178 year = {1970}, 35179 volume = {149}, 35180 pages = {75--88} 35181} 35182 35183@InCollection{ rockafellar:monotone, 35184 author = {R. T. Rockafellar}, 35185 title = {Monotone Operators and Augmented {L}agrangian Methods in Nonlinear Programming}, 35186 crossref = {mangasarian.meyer.ea:nonlinear*3}, 35187 pages = {1--26} 35188} 35189 35190@Article{ rockafellar:monotone*1, 35191 author = {R. T. Rockafellar}, 35192 title = {Monotone Operators and the Proximal Point Algorithm}, 35193 journal = {SIAM Journal on Control and Optimization}, 35194 year = {1976}, 35195 volume = {14}, 35196 pages = {877--898} 35197} 35198 35199@Article{ rockafellar:multiplier, 35200 author = {R. T. Rockafellar}, 35201 title = {The Multiplier Method of {H}estenes and {P}owell Applied to Convex Programming}, 35202 journal = {Journal of Optimization Theory and Applications}, 35203 year = {1973}, 35204 volume = {12}, 35205 pages = {555--562} 35206} 35207 35208@Article{ rockafellar:multistage, 35209 author = {R. T. Rockafellar}, 35210 title = {Multistage Convex Programming and Discrete-Time Optimal Control}, 35211 journal = {Control and Cybernetics}, 35212 year = {1988}, 35213 volume = {17}, 35214 number = {2-3}, 35215 pages = {225--245} 35216} 35217 35218@Book{ rockafellar:network, 35219 author = {R. T. Rockafellar}, 35220 title = {Network Flows and Monotropic Optimization}, 35221 publisher = {John Wiley}, 35222 year = {1984}, 35223 address = {New York} 35224} 35225 35226@Article{ rodrigues:mixed, 35227 author = {H. C. Rodrigues}, 35228 title = {A mixed variational formulation for shape optimization of solids with contact 35229 conditions}, 35230 journal = {Structural Optimization}, 35231 volume = {6}, 35232 year = {1993}, 35233 pages = {19--28} 35234} 35235 35236@Book{ rodrigues:obstacle, 35237 author = {J. F. Rodrigues}, 35238 title = {Obstacle Problems in Mathematical Physics}, 35239 publisher = {Elsevier Publishing Company}, 35240 address = {Amsterdam}, 35241 year = {1987} 35242} 35243 35244@Book{ roos.terlaky.ea:theory, 35245 author = {C. Roos and T. Terlaky and J.--Ph. Vial}, 35246 title = {Theory and Algorithms for Linear Optimization: An Interior-Point Approach}, 35247 publisher = {John Wiley \& Sons}, 35248 year = {1997}, 35249 address = {Chichester} 35250} 35251 35252@TechReport{ rosa:decomposition, 35253 author = {C. H. Rosa}, 35254 title = {A Decomposition Technique for Equilibrium Programming under Uncertainty}, 35255 institution = {IIASA}, 35256 year = {1996}, 35257 number = {WP-96-013}, 35258 address = {A-2361 Laxenburg, Austria} 35259} 35260 35261@Article{ rosen.lane.ea:treatment, 35262 author = {I. Rosen and R. Lane and S. Morrill and J. Belli}, 35263 title = {Treatment Plan Optimization Using Linear Programming}, 35264 journal = {Medical Physics}, 35265 year = {1990}, 35266 volume = {18}, 35267 number = {2}, 35268 pages = {141--152} 35269} 35270 35271@TechReport{ rosenblatt:perceptron-a, 35272 author = {F. Rosenblatt}, 35273 title = {The perceptron--a perceiving and recognizing automaton}, 35274 institution = {Cornell Aeronautical Laboratory}, 35275 year = {1957}, 35276 month = jan, 35277 address = {Ithaca, New York}, 35278 number = {85-460-1} 35279} 35280 35281@Book{ rosenblatt:principles, 35282 author = {F. Rosenblatt}, 35283 title = {Principles of Neurodynamics}, 35284 year = {1962}, 35285 publisher = {Spartan Books}, 35286 address = {New York} 35287} 35288 35289@InProceedings{ rosenblatt:two, 35290 author = {F. Rosenblatt}, 35291 title = {Two theorems of statistical separability in the perceptron}, 35292 booktitle = {Proceedings of Symposium Held at National Physical Laboratory, November 1958}, 35293 year = {1959}, 35294 publisher = {{HMS} Stationery Office}, 35295 address = {London}, 35296 volume = {1} 35297} 35298 35299@Article{ rosenbrock:automatic, 35300 author = {H. H. Rosenbrock}, 35301 title = {Automatic Method for Finding the Greatest or Least Value of a Function}, 35302 journal = {Computer Journal}, 35303 year = {1960}, 35304 volume = {3}, 35305 pages = {175--184} 35306} 35307 35308@Article{ roy.mukhopadhyay:pattern, 35309 author = {A. Roy and S. Mukhopadhyay}, 35310 title = {Pattern Classification Using Linear Programming}, 35311 journal = {ORSA Journal on Computing}, 35312 year = {1990}, 35313 volume = {3}, 35314 pages = {66--80} 35315} 35316 35317@Book{ rubinstein:monte, 35318 author = {R. Rubinstein}, 35319 title = {Monte Carlo Optimization, Simulation, and Sensitivity Analysis of Queueing 35320 Networks}, 35321 publisher = {Wiley}, 35322 address = {New York, NY}, 35323 year = {1986} 35324} 35325 35326@Article{ ruchala.olivera.ea:comparison, 35327 author = {K. J. Ruchala and G. H. Olivera and T. R. Mackie}, 35328 title = {A Comparison of Maximum-Likelihood and Iterative Filtered Backprojection 35329 Reconstruction Algorithms for Megavoltage {CT} on a Tomotherapy System}, 35330 journal = {Physics in Medicine and Biology, forthcoming}, 35331 year = {1999} 35332} 35333 35334@Book{ rudin:principles, 35335 author = {W. Rudin}, 35336 title = {Principles of Mathematical Analysis}, 35337 year = {1976}, 35338 publisher = {McGraw--Hill}, 35339 address = {Tokyo, Japan}, 35340 edition = {Third} 35341} 35342 35343@Book{ rudin:real, 35344 author = {W. Rudin}, 35345 title = {Real and Complex Analysis}, 35346 year = {1974}, 35347 publisher = {McGraw--Hill}, 35348 address = {Tokyo, Japan}, 35349 edition = {Second} 35350} 35351 35352@InProceedings{ rumelhart.hinton.ea:learning, 35353 author = {D. E. Rumelhart and G. E. Hinton and R. J. Williams}, 35354 title = {Learning Internal Representations by Error Propagation}, 35355 booktitle = {Parallel Distributed Processing}, 35356 year = {1986}, 35357 editor = {D. E. Rumelhart and J. L. McClelland}, 35358 publisher = {MIT Press}, 35359 address = {Cambridge, Massachusetts}, 35360 pages = {318--362} 35361} 35362 35363@Book{ rumelhart.mcclelland:parallel, 35364 author = {D. E. Rumelhart and J. L. McClelland}, 35365 title = {Parallel Distributed Processing}, 35366 year = {1986}, 35367 publisher = {MIT Press}, 35368 address = {Cambridge, Massachusetts} 35369} 35370 35371@InCollection{ ruszczynski:regularized, 35372 author = {A. Ruszczynski}, 35373 title = {On the Regularized Decomposition for Stochastic Programming Problems}, 35374 year = {1995}, 35375 booktitle = {Stochastic Programming: Numerical Techniques and Engineering Applications}, 35376 editor = {K. Marti and P. Kall}, 35377 publisher = {Springer-Verlag}, 35378 address = {Berlin}, 35379 volume = {425}, 35380 series = {Lecture Notes in Control and Information Sciences}, 35381 pages = {93--108} 35382} 35383 35384@Article{ rutherford.rutstrom.ea:lacord, 35385 author = {T. F. Rutherford and E. E. Rutstrom and D. Tarr}, 35386 title = {{L}'accord de libre-echange entre le {M}aroc et la {CE}: une evaluation 35387 quantitative}, 35388 journal = {Revue d' Economie du developpement}, 35389 year = {1994} 35390} 35391 35392@InCollection{ rutherford.tarr:blueprints, 35393 author = {T. Rutherford and D. Tarr}, 35394 title = {Blueprints, Spillovers and the Dynamic Gains from Trade Liberalization in a Small 35395 Open Economy}, 35396 booktitle = {Dynamic Issues in Applied Commercial Policy Analysis}, 35397 publisher = {Cambridge University Press}, 35398 year = {1997}, 35399 editor = {R. Baldwin and J. Francois}, 35400 address = {New York} 35401} 35402 35403@Article{ rutherford:applied, 35404 author = {T. F. Rutherford}, 35405 title = {Applied General Equilibrium Modeling with {MPSGE} as a {GAMS} Subsystem: An 35406 Overview of the Modeling Framework and Syntax}, 35407 year = {1999}, 35408 volume = {14}, 35409 pages = {1--46}, 35410 journal = {Computational Economics} 35411} 35412 35413@PhDThesis{ rutherford:applied*1, 35414 author = {T. F. Rutherford}, 35415 title = {Applied General Equilibrium Modeling}, 35416 school = {Stanford University}, 35417 year = {1987} 35418} 35419 35420@Article{ rutherford:extensions, 35421 author = {T. F. Rutherford}, 35422 title = {Extensions of {GAMS} for Complementarity Problems Arising in Applied Economic 35423 Analysis}, 35424 journal = {Journal of Economic Dynamics and Control}, 35425 volume = {19}, 35426 pages = {1299--1324}, 35427 year = {1995} 35428} 35429 35430@Misc{ rutherford:gnuplot, 35431 author = {T. F. Rutherford}, 35432 title = {A Libinclude Interface to Gnuplot from {GAMS}}, 35433 organization = {Department of Economics, University of Colorado}, 35434 address = {Boulder, Colorado}, 35435 note = {http://robles.colorado.edu/~tomruth/gnuplot/gnuplot.htm} 35436} 35437 35438@Unpublished{ rutherford:miles, 35439 author = {T. F. Rutherford}, 35440 title = {{MILES}: {A} Mixed Inequality and nonLinear Equation Solver}, 35441 year = {1993}, 35442 note = {Working Paper, Department of Economics, University of Colorado, Boulder} 35443} 35444 35445@TechReport{ rutherford:modeling, 35446 author = {T. F. Rutherford}, 35447 title = {A Modeling System for Applied General Equilibrium Analysis}, 35448 type = {Cowles Foundation Discussion Paper}, 35449 number = {836}, 35450 institution = {Yale University}, 35451 year = {1987} 35452} 35453 35454@TechReport{ rutherford:mpsge, 35455 author = {T. F. Rutherford}, 35456 title = {{MPSGE}}, 35457 institution = {University of Western Ontario}, 35458 year = {1988}, 35459 address = {London, Ontario} 35460} 35461 35462@Article{ rykov:simplex, 35463 author = {A. S. Rykov}, 35464 title = {Simplex Direct Search Algorithms}, 35465 journal = {Automation and Remote Control}, 35466 year = {1980}, 35467 volume = {41}, 35468 pages = {784--793} 35469} 35470 35471@Article{ saad.schultz:gmres, 35472 author = {Y. Saad and M. Schultz}, 35473 title = {{GMRES}: {A} Generalized Minimal Residual Algorithm for Solving Nonsymmetric 35474 Linear Systems}, 35475 journal = {SIAM Journal on Scientific and Statistical Computing}, 35476 year = {1986}, 35477 volume = {44}, 35478 pages = {856--869} 35479} 35480 35481@Book{ saad:iterative, 35482 author = {Y. Saad}, 35483 title = {Iterative Methods for Sparse Linear Systems}, 35484 year = {1996}, 35485 publisher = {PWS Publishing Company}, 35486 address = {Boston, Massachusetts} 35487} 35488 35489@Article{ sahni:approximate, 35490 author = {S. Sahni}, 35491 title = {Approximate Algorithms for the 0/1 Knapsack Problem}, 35492 journal = {jacm}, 35493 year = {1975}, 35494 volume = {22}, 35495 pages = {115--124} 35496} 35497 35498@InProceedings{ sauer.shepard.ea:comparison, 35499 author = {O. A. Sauer and D. M. Shepard and L. Angelos and T. R. Mackie}, 35500 title = {A Comparison of Objective Functions for Use in Radiotherapy Optimization}, 35501 booktitle = {Proceedings of the XII International Conference on the Use of Computers in 35502 Radiation Therapy, Salt Lake City}, 35503 year = {1997}, 35504 editor = {D. D. Leavitt and G. Starkshall}, 35505 publisher = {Medical Physics Publishing}, 35506 address = {St. Louis, Missouri} 35507} 35508 35509@Article{ sauer.xu:multivariate, 35510 author = {Th. Sauer and Y. Xu}, 35511 title = {On Multivariate {L}agrange Interpolation}, 35512 journal = {Mathematics of Computation}, 35513 year = {1995}, 35514 volume = {64}, 35515 pages = {1147--1170} 35516} 35517 35518@Article{ savelsbergh:preprocessing, 35519 author = {M. W. P. Savelsbergh}, 35520 title = {Preprocessing and Probing Techniques for Mixed Integer Programming Problems}, 35521 journal = {ORSA Journal on Computing}, 35522 year = {1994}, 35523 volume = {6}, 35524 pages = {445--454} 35525} 35526 35527@Article{ scarf:approximation, 35528 author = {H. E. Scarf}, 35529 title = {The Approximation of Fixed Points of a Continuous Mapping}, 35530 journal = {SIAM Journal on Applied Mathematics}, 35531 year = {1967}, 35532 volume = {15}, 35533 pages = {1328--1343} 35534} 35535 35536@Book{ scarf:computation, 35537 author = {H. E. Scarf}, 35538 title = {The Computation of Economic Equilibria}, 35539 year = {1973}, 35540 publisher = {Yale University Press}, 35541 address = {New Haven, Connecticut} 35542} 35543 35544@TechReport{ scheel.scholtes:mathematical, 35545 author = {H. Scheel and S. Scholtes}, 35546 title = {Mathematical Programs with Complementarity Constraints: Stationarity, Optimality, 35547 and Sensitivity}, 35548 institution = {Judge Institute of Management Studies, University of Cambridge}, 35549 year = {1998}, 35550 type = {Technical Report}, 35551 address = {Cambridge, England} 35552} 35553 35554@Article{ schlick:modified, 35555 author = {T. Schlick}, 35556 title = {Modified {C}holesky Factorization for Sparse Preconditioners}, 35557 journal = {SIAM Journal on Scientific Computing}, 35558 year = {1993}, 35559 volume = {14}, 35560 pages = {424--445} 35561} 35562 35563@Article{ schnabel.eskow:modified, 35564 author = {R. B. Schnabel and E. Eskow}, 35565 title = {A New Modified {C}holesky Factorization}, 35566 journal = {SIAM Journal on Scientific and Statistical Computing}, 35567 year = {1991}, 35568 volume = {11}, 35569 pages = {1136--1158} 35570} 35571 35572@Article{ schneider.zenios:comparative, 35573 author = {M. H. Schneider and S. A. Zenios}, 35574 title = {A Comparative Study of Algorithms for Matrix Balancing}, 35575 journal = {Operations Research}, 35576 year = {1990}, 35577 volume = {38}, 35578 pages = {439--455} 35579} 35580 35581@Book{ scholkopf.burges.ea:advances, 35582 editor = {B. {Sch\"{o}lkopf} and C. Burges and A. Smola}, 35583 title = {Advances in Kernel Methods: Support Vector Machines}, 35584 publisher = {MIT Press}, 35585 address = {Cambridge, MA }, 35586 year = {1998}, 35587 isbn = {0-262-19416-3} 35588} 35589 35590@Article{ scholtes.stohr:exact, 35591 author = {S. Scholtes and M. St{\"{o}}hr}, 35592 title = {Exact Penalization of Mathematical Programs with Equilibrium Constraints}, 35593 journal = {SIAM Journal on Control and Optimization}, 35594 volume = {37}, 35595 pages = {617--652}, 35596 year = {1999} 35597} 35598 35599@TechReport{ scholtes:introduction, 35600 author = {S. Scholtes}, 35601 title = {Introduction to piecewise differentiable equations}, 35602 institution = {Institut f{\"{u}}r Statistik und Mathematische Wirtschaftstheorie, 35603 Universit{\"{a}}t Karlsruhe}, 35604 year = {1994}, 35605 type = {Preprint}, 35606 number = {No. 53/1994}, 35607 address = {Karlsruhe, Germany} 35608} 35609 35610@Article{ schramm.zowe:version, 35611 author = {H. Schramm and J. Zowe}, 35612 title = {A Version of the Bundle Idea for Minimizing a Nonsmooth Function: Conceptual 35613 Idea, Convergence Analysis, Numerical Results}, 35614 journal = {SIAM Journal on Optimization}, 35615 year = {1992}, 35616 volume = {2}, 35617 pages = {121--152} 35618} 35619 35620@Article{ schultz.meyer:interior, 35621 author = {G. L. Schultz and R. R. Meyer}, 35622 title = {An Interior Point Method for Block Angular Optimization}, 35623 journal = {SIAM Journal on Optimization}, 35624 year = {1991}, 35625 volume = {1}, 35626 pages = {583--602} 35627} 35628 35629@InProceedings{ sekiguchi.sato.ea:ninf, 35630 author = {S. Sekiguchi and M. Sato and S. Matsuoka and U. Nagashima}, 35631 title = {Ninf: Network based Information Library for Globally High Performance Computing}, 35632 booktitle = {Proceedings of the Parallel Object-Oriented Methods and Applications ({POOMA})}, 35633 year = {1996}, 35634 address = {Santa Fe} 35635} 35636 35637@InCollection{ sellami.robinson:homotopies, 35638 author = {H. Sellami and S. M. Robinson}, 35639 title = {Homotopies Based on Nonsmooth Equations for Solving Nonlinear Variational 35640 Inequalities}, 35641 booktitle = {Nonlinear Optimization and Applications}, 35642 editor = {G. Di Pillo and F. Giannessi}, 35643 year = {1996}, 35644 pages = {327--343}, 35645 publisher = {Plenum Press}, 35646 address = {New York} 35647} 35648 35649@Article{ sellami.robinson:implementation, 35650 author = {H. Sellami and S. M. Robinson}, 35651 title = {Implementation of a Continuation Method for Normal Maps}, 35652 journal = {Mathematical Programming}, 35653 year = {1997}, 35654 volume = {76}, 35655 pages = {563--578} 35656} 35657 35658@PhDThesis{ sellami:continuation, 35659 author = {H. Sellami}, 35660 title = {A Continuation Method for Normal Maps}, 35661 school = {University of Wisconsin -- Madison}, 35662 year = {1994}, 35663 address = {Madison, Wisconsin} 35664} 35665 35666@Article{ sellami:homotopy, 35667 author = {H. Sellami}, 35668 title = {A Homotopy Continuation Method for Normal Maps}, 35669 journal = {Mathematical Programming}, 35670 vol = {82}, 35671 year = {1998}, 35672 pages = {317--337} 35673} 35674 35675@Book{ seuss:one, 35676 author = {{Dr.} A. Seuss}, 35677 title = {One Fish, Two Fish, Red Fish, Blue Fish}, 35678 year = {1960}, 35679 publisher = {Beginner Books}, 35680 address = {New York}, 35681 series = {Beginner Books, B13}, 35682 note = {A story--poem about the activities of such unusual animals as the Nook, Wump, 35683 Yink, Yop, Gack, and the Zeds} 35684} 35685 35686@Article{ seyfferth.pfeiffer:dynamics, 35687 author = {W. Seyfferth and F. Pfeiffer}, 35688 title = {Dynamics of Assembly Processes With a Manipulator}, 35689 journal = {Proceedings of the 1992 IEEE/RSJ International Conference on Intelligent Robots 35690 and Systems}, 35691 year = {1992}, 35692 pages = {1303--1310} 35693} 35694 35695@Article{ shanno.simantiraki:infeasible, 35696 author = {D. Shanno and E. Simantiraki}, 35697 title = {An Infeasible Interior--Point Method for Linear Complementarity Problems}, 35698 year = {1997}, 35699 journal = {SIAM Journal on Optimization}, 35700 volume = {7}, 35701 pages = {620--640} 35702} 35703 35704@InProceedings{ shanno.simantiraki:interior, 35705 author = {D. Shanno and E. Simantiraki}, 35706 title = {Interior Point Methods for Linear and Nonlinear Programming}, 35707 booktitle = {State of the Art in Numerical Analysis}, 35708 year = {1997}, 35709 editor = {I. S. Duff and G. A. Watson}, 35710 publisher = {Oxford University Press}, 35711 address = {Oxford} 35712} 35713 35714@Article{ shannon:introduction, 35715 author = {R. E. Shannon}, 35716 title = {Introduction to the Art and Science of simulation}, 35717 journal = {WSC98 1998 Winter simulation conference proceedings}, 35718 year = {1998}, 35719 volume = {1}, 35720 pages = {7--14} 35721} 35722 35723@TechReport{ shapiro:concepts, 35724 author = {A. Shapiro}, 35725 title = {On Concepts of Directional Differentiability}, 35726 institution = {Department of Mathematics and Applied Mathematics, University of South Africa}, 35727 year = {1988}, 35728 address = {Pretoria, South Africa}, 35729 number = {73/88(18)}, 35730 type = {Research Report} 35731} 35732 35733@Book{ shavlik.editors:readings, 35734 author = {J. W. Shavlik and T. G. Dietterich {(editors)}}, 35735 title = {Readings in Machine Learning}, 35736 year = {1990}, 35737 publisher = {Morgan Kaufman}, 35738 address = {San Mateo, California} 35739} 35740 35741@Article{ shavlik.mooney.ea:symbolic, 35742 author = {J. W. Shavlik and R. J. Mooney and G. G. Towell}, 35743 title = {Symbolic and Neural Network Learning Algorithms: An Experimental Comparison}, 35744 journal = {Machine Learning}, 35745 year = {1991}, 35746 volume = {6}, 35747 pages = {111--143} 35748} 35749 35750@Book{ sheffi:urban, 35751 author = {Y. Sheffi}, 35752 title = {Urban Transportation Networks}, 35753 publisher = {Prentice-Hall, Inc}, 35754 year = {1985}, 35755 address = {Englewood Cliffs, New Jersey} 35756} 35757 35758@Article{ sheng.potra:quadratically, 35759 author = {R. Sheng and F. A. Potra}, 35760 title = {A Quadratically {CO}nvergent Infeasible-Interior-Point {AL}gorithm for {LCP} with 35761 Polynomial {CO}mplexity}, 35762 journal = {SIAM Journal on Optimization}, 35763 year = {1997}, 35764 volume = {7}, 35765 pages = {304--317} 35766} 35767 35768@InProceedings{ shepard.angelos.ea:simple, 35769 author = {D. M. Shepard and L. Angelos and O. A. Sauer and T. R. Mackie}, 35770 title = {A Simple Model for Examining Radiotherapy Optimization}, 35771 booktitle = {Proceedings of the XII International Conference on the Use of Computers in 35772 Radiation Therapy, Salt Lake City}, 35773 year = {1997}, 35774 editor = {D. D. Leavitt and G. Starkshall}, 35775 publisher = {Medical Physics Publishing}, 35776 address = {St. Louis, Missouri} 35777} 35778 35779@Article{ shepard.ferris.ea:inverse, 35780 author = {D. M. Shepard and M. C. Ferris and R. Ove and L. Ma}, 35781 title = {Inverse Treatment Planning for Gamma Knife Radiosurgery}, 35782 journal = {Medical Physics}, 35783 volume = {27}, 35784 pages = {12}, 35785 year = {2000}, 35786 key = {93} 35787} 35788 35789@Article{ shepard.ferris.ea:optimizing, 35790 author = {D. M. Shepard and M. C. Ferris and G. Olivera and T. R. Mackie}, 35791 title = {Optimizing the Delivery of Radiation to Cancer Patients}, 35792 journal = {SIAM Review}, 35793 volume = {41}, 35794 pages = {721--744}, 35795 year = {1999}, 35796 url = {ftp://ftp.cs.wisc.edu/math-prog/tech-reports/98-07.ps}, 35797 key = {68}, 35798 institution = {Computer Sciences Department, University of Wisconsin}, 35799 address = {Madison, Wisconsin}, 35800 number = {98-07}, 35801 type = {Mathematical Programming Technical Report} 35802} 35803 35804@Article{ sherali.shetty:finitely, 35805 author = {H. D. Sherali and C. M. Shetty}, 35806 title = {A Finitely Convergent Algorithm for Bilinear Programming Problems using Polar 35807 Cuts and Disjunctive Face Cuts}, 35808 journal = {Mathematical Programming}, 35809 year = {1980}, 35810 volume = {19}, 35811 pages = {14--31} 35812} 35813 35814@Article{ sherali.soyster.ea:stackelberg-nash-cournot, 35815 author = {H. D. Sherali and A. L. Soyster and F. H. Murphy}, 35816 title = {{S}tackelberg--{N}ash--{C}ournot Equilibria: Characterization and Computation}, 35817 journal = {Operations Research}, 35818 year = {1983}, 35819 volume = {31}, 35820 pages = {253--276} 35821} 35822 35823@Article{ shi.olafsson.ea:hybrid, 35824 author = {L. Shi and S. \'{O}lafsson and Q. Chen}, 35825 title = {A New Hybrid Optimization Algorithm}, 35826 journal = {Computers and Industrial Engineering}, 35827 year = {1999}, 35828 volume = {36}, 35829 pages = {409--426} 35830} 35831 35832@PhDThesis{ shiau:iterative, 35833 author = {T.--H. Shiau}, 35834 title = {Iterative Linear Programming for Linear Complementarity and Related Problems}, 35835 school = {Computer Sciences Department, University of Wisconsin}, 35836 year = {1983}, 35837 address = {Madison, Wisconsin}, 35838 note = {Technical Report 507} 35839} 35840 35841@InProceedings{ shor:generalized, 35842 crossref = {bachem.grotschel.ea:mathematical}, 35843 author = {N. Z. Shor}, 35844 title = {Generalized Gradient Methods of Nondifferentiable Optimization Employing Space 35845 Dilation Operations}, 35846 pages = {501--529} 35847} 35848 35849@Book{ shor:minimization, 35850 author = {N. Z. Shor}, 35851 title = {Minimization Methods for Nondifferentiable Functions}, 35852 year = {1985}, 35853 publisher = {Springer-Verlag}, 35854 address = {Berlin} 35855} 35856 35857@Article{ shoven.whalley:applied, 35858 author = {J. Shoven and J. Whalley}, 35859 title = {Applied General Equilibrium Models of Taxation and International Trade: 35860 Introduction and Survey}, 35861 journal = {Journal of Economic Literature}, 35862 year = {1984}, 35863 volume = {22}, 35864 pages = {1007--1051} 35865} 35866 35867@Article{ shultz.meyer:interior, 35868 author = {G. L. Shultz and R. R. Meyer}, 35869 title = {An Interior Point Method for Block Angular Optimization}, 35870 journal = {SIAM Journal on Optimization}, 35871 year = {1991}, 35872 volume = {1}, 35873 pages = {583--602} 35874} 35875 35876@Article{ shultz.schnabel.ea:family, 35877 author = {G. A. Shultz and R. B. Schnabel and R. H. Byrd}, 35878 title = {A Family of Trust--Region--Based Algorithms for Unconstrained Minimization}, 35879 journal = {SIAM Journal on Numerical Analysis}, 35880 year = {1985}, 35881 volume = {22}, 35882 pages = {44--67} 35883} 35884 35885@Article{ sibony:methodes, 35886 author = {M. Sibony}, 35887 title = {Methodes iteratives pur les equations et inequations aux derives partielles 35888 nonlineaires de type monotone}, 35889 journal = {Calcolo}, 35890 year = {1970}, 35891 volume = {7}, 35892 pages = {65--183} 35893} 35894 35895@Article{ sidney:optimal, 35896 author = {J. B. Sidney}, 35897 title = {Optimal Single--Machine Scheduling with Earliness and Tardiness Penalties}, 35898 journal = {Operations Research}, 35899 year = {1977}, 35900 volume = {25}, 35901 pages = {62--69} 35902} 35903 35904@Book{ siegel:corba, 35905 author = {J. Siegel}, 35906 title = {{CORBA} - Fundamentals and Programming}, 35907 publisher = {John Wiley \& Sons}, 35908 year = {1996}, 35909 address = {New York, New York} 35910} 35911 35912@TechReport{ simantiraki.shanno:infeasible-interior-point, 35913 author = {E. Simantiraki and D. F. Shanno}, 35914 title = {An infeasible-interior-point algorithm for linear complementarity problems}, 35915 type = {Research Report}, 35916 number = {7-95}, 35917 institution = {Rutgers Center for Operations Research, Rutgers University}, 35918 address = {New Brunswick, New Jersey}, 35919 year = {1995} 35920} 35921 35922@InProceedings{ simantiraki.shanno:infeasible-interior-point*1, 35923 author = {E. Simantiraki and D. F. Shanno}, 35924 title = {An Infeasible-Interior-Point Algorithm for Solving Mixed Complementarity 35925 Problems}, 35926 crossref = {ferris.pang:complementarity}, 35927 pages = {386--404} 35928} 35929 35930@Book{ simpson:artificial, 35931 author = {P. K. Simpson}, 35932 title = {Artificial Neural Systems}, 35933 year = {1990}, 35934 publisher = {Pergamon Press}, 35935 address = {New York} 35936} 35937 35938@Article{ smeers:computable, 35939 author = {Y. Smeers}, 35940 title = {Computable Equilibrium Models and the Restructuring of the {E}uropean Electricity 35941 and Gas Markets}, 35942 journal = {The Energy Journal}, 35943 year = {1997}, 35944 optkey = {}, 35945 optvolume = {18}, 35946 optnumber = {}, 35947 optmonth = {}, 35948 optpages = {1--32}, 35949 optnote = {}, 35950 optannote = {} 35951} 35952 35953@Article{ smith:design, 35954 author = {F. W. Smith}, 35955 title = {Design of Multicategory Pattern Classifiers with Two-Category Classifier Design 35956 Procedures}, 35957 journal = {IEEE Transactions on Computers}, 35958 year = {1969}, 35959 volume = {18}, 35960 pages = {367--372} 35961} 35962 35963@Article{ smith:existence, 35964 author = {M. J. Smith}, 35965 title = {The Existence, Uniqueness and Stability of Traffic Equilibria}, 35966 journal = {Transportation Research}, 35967 year = {1979}, 35968 volume = {13B}, 35969 pages = {295--304} 35970} 35971 35972@Article{ smith:existence*1, 35973 author = {M. J. Smith}, 35974 title = {The existence and calculation of traffic equilibria}, 35975 journal = {Transportation Research}, 35976 volume = {17B}, 35977 year = {1983}, 35978 pages = {291--303} 35979} 35980 35981@Article{ smith:pattern, 35982 author = {F. W. Smith}, 35983 title = {Pattern Classifier Design by Linear Programming}, 35984 journal = {IEEE Transactions on Computers}, 35985 year = {1968}, 35986 volume = {C-17}, 35987 pages = {367--372} 35988} 35989 35990@Article{ solodov.svaiter:projection, 35991 author = {M. V. Solodov and B. F. Svaiter}, 35992 title = {A New Projection Method for Variational Inequality Problems}, 35993 journal = {SIAM Journal on Control and Optimization}, 35994 volume = {37}, 35995 pages = {765--776}, 35996 year = {1999} 35997} 35998 35999@Article{ solodov.tseng:modified, 36000 author = {M. V. Solodov and P. Tseng}, 36001 title = {Modified Projection--Type Methods for Monotone Variational Inequalities}, 36002 year = {1996}, 36003 journal = {SIAM Journal on Control and Optimization}, 36004 pages = {1814--1830}, 36005 volume = {34} 36006} 36007 36008@Article{ solodov:stationary, 36009 author = {M. V. Solodov}, 36010 title = {Stationary Points of Bound Constrained Minimization Reformulations of 36011 Complementarity Problems}, 36012 journal = {Journal of Optimization Theory and Applications, forthcoming}, 36013 year = {1997} 36014} 36015 36016@Article{ spendley.hext.ea:sequential, 36017 author = {W. Spendley and G. R. Hext and F. R. Himsworth}, 36018 title = {Sequential Application of Simplex Designs in Optimization and Evolutionary 36019 Operation}, 36020 journal = {Technometrics}, 36021 year = {1962}, 36022 pages = {441--461}, 36023 volume = {4} 36024} 36025 36026@Article{ spingarn:applications, 36027 author = {J. E. Spingarn}, 36028 title = {Applications of the Method of Partial Inverses to Convex Programming}, 36029 journal = {Mathematical Programming}, 36030 year = {1985}, 36031 volume = {32}, 36032 pages = {199--223} 36033} 36034 36035@Book{ srinivasan.whalley:general, 36036 author = {T. Srinivasan and J. Whalley}, 36037 title = {General Equilibrium Trade Policy Modelling}, 36038 publisher = {MIT Press}, 36039 year = {1986}, 36040 address = {Boston} 36041} 36042 36043@Book{ stackelberg:theory, 36044 author = {H. Van Stackelberg}, 36045 title = {The Theory of Market Economy}, 36046 publisher = {Oxford University Press}, 36047 year = {1952} 36048} 36049 36050@Article{ stavroulakis.panagiotopoulos.ea:rigid, 36051 author = {G. E. Stavroulakis and P. D. Panagiotopoulos and A. M. Al-Fahed}, 36052 title = {On the Rigid Body Displacements and Rotations in Unilateral Contact Problems and 36053 Applications}, 36054 journal = {Computers \& Structures}, 36055 volume = {40}, 36056 year = {1991}, 36057 pages = {599--614} 36058} 36059 36060@Article{ stavroulakis:optimal, 36061 author = {G. E. Stavroulakis}, 36062 title = {Optimal prestress of cracked unilateral structures: finite element analysis of an 36063 optimal control problem for variational inequalities}, 36064 journal = {Computer Methods in Applied Mechanics and Engineering, forthcoming}, 36065 year = {1996} 36066} 36067 36068@Article{ stavroulakis:optimal*1, 36069 author = {G. E. Stavroulakis}, 36070 title = {Optimal prestress of structures with frictional unilateral contact interfaces}, 36071 journal = {Archives of Applied Mechanics, forthcoming}, 36072 year = {1996} 36073} 36074 36075@Book{ steenbrink:optimization, 36076 author = {P. A. Steenbrink}, 36077 title = {Optimization of Transport Networks}, 36078 publisher = {John Wiley \& Sons}, 36079 address = {London, England}, 36080 year = {1974} 36081} 36082 36083@Article{ stephens:asymptotic, 36084 author = {M. A. Stephens}, 36085 title = {Asymptotic Results for Goodness-of-Fit Statistics with Unknown Parameters}, 36086 journal = {Annals of Statistics}, 36087 year = {1976}, 36088 volume = {4}, 36089 pages = {357--369} 36090} 36091 36092@Article{ stephens:edf, 36093 author = {M. A. Stephens}, 36094 title = {{EDF} Statistics for Goodness of Fit and Some Comparisons}, 36095 journal = {Journal of the American Statistical Association}, 36096 year = {1974}, 36097 volume = {69}, 36098 pages = {730--737} 36099} 36100 36101@Article{ stevens:location, 36102 author = {B. H. Stevens}, 36103 title = {Location Theory and Programming Models: The Von Th{\"{u}}nen case}, 36104 journal = {Papers of the Regional Science Association}, 36105 year = {1968}, 36106 volume = {21}, 36107 pages = {19--34} 36108} 36109 36110@Article{ stewart.trinkle:implicit, 36111 author = {D. E. Stewart and J. C. Trinkle}, 36112 title = {An Implicit Time-Stepping Scheme for Rigid Body Dynamics with Inelastic 36113 Collisions and {C}oulomb Friction}, 36114 journal = {International Journal for Numerical Methods in Engineering}, 36115 year = {1996}, 36116 volume = {39}, 36117 pages = {2673--2691} 36118} 36119 36120@Book{ stoer.bulirsch:introduction, 36121 author = {J. Stoer and R. Bulirsch}, 36122 title = {Introduction to Numerical Analysis}, 36123 year = {1980}, 36124 publisher = {Springer-Verlag}, 36125 address = {New York} 36126} 36127 36128@Article{ stoer:complexity, 36129 author = {J. Stoer}, 36130 title = {The complexity of an infeasible interior--point path--following method for the 36131 solution of linear programs}, 36132 journal = {Optimization Methods and Software}, 36133 year = {1994}, 36134 volume = {3}, 36135 pages = {1--12} 36136} 36137 36138@Article{ stone:cross-validatory, 36139 author = {M. Stone}, 36140 title = {Cross-validatory choice and assessment of statistical predictions}, 36141 journal = {Journal of the Royal Statistical Society}, 36142 year = {1974}, 36143 volume = {36}, 36144 pages = {111--147} 36145} 36146 36147@Article{ stone.smith.ea:inverse, 36148 author = {R. A. Stone and V. Smith and L. Verhey}, 36149 title = {Inverse Planning for the {G}amma {K}nife}, 36150 journal = {Medical Physics}, 36151 year = {1993}, 36152 volume = {20}, 36153 pages = {865} 36154} 36155 36156@Book{ strang:linear, 36157 author = {G. Strang}, 36158 title = {Linear Algebra and its Applications}, 36159 year = {1980}, 36160 publisher = {Academic Press}, 36161 address = {New York}, 36162 edition = {Second} 36163} 36164 36165@InProceedings{ street.wolberg.ea:nuclear, 36166 author = {W. N. Street and W. H. Wolberg and O. L. Mangasarian}, 36167 title = {Nuclear Feature Extraction for Breast Tumor Diagnosis}, 36168 booktitle = {Biomedical Image Processing and Biomedical Visualization}, 36169 year = {1993}, 36170 publisher = {SPIE--The International Society for Optical Engineering}, 36171 address = {San Jose, California}, 36172 pages = {861--870}, 36173 volume = {1905} 36174} 36175 36176@Article{ subramanian:gauss-newton, 36177 author = {P. K. Subramanian}, 36178 title = {Gauss--{N}ewton Methods for the Complementarity Problem}, 36179 journal = {Journal of Optimization Theory and Applications}, 36180 year = {1993}, 36181 volume = {77}, 36182 pages = {467--482} 36183} 36184 36185@PhDThesis{ subramanian:iterative, 36186 author = {P. K. Subramanian}, 36187 title = {Iterative Methods of Solution for Complementarity Problems}, 36188 year = {1985}, 36189 address = {Madison, Wisconsin}, 36190 school = {Computer Sciences Department, University of Wisconsin} 36191} 36192 36193@TechReport{ subramanian:note, 36194 author = {P. K. Subramanian}, 36195 title = {A Note on Least Two Norm Solutions of Monotone Complementarity Problems}, 36196 institution = {Mathematics Research Center, University of Wisconsin--Madison}, 36197 year = {1985}, 36198 address = {Madison, Wisconsin}, 36199 number = {2844}, 36200 type = {Technical Summary Report} 36201} 36202 36203@TechReport{ suh.gucht:distributed, 36204 author = {J. Y. Suh and D. Van Gucht}, 36205 title = {Distributed Genetic Algorithms}, 36206 institution = {Computer Science Department, Indiana University}, 36207 year = {1987}, 36208 address = {Bloomington}, 36209 number = {225} 36210} 36211 36212@Article{ sun.natori.ea:computational, 36213 author = {S. M. Sun and M. C. Natori and K. C. Park}, 36214 title = {A Computational Procedure for Flexible Beams with Frictional Contact 36215 Constraints}, 36216 journal = {International Journal for Numerical Methods in Engineering}, 36217 volume = {36}, 36218 pages = {3781--3800}, 36219 year = {1993} 36220} 36221 36222@Article{ sun.qi:ncp-functions, 36223 author = {D. Sun and L. Qi}, 36224 title = {On {NCP}-Functions}, 36225 journal = {Computational Optimization and Applications, forthcoming}, 36226 year = {1998} 36227} 36228 36229@Article{ sun.womersley:unconstrained, 36230 author = {D. Sun and R. S. Womersley}, 36231 title = {A new unconstrained differentiable merit function for box constrained variational 36232 inequality problems and a damped {G}auss-{N}ewton method}, 36233 journal = {SIAM Journal on Optimization}, 36234 year = {1999}, 36235 volume = {9}, 36236 pages = {388--413} 36237} 36238 36239@Article{ sun:class, 36240 author = {D. Sun}, 36241 title = {A Class of Iterative Methods for Nonlinear Projection Equations}, 36242 journal = {Journal of Optimization Theory and Applications}, 36243 year = {1996}, 36244 volume = {91}, 36245 pages = {123--140} 36246} 36247 36248@PhDThesis{ sun:monotropic, 36249 author = {J. Sun}, 36250 title = {On Monotropic Piecewise Quadratic Programming}, 36251 school = {University of Washington}, 36252 year = {1986}, 36253 address = {Seattle, Washington} 36254} 36255 36256@Article{ sun:thermal, 36257 author = {D. C. Sun}, 36258 title = {A Thermal Elastic Theory of Piston-Ring and Cylinder-Bore Contact}, 36259 journal = {Journal of Applied Mechanics}, 36260 volume = {58}, 36261 pages = {141--153}, 36262 year = {1991} 36263} 36264 36265@Article{ sundararaghavan.ahmed:minimizing, 36266 author = {P. S. Sundararaghavan and M. U. Ahmed}, 36267 title = {Minimizing the Sum of Absolute Lateness in Single--Machine and Multimachine 36268 Scheduling}, 36269 journal = {Naval Research Logistics Quarterly}, 36270 year = {1984}, 36271 volume = {31}, 36272 pages = {325--333} 36273} 36274 36275@TechReport{ sznajder.gowda:generalizations, 36276 author = {R. Sznajder and M. S. Gowda}, 36277 title = {Generalizations of ${P}_0$-- and ${P}$-- properties; extended vertical and 36278 horizontal {LCP}s}, 36279 institution = {Department of Mathematics, University of Maryland--Baltimore County}, 36280 year = {1992}, 36281 address = {Catonsville, Maryland}, 36282 number = {92--16}, 36283 type = {Research Report} 36284} 36285 36286@Article{ sznajder.gowda:nondegeneracy, 36287 author = {R. Sznajder and M. S. Gowda}, 36288 title = {Nondegeneracy Concepts for Zeros of Piecewise Smooth Functions}, 36289 journal = {Mathematics of Operations Research}, 36290 year = {1998}, 36291 volume = {23}, 36292 pages = {221--238} 36293} 36294 36295@Article{ taji.fukushima.ea:globally, 36296 author = {K. Taji and M. Fukushima and T. Ibaraki}, 36297 title = {A Globally Convergent {N}ewton Method for Solving Strongly Monotone Variational 36298 Inequalities}, 36299 journal = {Mathematical Programming}, 36300 year = {1993}, 36301 volume = {58}, 36302 pages = {369--383} 36303} 36304 36305@Article{ taji.fukushima:optimization, 36306 author = {K. Taji and M. Fukushima}, 36307 title = {Optimization Based Globally Convergent Methods for the Nonlinear Complementarity 36308 Problem}, 36309 journal = {Journal of the Operations Research Society of Japan}, 36310 year = {1994}, 36311 volume = {37}, 36312 pages = {310--331} 36313} 36314 36315@Article{ talbot.patterson.ea:comparative, 36316 author = {F. B. Talbot and J. H. Patterson and W. V. Gehrlein}, 36317 title = {A Comparative Evaluation of Heuristic Line Balancing Techniques}, 36318 journal = {Management Science}, 36319 year = {1986}, 36320 volume = {32}, 36321 pages = {430--454} 36322} 36323 36324@Article{ talman.yamamoto:simplicial, 36325 author = {A. J. J. Talman and Y. Yamamoto}, 36326 title = {A {S}implicial Algorithm for Stationary Point Problems}, 36327 journal = {Mathematics of Operations Research}, 36328 year = {1989}, 36329 volume = {14}, 36330 pages = {383--399} 36331} 36332 36333@InProceedings{ tanese:distributed, 36334 crossref = {schaeffer:third}, 36335 author = {R. Tanese}, 36336 title = {Distributed Genetic Algorithms}, 36337 pages = {434--439} 36338} 36339 36340@InProceedings{ tanese:parallel, 36341 crossref = {grefenstette:genetic}, 36342 author = {R. Tanese}, 36343 title = {Parallel Genetic Algorithms for a Hypercube}, 36344 pages = {177--183} 36345} 36346 36347@Article{ teboulle:entropic, 36348 author = {M. Teboulle}, 36349 title = {Entropic Proximal Mappings with Applications to Nonlinear Programming}, 36350 year = {1992}, 36351 journal = {Mathematics of Operations Research}, 36352 volume = {17}, 36353 pages = {670--690} 36354} 36355 36356@Article{ thuente:duality, 36357 author = {D. J. Thuente}, 36358 title = {Duality Theory for Generalized Linear Programs with Computational Methods}, 36359 journal = {Operations Research}, 36360 year = {1980}, 36361 volume = {28}, 36362 pages = {1005--1011} 36363} 36364 36365@Book{ tikhonov.arsenin:solutions, 36366 author = {A. N. Tikhonov and V. Y. Arsenin}, 36367 title = {Solutions of Ill--Posed Problems}, 36368 year = {1977}, 36369 publisher = {John Wiley \& Sons}, 36370 address = {New York} 36371} 36372 36373@InProceedings{ tin-loi.ferris:complementarity, 36374 author = {F. Tin-Loi and M. C. Ferris}, 36375 title = {Complementarity Problems in Engineering and Mechanics: Models and Solution}, 36376 booktitle = {Computational Mechanics for the Next Millenium}, 36377 key = {79}, 36378 pages = {1029--1036}, 36379 year = {1999}, 36380 editor = {C. M. Wang and K. H. Lee and K. K. Ang}, 36381 volume = {2}, 36382 series = {Proceedings of APCOM '99, Fourth Asia-Pacific Conference on Computational 36383 Mechanics}, 36384 url = {ftp: //ftp.cs.wisc.edu/math-prog/tech-reports/99-02.ps}, 36385 publisher = {Elsevier Science Ltd}, 36386 type = {Mathematical Programming Technical Report}, 36387 institution = {Computer Sciences Department, University of Wisconsin}, 36388 address = {Madison, Wisconsin}, 36389 number = {99-02} 36390} 36391 36392@InProceedings{ tin-loi.ferris:holonomic, 36393 author = {F. Tin-Loi and M. C. Ferris}, 36394 title = {Holonomic Analysis of Quasibrittle Fracture with Nonlinear Softening}, 36395 booktitle = {Advances in Fracture Research}, 36396 year = {1997}, 36397 editor = {B. L. Karihaloo and Y. W. Mai and M. I. Ripley and R. O. Ritchie}, 36398 volume = {2}, 36399 publisher = {Pergamon Press}, 36400 pages = {2183--2190}, 36401 key = {53} 36402} 36403 36404@InProceedings{ tin-loi.ferris:simple, 36405 author = {F. Tin-Loi and M. C. Ferris}, 36406 title = {A Simple Mathematical Programming Method for a Structural Identification 36407 Problem}, 36408 booktitle = {Seventh International Conference on Computing in Civil and Building Engineering 36409 (ICCCBE-VII), Seoul, Korea, 19-21 August}, 36410 editors = {C. K. Choi and C. B. Yun and H. G. Kwak}, 36411 publisher = {Techno-Press}, 36412 address = {Korea}, 36413 year = {1997}, 36414 pages = {511--518}, 36415 key = {59} 36416} 36417 36418@Article{ tin-loi.misa:large, 36419 author = {F. Tin-Loi and J. S. Misa}, 36420 title = {Large displacement elastoplastic analysis of semirigid steel frames}, 36421 journal = {International Journal for Numerical Methods in Engineering}, 36422 volume = {39}, 36423 pages = {741--762}, 36424 year = {1996} 36425} 36426 36427@Article{ tin-loi.pang:elastoplastic, 36428 author = {F. Tin-Loi and J. S. Pang}, 36429 title = {Elastoplastic analysis of structures with nonlinear hardening}, 36430 journal = {Computer Methods in Applied Mechanics and Engineering}, 36431 volume = {107}, 36432 year = {1993}, 36433 pages = {299--312} 36434} 36435 36436@Article{ tin-loi.vimonsatit:nonlinear, 36437 author = {F. Tin-Loi and V. Vimonsatit}, 36438 title = {Nonlinear Analysis of Semi-Rigid Frames: a Parametric Complementarity Approach}, 36439 journal = {Engineering Structures}, 36440 volume = {18}, 36441 year = {1996}, 36442 pages = {115--124} 36443} 36444 36445@Article{ tobin:uniqueness, 36446 author = {R. L. Tobin}, 36447 title = {Uniqueness results and algorithm for Stackelberg-Cournot-Nash equilibria}, 36448 journal = {Annals of Operations Research}, 36449 volume = {34}, 36450 year = {1992}, 36451 pages = {21--36} 36452} 36453 36454@Article{ tobin:variable, 36455 author = {R. L. Tobin}, 36456 title = {A Variable Dimension Solution Approach for the General Spatial Equilibrium 36457 Problem}, 36458 journal = {Mathematical Programming}, 36459 year = {1988}, 36460 volume = {40}, 36461 pages = {33--51} 36462} 36463 36464@Article{ todd.burrell:extension, 36465 author = {M. J. Todd and B. P. Burrell}, 36466 title = {An Extension of {K}armarkar's Algorithm for Linear Programming Using Dual 36467 Variables}, 36468 journal = {Algorithmica}, 36469 year = {1986}, 36470 volume = {1}, 36471 pages = {409--424} 36472} 36473 36474@Book{ todd:computation, 36475 author = {M. J. Todd}, 36476 title = {Computation of Fixed Points and Applications}, 36477 publisher = {Springer-Verlag}, 36478 year = {1976}, 36479 volume = {124}, 36480 series = {Lecture Notes in Economics and Mathematical Systems}, 36481 address = {Heidelberg} 36482} 36483 36484@Article{ todd:note, 36485 author = {M. J. Todd}, 36486 title = {A Note on Computing Equilibria in Economies with Activity Analysis Models of 36487 Production}, 36488 journal = {Journal of Mathematical Economics}, 36489 year = {1976}, 36490 volume = {6}, 36491 pages = {135--144} 36492} 36493 36494@Article{ toint:assesment, 36495 author = {Ph. L. Toint}, 36496 title = {An Assesment of Non--Monotone Linesearch Techniques for Unconstrained 36497 Optimization}, 36498 year = {1996}, 36499 journal = {SIAM Journal on Scientific Computing}, 36500 volume = {17}, 36501 pages = {725=-739} 36502} 36503 36504@TechReport{ toint:assesment*1, 36505 author = {Ph. L. Toint}, 36506 title = {An Assesment of Non--Monotone Linesearch Techniques for Unconstrained 36507 Optimization: The Complete Numerical Results}, 36508 institution = {Department of Mathematics, FUNDP}, 36509 year = {1994}, 36510 number = {94/15}, 36511 address = {Namur, Belgium} 36512} 36513 36514@Article{ toint:global, 36515 author = {Ph. L. Toint}, 36516 title = {Global Convergence of a Class of Trust Region Methods for Nonconvex Minimization 36517 in a {H}ilbert Space}, 36518 journal = {IMA Journal of Numerical Analysis}, 36519 year = {1988}, 36520 volume = {8}, 36521 pages = {231--252} 36522} 36523 36524@Article{ toint:non-monotone, 36525 author = {Ph. L. Toint}, 36526 title = {A Non--Monotone Trust--Region Algorithm for Nonlinear Optimization subject to 36527 Convex Constraints}, 36528 year = {1997}, 36529 journal = {Mathematical Programming}, 36530 volume = {77}, 36531 pages = {69--94} 36532} 36533 36534@InCollection{ toint:transportation, 36535 author = {Ph. L. Toint}, 36536 title = {Transportation Modelling and Operations Research: {A} Fruitful Connection}, 36537 booktitle = {Operations Research and Decision Aid Methodologies in Traffic and Transportation 36538 Management}, 36539 publisher = {Springer-Verlag}, 36540 series = {NATO ASI Series F}, 36541 year = {1997}, 36542 editor = {Ph. L. Toint and M. Labbe and K. Tanczos and G. Laporte} 36543} 36544 36545@Article{ tomlin.welch:finding, 36546 author = {J. Tomlin and J. Welch}, 36547 title = {Finding Duplicate Rows in a Linear Programming Model}, 36548 journal = {Operations Research Letters}, 36549 year = {1986}, 36550 volume = {5}, 36551 number = {1}, 36552 pages = {7--11} 36553} 36554 36555@Article{ torczon:convergence, 36556 author = {V. Torczon}, 36557 title = {On the Convergence of the Multidirectional Search Algorithm}, 36558 journal = {SIAM Journal on Optimization}, 36559 year = {1991}, 36560 volume = {1}, 36561 pages = {123--145} 36562} 36563 36564@Article{ torczon:convergence*1, 36565 author = {V. Torczon}, 36566 title = {On the Convergence of Pattern Search Algorithms}, 36567 journal = {SIAM Journal on Optimization}, 36568 year = {1997}, 36569 volume = {7}, 36570 pages = {1--25} 36571} 36572 36573@Misc{ torma.rutherford:general, 36574 author = {H. Torma and T. Rutherford}, 36575 title = {A General Equilibrium Assessment of {F}inland's Grand Tax Reform}, 36576 year = {1992}, 36577 howpublished = {Working Paper 15/1992}, 36578 note = {Department of Economics and Management, University of Jyvaskyla, Finland} 36579} 36580 36581@Article{ trinkle.pang.ea:dynamic, 36582 author = {J. C. Trinkle and J. S. Pang and S. Sudarsky and G. Lo}, 36583 title = {On Dynamic Multi-Rigid-Body Contact Problems}, 36584 journal = {Zeitschrift f{\"{u}}r Angewandte Mathematik und Mechanik}, 36585 year = {1997}, 36586 pages = {267--279}, 36587 volume = {77} 36588} 36589 36590@InProceedings{ trinkle.pang:dynamic, 36591 author = {J. C. Trinkle and J. S. Pang}, 36592 title = {Dynamic multi-rigid-body systems with concurrent distributed contacts friction}, 36593 book = {{IEEE} International Conference on Robotics and Automation}, 36594 pages = {2276--2281}, 36595 year = {1997} 36596} 36597 36598@TechReport{ tseng.bertsekas:convergence, 36599 author = {P. Tseng and D. P. Bertsekas}, 36600 title = {On the Convergence of the Exponential Multiplier Method for Convex Programming}, 36601 institution = {Laboratory for Information and Decision Systems, Massachusetts Institute of 36602 Technology}, 36603 year = {1990}, 36604 type = {technical report}, 36605 number = {LIDS-P-1995}, 36606 address = {Cambridge, MA} 36607} 36608 36609@Article{ tseng.yamashita.ea:equivalence, 36610 author = {P. Tseng and N. Yamashita and M. Fukushima}, 36611 title = {Equivalence of Complementarity Problems to Differentiable Minimization: a Unified 36612 Approach}, 36613 year = {1996}, 36614 journal = {SIAM Journal on Optimization}, 36615 volume = {6}, 36616 pages = {446--460} 36617} 36618 36619@Article{ tseng:applications, 36620 author = {P. Tseng}, 36621 title = {Applications of a splitting algorithm to decomposition in convex programming and 36622 variational inequalities}, 36623 journal = {SIAM Journal on Control and Optimization}, 36624 year = {1991}, 36625 volume = {29}, 36626 pages = {119--138} 36627} 36628 36629@Article{ tseng:dual, 36630 author = {P. Tseng}, 36631 title = {Dual Ascent Methods for Problems with Strictly Convex Costs and Linear 36632 Constraints: a Unified Approach}, 36633 journal = {SIAM Journal on Control and Optimization}, 36634 year = {1990}, 36635 volume = {28}, 36636 pages = {214--242} 36637} 36638 36639@Article{ tseng:dual*1, 36640 author = {P. Tseng}, 36641 title = {Dual Ascent Methods with Strictly Convex Costs and Linear Constraints: {A} 36642 Unified Approach}, 36643 journal = {SIAM Journal on Control and Optimization}, 36644 year = {1990}, 36645 volume = {28}, 36646 pages = {214--242} 36647} 36648 36649@Article{ tseng:dual*2, 36650 author = {P. Tseng}, 36651 title = {Dual Coordinate Ascent Methods for Non--Strictly Convex Minimization}, 36652 journal = {Mathematical Programming}, 36653 year = {1993}, 36654 volume = {59}, 36655 pages = {231--248} 36656} 36657 36658@Article{ tseng:fortified-descent, 36659 author = {P. Tseng}, 36660 title = {Fortified-Descent Simplicial Search Method: a General Approach}, 36661 journal = {SIAM Journal on Optimization}, 36662 volume = {10}, 36663 pages = {269--288}, 36664 year = {2000} 36665} 36666 36667@Article{ tseng:growth, 36668 author = {P. Tseng}, 36669 title = {Growth Behavior of a Class of Merit Functions for the Nonlinear Complementarity 36670 Problem}, 36671 journal = {Journal of Optimization Theory and Applications}, 36672 volume = {89}, 36673 year = {1996}, 36674 pages = {17--37} 36675} 36676 36677@Unpublished{ tseng:matlab, 36678 author = {P. Tseng}, 36679 title = {Matlab Implementations of Complementarity Codes}, 36680 year = {1995}, 36681 note = {Private Communication} 36682} 36683 36684@Article{ ursescu:multifunctions, 36685 author = {C. Ursescu}, 36686 title = {Multifunctions with closed convex graph}, 36687 journal = {Czech. Math. J.}, 36688 year = {1975}, 36689 volume = {35}, 36690 pages = {438--441} 36691} 36692 36693@TechReport{ vaidya:algorithm, 36694 author = {P. M. Vaidya}, 36695 title = {An Algorithm for Linear Programming which Requires 36696 {O}($((m+n)n^2+(m+n)^{1.5})${L}) arithmetic operations}, 36697 institution = {AT\&T Bell Laboratories}, 36698 year = {1987}, 36699 address = {Murray Hill, New Jersey} 36700} 36701 36702@Article{ val:unloading, 36703 author = {P. Du Val}, 36704 title = {The Unloading Problem for Plane Curves}, 36705 journal = {American Journal of Mathematics}, 36706 year = {1940}, 36707 volume = {62}, 36708 pages = {307--311} 36709} 36710 36711@InCollection{ valentine:problem, 36712 author = {F. A. Valentine}, 36713 title = {The Problem of {L}agrange with Differential Inequalities as Added Side 36714 Conditions}, 36715 booktitle = {Contributions to the Calculus of Variations, 1933--1937}, 36716 year = {1937}, 36717 publisher = {University of Chicago Press}, 36718 address = {Chicago}, 36719 pages = {407--448} 36720} 36721 36722@Article{ valle.poch.ea:comparison, 36723 author = {M. del Valle and M. Poch and J. Alonso and J. Bartroli}, 36724 title = {Comparison of the {P}owell and Simplex Methods in the Optimization of 36725 Flow-Injection Systems}, 36726 journal = {Analytica Chimica Acta}, 36727 year = {1990}, 36728 volume = {241}, 36729 pages = {31--42} 36730} 36731 36732@Article{ vandenberghe.demoor.ea:generalized, 36733 author = {L. Vandenberghe and B. L. {De~Moor} and J. Vandewalle}, 36734 title = {The generalized linear complementarity problem applied to the complete analysis 36735 of resistive piecewise-linear circuits}, 36736 journal = {IEEE Transactions on Circuits and Systems}, 36737 volume = {36}, 36738 year = {1989}, 36739 pages = {1382--1391} 36740} 36741 36742@Article{ vanderbei.meketon.ea:modification, 36743 author = {R. J. Vanderbei and M. S. Meketon and B. A. Freedman}, 36744 title = {A Modification of {K}armarkar's Algorithm}, 36745 journal = {Algorithmica}, 36746 year = {1986}, 36747 volume = {1}, 36748 pages = {395--407} 36749} 36750 36751@Article{ vanderbei:affine-scaling, 36752 author = {R. J. Vanderbei}, 36753 title = {Affine--Scaling for Linear Programs with Free Variables}, 36754 journal = {Mathematical Programming}, 36755 year = {1989}, 36756 volume = {43}, 36757 pages = {31--44} 36758} 36759 36760@Article{ vanroy.wolsey:solving, 36761 author = {T. J. Van~Roy and L. A. Wolsey}, 36762 title = {Solving Mixed Integer 0-1 Programs by Automatic Reformulation}, 36763 journal = {Operations Research}, 36764 volume = {35}, 36765 pages = {45--57}, 36766 year = {1987} 36767} 36768 36769@Book{ vapnik:nature, 36770 author = {V. N. Vapnik}, 36771 title = {The Nature of Statistical Learning Theory}, 36772 publisher = {John Wiley \& Sons}, 36773 address = {New York}, 36774 year = {1996} 36775} 36776 36777@Book{ varian:microeconomic, 36778 author = {Hal R. Varian}, 36779 title = {Microeconomic Analysis}, 36780 year = {1978}, 36781 publisher = {W.W. Norton \& Company}, 36782 address = {New York, New York} 36783} 36784 36785@Article{ verhey:immobilizing, 36786 author = {L. J. Verhey}, 36787 title = {Immobilizing and Positioning Patients for Radiotherapy}, 36788 journal = {Seminars in Radiation Oncology}, 36789 year = {1995}, 36790 volume = {5}, 36791 number = {2}, 36792 pages = {100--113} 36793} 36794 36795@Article{ vinante.pintos:differentiable, 36796 author = {C. Vinante and S. Pintos}, 36797 title = {On Differentiable Exact Penalty Functions}, 36798 journal = {Journal of Optimization Theory and Applications}, 36799 year = {1986}, 36800 volume = {50}, 36801 pages = {479--493} 36802} 36803 36804@Article{ vlach:scheduling, 36805 author = {M. Vlach}, 36806 title = {On Scheduling with Earliness and Tardiness Penalties}, 36807 journal = {Methods of Operations Research}, 36808 year = {1983}, 36809 volume = {45}, 36810 pages = {367--375} 36811} 36812 36813@InCollection{ wacker:summary, 36814 author = {H.--J. Wacker}, 36815 title = {A Summary of the Developments on Imbedding Methods}, 36816 booktitle = {Continuation Methods}, 36817 year = {1978}, 36818 editor = {H.--J. Wacker}, 36819 publisher = {Academic Press}, 36820 address = {New York}, 36821 pages = {1--35} 36822} 36823 36824@Article{ wakefield.tin-loi:large, 36825 author = {R. R. Wakefield and F. Tin-Loi}, 36826 title = {Large Scale Nonholonomic Elastoplastic Analysis using a Linear Complementarity 36827 Formulation}, 36828 journal = {Computer Methods in Applied Mechanics and Engineering}, 36829 volume = {84}, 36830 year = {1990}, 36831 pages = {229--242} 36832} 36833 36834@Article{ wakefield.tin-loi:large*1, 36835 author = {R. R. Wakefield and F. Tin-Loi}, 36836 title = {Large Displacement Elastoplastic Analysis of Frames using an Iterative {LCP} 36837 Approach}, 36838 journal = {International Journal Mechanical Science}, 36839 volume = {33}, 36840 year = {1991}, 36841 pages = {379--391} 36842} 36843 36844@Article{ walker:implementation, 36845 author = {H. F. Walker}, 36846 title = {Implementation of the {GMRES} method using {H}ouseholder transformations}, 36847 journal = {SIAM Journal on Scientific Computing}, 36848 volume = {9}, 36849 year = {1988}, 36850 pages = {152--163} 36851} 36852 36853@Book{ wall.schwartz:programming, 36854 author = {L. Wall and R. L. Schwartz}, 36855 title = {Programming Perl}, 36856 publisher = {O'Reilly and Associates, Inc.}, 36857 address = {Sebastopol, CA}, 36858 year = {1991} 36859} 36860 36861@Book{ walras:elements, 36862 author = {L. Walras}, 36863 title = {Elements of Pure Economics}, 36864 publisher = {Allen and Unwin}, 36865 year = {1954}, 36866 address = {London} 36867} 36868 36869@Article{ wang.monteiro.ea:interior, 36870 author = {T. Wang and R. D. C. Monteiro and J. S. Pang}, 36871 title = {An Interior Point Potential Reduction Method for Constrained Equations}, 36872 journal = {Mathematical Programming}, 36873 volume = {74}, 36874 pages = {159--196}, 36875 year = {1996} 36876} 36877 36878@Article{ wardi:stochastic, 36879 author = {Y. Wardi}, 36880 title = {A Stochastic Steepest-Descent Algorithm}, 36881 journal = {Journal of Optimization Theory and Applications}, 36882 year = {1988}, 36883 volume = {59}, 36884 pages = {307--323} 36885} 36886 36887@Article{ wardi:stochastic*1, 36888 author = {Y. Wardi}, 36889 title = {Stochastic Algorithms for with {A}rmijo Stepsizes for Minimization of Functions}, 36890 journal = {Journal of Optimization Theory and Applications}, 36891 year = {1990}, 36892 volume = {64}, 36893 pages = {399--417} 36894} 36895 36896@Article{ wardrop:theoretical, 36897 author = {J. G. Wardrop}, 36898 title = {Some Theoretical Aspects of Road Traffic Research}, 36899 journal = {Proceeding of the Institute of Civil Engineers, Part {II}}, 36900 year = {1952}, 36901 pages = {325--378} 36902} 36903 36904@Article{ warga:minimizing, 36905 author = {J. Warga}, 36906 title = {Minimizing certain convex functions}, 36907 journal = {Journal of SIAM on Applied Mathematics}, 36908 year = {1963}, 36909 volume = {11}, 36910 pages = {588--593} 36911} 36912 36913@Article{ watson.billups.ea:hompack, 36914 author = {L. T. Watson and S. C. Billups and A. P. Morgan}, 36915 title = {Algorithm 652: {HOMPACK}: {A} Suite of Codes for Globally Convergent Homotopy 36916 Algorithms}, 36917 journal = {{ACM} Transactions on Mathematical Software}, 36918 year = {1987}, 36919 volume = {13}, 36920 pages = {281--310} 36921} 36922 36923@Article{ watson.billups.ea:slow, 36924 author = {L. T. Watson and S. C. Billups and C. Y. Wang}, 36925 title = {Slow Viscous Flow in a Syringe}, 36926 journal = {Journal of Biomechanical Engineering}, 36927 year = {1986}, 36928 volume = {108}, 36929 pages = {317--323} 36930} 36931 36932@Article{ watson:discrete, 36933 author = {G. A. Watson}, 36934 title = {Discrete $\ell_1$ approximation by rational functions}, 36935 journal = {IMA Journal of Numerical Analysis}, 36936 year = {1984}, 36937 volume = {4}, 36938 pages = {275--288} 36939} 36940 36941@Article{ watson:solving, 36942 author = {L. T. Watson}, 36943 title = {Solving the nonlinear complementarity problem by a homotopy method}, 36944 journal = {SIAM Journal on Control and Optimization}, 36945 year = {1979}, 36946 volume = {17}, 36947 pages = {36--46} 36948} 36949 36950@Article{ webb:optimum, 36951 author = {S. Webb}, 36952 title = {Optimum Parameters in a Model of Tumor Control Probability including Interpatient 36953 Heterogeneity}, 36954 journal = {Physics in Medicine and Biology}, 36955 year = {1994}, 36956 volume = {39}, 36957 pages = {1895--1914} 36958} 36959 36960@Book{ webb:physics, 36961 author = {S. Webb}, 36962 title = {The Physics of Conformal Radiotherapy: Advances in Technology}, 36963 publisher = {Institute of Physics Publishing Ltd.}, 36964 year = {1997}, 36965 optaddress = {Philadelphia} 36966} 36967 36968@InBook{ webb:theory, 36969 author = {S. Webb}, 36970 editor = {E. Sternick}, 36971 title = {The Theory and Practice of Intensity Modulated Radiation Therapy}, 36972 chapter = {Inverse Planning for IMRT: the Role of Simulated Annealing}, 36973 publisher = {Advanced Medical Publishing}, 36974 year = {1997} 36975} 36976 36977@Book{ weiss.kulikowski:computer, 36978 author = {S. M. Weiss and C. A. Kulikowski}, 36979 title = {Computer Systems that Learn}, 36980 year = {1991}, 36981 publisher = {Morgan Kaufmann Publishers, Inc}, 36982 address = {San Mateo, California} 36983} 36984 36985@PhDThesis{ werbos:beyond, 36986 author = {P. J. Werbos}, 36987 title = {Beyond Regression: New Tools for Prediction and Analysis in the Behaviorial 36988 Sciences}, 36989 year = {1974}, 36990 school = {Harvard University} 36991} 36992 36993@InCollection{ wets:convergence, 36994 author = {R. J.-B. Wets}, 36995 title = {Convergence of Convex Functions, Variational Inequalites, and Convex Optimization 36996 Problems}, 36997 booktitle = {Variational Inequalites and Complementarity Problems}, 36998 year = {1980}, 36999 editor = {R. W. Cottle and F. Giannessi and J.--L. Lions}, 37000 publisher = {John Wiley \& Sons}, 37001 address = {New York}, 37002 pages = {375--403} 37003} 37004 37005@InCollection{ wets:large, 37006 author = {R. J.-B. Wets}, 37007 title = {Large Scale Linear Programming Techniques in Stochastic Programming}, 37008 booktitle = {Numerical Techniques for Stochastic Optimization}, 37009 publisher = {Springer-Verlag}, 37010 year = {1988}, 37011 editor = {Yu. M. Ermoliev and R. J. -B. Wets}, 37012 address = {Berlin}, 37013 pages = {65--93} 37014} 37015 37016@Article{ white:asymptotic, 37017 author = {H. White}, 37018 title = {Some asymptotic results for learning in single hidden-layer feedforward network 37019 models}, 37020 journal = {Journal of the American Stattistical Association}, 37021 year = {1989}, 37022 volume = {84}, 37023 number = {408}, 37024 pages = {1003--1013} 37025} 37026 37027@Article{ white:learning, 37028 author = {H. White}, 37029 title = {Learning in artificial neural networks{:} {A} statistical perspective}, 37030 journal = {Neural Computation}, 37031 year = {1989}, 37032 volume = {1}, 37033 pages = {425--461} 37034} 37035 37036@InProceedings{ whitley.starkweather.ea:scheduling, 37037 crossref = {schaeffer:third}, 37038 author = {D. Whitley and T. Starkweather and D. Fuquay}, 37039 title = {Scheduling Problems and Travelling Salesmen: The Genetic Edge Recombination 37040 Operator}, 37041 pages = {133--140} 37042} 37043 37044@Book{ williams:model, 37045 author = {H. P. Williams}, 37046 title = {Model Building in Mathematical Programming}, 37047 publisher = {John Wiley \& Sons}, 37048 year = {1990}, 37049 edition = {Third} 37050} 37051 37052@Book{ wilmott.dewynne.ea:option, 37053 author = {P. Wilmott and J. Dewynne and S. Howison}, 37054 title = {Option Pricing}, 37055 publisher = {Oxford Financial Press}, 37056 year = {1993}, 37057 address = {Oxford, England} 37058} 37059 37060@PhDThesis{ wilson:simplicial, 37061 author = {R. B. Wilson}, 37062 title = {A Simplicial Algorithm for Concave Programming}, 37063 year = {1963}, 37064 address = {Boston, MA}, 37065 school = {Graduate School of Business Administration, Harvard University} 37066} 37067 37068@TechReport{ wolberg.bennett.ea:breast, 37069 author = {W. H. Wolberg and K. P. Bennett and O. L. Mangasarian}, 37070 title = {Breast Cancer Diagnosis and Prognostic Determination from Cell Analysis}, 37071 institution = {Departments of Surgery and Human Oncology and Computer Sciences, University of 37072 Wisconsin}, 37073 year = {1992}, 37074 address = {Madison, WI 53706}, 37075 type = {Manuscript} 37076} 37077 37078@Article{ wolberg.mangasarian:multisurface, 37079 author = {W. H. Wolberg and O. L. Mangasarian}, 37080 title = {Multisurface Method of Pattern Separation for Medical Diagnosis Applied to Breast 37081 Cytology}, 37082 journal = {Proceedings of the National Academy of Sciences,U.S.A.}, 37083 year = {1990}, 37084 volume = {87}, 37085 pages = {9193--9196} 37086} 37087 37088@Unpublished{ wolberg.mangasarian:wbcd, 37089 author = {W. H. Wolberg and O. L. Mangasarian}, 37090 title = {{WBCD: Wisconsin Breast Cancer Database}}, 37091 year = {1991}, 37092 note = {Computer Sciences Department, University of Wisconsin, Madison, ftp: //ftp. cs. 37093 wisc.edu/math-prog/cpo-dataset/machine-learn/cancer1/} 37094} 37095 37096@Article{ wolberg.street.ea:breast, 37097 author = {W. H. Wolberg and W. N. Street and O. L. Mangasarian}, 37098 title = {Breast Cytology Diagnosis via Digital Image Analysis}, 37099 journal = {Analytical and Quantitative Cytology and Histology}, 37100 year = {1993}, 37101 volume = {15}, 37102 number = {6}, 37103 pages = {396--404} 37104} 37105 37106@Unpublished{ wolberg.street.ea:wdbc, 37107 author = {W. H. Wolberg and W. N. Street and O. L. Mangasarian}, 37108 title = {{WDBC: Wisconsin Diagnostic Breast Cancer Database}}, 37109 year = {1995}, 37110 note = {Computer Sciences Department, University of Wisconsin, Madison, ftp: //ftp. 37111 cs.wisc.edu/math-prog/cpo-dataset/machine-learn/WDBC/} 37112} 37113 37114@Unpublished{ wolberg.street.ea:wpbc, 37115 author = {W. H. Wolberg and W. N. Street and O. L. Mangasarian}, 37116 title = {{WPBC: Wisconsin Prognostic Breast Cancer Database}}, 37117 year = {1995}, 37118 note = {Computer Sciences Department, University of Wisconsin, Madison, ftp: //ftp. 37119 cs.wisc.edu/math-prog/cpo-dataset/machine-learn/WPBC/} 37120} 37121 37122@Book{ wolsey:integer, 37123 author = {L. A. Wolsey}, 37124 title = {Integer Programming}, 37125 publisher = {John Wiley \& Sons}, 37126 year = {1998}, 37127 address = {New York, NY} 37128} 37129 37130@Article{ womersley:local, 37131 author = {R. S. Womersley}, 37132 title = {Local Properties of Algorithms for Minimizing Composite Functions}, 37133 journal = {Mathematical Programming}, 37134 year = {1985}, 37135 volume = {32}, 37136 pages = {69--89} 37137} 37138 37139@Article{ woo.sanders.ea:peacock, 37140 author = {S. Y. Woo and M. Sanders and W. Grant and E. B. Butler}, 37141 title = {Does the ``peacock'' have anything to do with radiotherapy?}, 37142 journal = {International Journal of Radiation Oncology, Biology and Physics}, 37143 year = {1994}, 37144 volume = {29}, 37145 number = {1}, 37146 pages = {213--214} 37147} 37148 37149@Article{ wright.ralph:superlinear, 37150 author = {S. J. Wright and D. Ralph}, 37151 title = {A Superlinear Infeasible--Interior--Point Algorithm for Monotone Complementarity 37152 Problems}, 37153 year = {1996}, 37154 journal = {Mathematics of Operations Research}, 37155 volume = {21}, 37156 pages = {815--838} 37157} 37158 37159@TechReport{ wright.zhang:superquadratic, 37160 author = {S. J. Wright and Y. Zhang}, 37161 title = {A Superquadratic Infeasible--Interior--Point Method for linear complementarity 37162 problems}, 37163 institution = {Argonne National Laboratory}, 37164 year = {1994}, 37165 annote = {revised}, 37166 number = {MCS--P418--0294}, 37167 address = {Argonne, Illinois}, 37168 type = {Preprint} 37169} 37170 37171@TechReport{ wright:dynfgm, 37172 author = {S. E. Wright}, 37173 title = {{DYNFGM}: Dynamic Finite Generation Method}, 37174 institution = {Department of Mathematics, University of Washington}, 37175 year = {1989}, 37176 address = {Seattle, Washington} 37177} 37178 37179@Article{ wright:infeasible-interior-point, 37180 author = {S. J. Wright}, 37181 title = {An Infeasible--Interior--Point Algorithm for Linear Complementarity Problems}, 37182 journal = {Mathematical Programming}, 37183 volume = {67}, 37184 pages = {29--51}, 37185 year = {1994} 37186} 37187 37188@Article{ wright:path-following, 37189 author = {S. J. Wright}, 37190 title = {A Path--Following Infeasible--Interior--Point Algorithm for Linear 37191 Complementarity Problems}, 37192 journal = {Optimization Methods and Software}, 37193 year = {1993}, 37194 volume = {2}, 37195 pages = {79--106} 37196} 37197 37198@TechReport{ wright:path-following*1, 37199 author = {S. J. Wright}, 37200 title = {A Path--Following Infeasible--Interior--Point Algorithm for Linear and Quadratic 37201 Problems}, 37202 institution = {Argonne National Laboratory}, 37203 year = {1993}, 37204 number = {MCS--P401--1293}, 37205 address = {Argonne, Illinois} 37206} 37207 37208@Book{ wright:primal-dual, 37209 author = {S. J. Wright}, 37210 title = {Primal--Dual Interior--Point Methods}, 37211 year = {1997}, 37212 publisher = {SIAM}, 37213 address = {Philadelphia, Pennsylvania} 37214} 37215 37216@TechReport{ wright:reduced, 37217 author = {S. J. Wright}, 37218 title = {On Reduced Convex QP Formulations of Monotone LCP Problems}, 37219 institution = {Argonne National Laboratory}, 37220 year = {2000}, 37221 number = {MCS--P808--0400}, 37222 address = {Argonne, Illinois} 37223} 37224 37225@Article{ wright:solution, 37226 author = {S. J. Wright}, 37227 title = {Solution of Discrete--Time Optimal Control Problems on Parallel Computers}, 37228 journal = {Parallel Computing}, 37229 year = {1990}, 37230 volume = {16}, 37231 pages = {221--238} 37232} 37233 37234@Article{ wu.bourland:morphology, 37235 author = {Q. J. Wu and J. D. Bourland}, 37236 title = {Morphology-guided radiosurgery treatment planning and optimization for multiple 37237 isocenters}, 37238 journal = {Medical Physics}, 37239 year = {1999}, 37240 volume = {26}, 37241 number = {10}, 37242 pages = {2151--2160} 37243} 37244 37245@Misc{ wunderling:soplex, 37246 author = {R. Wunderling}, 37247 title = {{SOPLEX}: The Sequential Object-Oriented Simplex Class Library}, 37248 howpublished = {http://www.zib.de/Optimization/Software/Soplex/} 37249} 37250 37251@Article{ xiao.harker:nonsmooth, 37252 author = {B. Xiao and P. T. Harker}, 37253 title = {A Nonsmooth {N}ewton Method for Variational Inequalities: {I}: Theory}, 37254 journal = {Mathematical Programming}, 37255 year = {1994}, 37256 volume = {65}, 37257 pages = {151--194} 37258} 37259 37260@Article{ xiao.harker:nonsmooth*1, 37261 author = {B. Xiao and P. T. Harker}, 37262 title = {A Nonsmooth {N}ewton Method for Variational Inequalities: {II}: Numerical 37263 Results}, 37264 journal = {Mathematical Programming}, 37265 year = {1994}, 37266 volume = {65}, 37267 pages = {195--216} 37268} 37269 37270@Article{ xiao.zhou:nonmonotone, 37271 author = {Y. Xiao and F. J. Zhou}, 37272 title = {Nonmonotone Trust Region Methods with Curvilinear Paths in Unconstrained 37273 Minimization}, 37274 journal = {Computing}, 37275 year = {1992}, 37276 volume = {48}, 37277 pages = {303--317} 37278} 37279 37280@TechReport{ xiao:global, 37281 author = {B. Xiao}, 37282 title = {Global {N}ewton methods for nonlinear problems and variational inequalities: a 37283 {B}-differentiable equation approach}, 37284 type = {{Ph.D. Thesis}}, 37285 year = {1990}, 37286 institution = {Department of Decision Sciences, The Warton School, University of Pennsylvania}, 37287 address = {Philadelphia, PA} 37288} 37289 37290@Article{ xu.burke:polynomial, 37291 author = {S. Xu and J. V. Burke}, 37292 title = {A Polynomial Time Interior-Point Path-Following Algorithm for {LCP} based on 37293 {C}hen-{H}arker-{K}anzow Smoothing Techniques}, 37294 year = {1999}, 37295 journal = {Mathematical Programming}, 37296 volume = {86}, 37297 pages = {91--104} 37298} 37299 37300@TechReport{ xu:global, 37301 author = {S. Xu}, 37302 title = {The Global Linear Convergence of an Infeasible Non-Interior Path-Following 37303 Algorithm for Complementarity Problems with Uniform {P}-Functions}, 37304 institution = {Department of Mathematics, University of Washington}, 37305 year = {1996}, 37306 type = {Technical Report}, 37307 address = {Seattle, WA} 37308} 37309 37310@Article{ yajima.konno:efficient, 37311 author = {Y. Yajima and H. Konno}, 37312 title = {Efficient Algorithms for Solving Rank Two and Rank Three Bilinear Programming 37313 Problems}, 37314 journal = {Journal of Global Optimization}, 37315 year = {1991}, 37316 volume = {1:1}, 37317 pages = {155--171} 37318} 37319 37320@Article{ yamamoto:path-following, 37321 author = {Y. Yamamoto}, 37322 title = {A Path--Following Algorithm for Stationary Point Problems}, 37323 journal = {Journal of Operations Society of Japan}, 37324 year = {1987}, 37325 volume = {30}, 37326 pages = {181--198} 37327} 37328 37329@Article{ yamashita.fukushima:modified, 37330 author = {N. Yamashita and M. Fukushima}, 37331 title = {Modified {N}ewton Methods for Solving a Semismooth Reformulation of Monotone 37332 Complementarity Problems}, 37333 journal = {Mathematical Programming}, 37334 year = {1997}, 37335 volume = {76}, 37336 pages = {469--492} 37337} 37338 37339@Article{ yamashita.fukushima:stationary, 37340 author = {N. Yamashita and M. Fukushima}, 37341 title = {On Stationary Points of the Implicit Lagrangian for Nonlinear Complementarity 37342 Problems}, 37343 journal = {Journal of Optimization Theory and Applications}, 37344 volume = {84}, 37345 pages = {653--663}, 37346 year = {1995} 37347} 37348 37349@Article{ yamashita.taji.ea:unconstrained, 37350 author = {N. Yamashita and K. Taji and M. Fukushima}, 37351 title = {Unconstrained Optimization Reformulations of Variational Inequality Problems}, 37352 journal = {Journal of Optimization Theory and Applications}, 37353 year = {1997}, 37354 volume = {92}, 37355 pages = {439--456} 37356} 37357 37358@TechReport{ yamashita:properties, 37359 author = {N. Yamashita}, 37360 title = {Some Properties of the Restricted {NCP}-Functions for the Nonlinear 37361 Complementarity Problem}, 37362 institution = {Department of Applied Mathematics and Physics, Kyoto University}, 37363 year = {1996}, 37364 type = {Technical Report}, 37365 address = {Kyoto, Japan} 37366} 37367 37368@Article{ yang.mackie.ea:investigation, 37369 author = {J. N. Yang and T. R. Mackie and P. Reckwerdt and J. O. Deasy and B. R. 37370 Thomadsen}, 37371 title = {An investigation of tomotherapy beam delivery}, 37372 journal = {Medical Physics}, 37373 year = {1997}, 37374 volume = {24}, 37375 number = {3}, 37376 pages = {425--436} 37377} 37378 37379@Article{ yan.shu.ea:clinical, 37380 author = {Y. Yan and H. Shu and X. Bao}, 37381 title = {Clinical Treatment Planning Optimization by {P}owell's method for {G}amma Unit 37382 Treatmen System}, 37383 journal = {International Journal of Radiation Oncology, Biology and Physics}, 37384 year = {1997}, 37385 volume = {39}, 37386 pages = {247--254} 37387} 37388 37389@Article{ yau.gao:obstacle, 37390 author = {S. T. Yau and Y. Gao}, 37391 title = {Obstacle problem for von {K}arm\'an equations}, 37392 journal = {Advances in Applied Mathematics}, 37393 volume = {13}, 37394 year = {1992}, 37395 pages = {123--141} 37396} 37397 37398@Article{ ye.tse:extension, 37399 author = {Y. Ye and E. Tse}, 37400 title = {An Extension of {K}armarkar's Projective Algorithm for Convex Quadratic 37401 Programming}, 37402 journal = {Mathematical Programming}, 37403 year = {1989}, 37404 volume = {44} 37405} 37406 37407@Article{ ye:affine, 37408 author = {Y. Ye}, 37409 title = {On affine scaling algorithms for nonconvex quadratic programming}, 37410 journal = {Mathematical Programming}, 37411 year = {1992}, 37412 volume = {56}, 37413 pages = {285--300} 37414} 37415 37416@PhDThesis{ ye:interior, 37417 author = {Y. Ye}, 37418 title = {Interior Algorithms for Linear, Quadratic, and Linearly Constrained Convex 37419 Programming}, 37420 year = {1987}, 37421 address = {Stanford, California}, 37422 school = {Department of Engineering--Economic Systems, Stanford University} 37423} 37424 37425@Book{ ye:interior*1, 37426 author = {Y. Ye}, 37427 title = {Interior-Point Algorithms: Theory and Analysis}, 37428 publisher = {John Wiley \& Sons}, 37429 year = {1997}, 37430 address = {New York, NY} 37431} 37432 37433@Article{ yu:convergence, 37434 author = {W. --C. Yu}, 37435 title = {The Convergence Property of the Simplex Evolutionary Techniques}, 37436 journal = {Scientia Sinica, Special issue of Mathematics}, 37437 year = {1979}, 37438 volume = {1}, 37439 pages = {68--77} 37440} 37441 37442@Article{ yu.schell:genetic, 37443 author = {Y. Yu and M. C. Schell}, 37444 title = {A Genetic Algorithm for the Optimization of Prostate Implants}, 37445 journal = {Medical Physics}, 37446 year = {1996}, 37447 volume = {23}, 37448 pages = {2085--2091} 37449} 37450 37451@Article{ yuan:superlinear, 37452 author = {Y. Yuan}, 37453 title = {On the Superlinear Convergence of a Trust Region Algorithm for Nonmooth 37454 Optimization}, 37455 journal = {Mathematical Programming}, 37456 year = {1985}, 37457 volume = {31}, 37458 pages = {269--285} 37459} 37460 37461@Book{ zangwill:nonlinear, 37462 author = {W. I. Zangwill}, 37463 title = {Nonlinear Programming: {A} Unified Approach}, 37464 year = {1969}, 37465 publisher = {Prentice-Hall, Inc}, 37466 address = {Englewood Cliffs, New Jersey} 37467} 37468 37469@TechReport{ zangwill:nonlinear*1, 37470 author = {W. I. Zangwill}, 37471 title = {Nonlinear Programming by Sequential Unconstrained Maximization}, 37472 institution = {Center for Research in Management Science, University of California}, 37473 year = {1965}, 37474 address = {Berkeley}, 37475 number = {131}, 37476 type = {Working Paper} 37477} 37478 37479@Article{ zangwill:nonlinear*2, 37480 author = {W. I. Zangwill}, 37481 title = {Nonlinear Programming via Penalty Functions}, 37482 journal = {Management Science}, 37483 year = {1967}, 37484 volume = {13}, 37485 pages = {344--358} 37486} 37487 37488@TechReport{ zenios.censor:massively, 37489 author = {S. A. Zenios and Y. Censor}, 37490 title = {Massively Parallel Row-Action Algorithms for some Nonlinear Transportation 37491 Problems}, 37492 institution = {decision sciences department, Wharton School, University of Pennsylvania}, 37493 year = {1990}, 37494 type = {report}, 37495 number = {89-09-10}, 37496 address = {Philadelphia, PA} 37497} 37498 37499@Article{ zenios.lasken:nonlinear, 37500 author = {S. A. Zenios and R. A. Lasken}, 37501 title = {Nonlinear Network Optimization on a Massively Parallel {C}onnection {M}achine}, 37502 journal = {Annals of Operations Research}, 37503 year = {1988}, 37504 volume = {14}, 37505 pages = {147--163} 37506} 37507 37508@Article{ zenios.mulvey:distributed, 37509 author = {S. A. Zenios and J. M. Mulvey}, 37510 title = {A Distributed Algorithm for Convex Network Optimization Problems}, 37511 journal = {Parallel Computing}, 37512 year = {1988}, 37513 volume = {6}, 37514 pages = {43--56} 37515} 37516 37517@TechReport{ zenios.neilsen:massively, 37518 author = {S. A. Zenios and S. Neilsen}, 37519 title = {Massively Parallel Algorithms for Singly Constrained Nonlinear Programs}, 37520 institution = {Decision Sciences Department, Wharton School, University of Pennsylvania}, 37521 year = {1990}, 37522 type = {report}, 37523 number = {90-03-01}, 37524 address = {Philadelphia, PA} 37525} 37526 37527@TechReport{ zenios.qi.ea:comparative, 37528 author = {S. A. Zenios and R. Qi and E. D. Chajakis}, 37529 title = {A Comparative Study of Parallel Dual Coordinate Ascent Implementations for 37530 Nonlinear Network Optimization}, 37531 institution = {Decision Sciences Department, Wharton School, University of Pennsylvania}, 37532 year = {1990}, 37533 type = {report}, 37534 number = {89-10-02}, 37535 address = {Philadelphia, PA} 37536} 37537 37538@Article{ zhang.kim.ea:improved, 37539 author = {J. Zhang and N.--H. Kim and L. Lasdon}, 37540 title = {An Improved Successive Linear Programming Algorithm}, 37541 year = {1985}, 37542 journal = {Management Science}, 37543 volume = {31}, 37544 pages = {1312--1331} 37545} 37546 37547@Article{ zhang.tapia.ea:superlinear, 37548 author = {Y. Zhang and R. A. Tapia and F. Potra}, 37549 title = {On the Superlinear Convergence of Interior Points Algorithms for a general class 37550 of problems}, 37551 journal = {SIAM Journal on Optimization}, 37552 year = {1993}, 37553 volume = {3}, 37554 number = {?}, 37555 pages = {413--422}, 37556} 37557 37558@Article{ zhang.tapia:superlinearly, 37559 author = {Y. Zhang and R. A. Tapia}, 37560 title = {A superlinearly convergent polynomial primal-dual interior-point algorirthm for 37561 linear programming}, 37562 journal = {SIAM Journal on Optimization}, 37563 year = {1993}, 37564 volume = {3}, 37565 pages = {118--133} 37566} 37567 37568@TechReport{ zhang.zhang:superlinear, 37569 author = {Y. Zhang and D. Zhang}, 37570 title = {Superlinear convergence of infeasible interior-point methods for linear 37571 programming}, 37572 institution = {Department of Mathematics and Statistics, University of Maryland}, 37573 year = {1992}, 37574 number = {92-15}, 37575 address = {Baltimore County, Maryland} 37576} 37577 37578@Article{ zhang:convergence, 37579 author = {Yin Zhang}, 37580 title = {On the Convergence of a Class of Infeasible Interior--Point Methods for the 37581 Horizontal Linear Complementarity Problem}, 37582 journal = {SIAM Journal on Optimization}, 37583 year = {1994}, 37584 volume = {4}, 37585 pages = {208--227} 37586} 37587 37588@Article{ zhang:convergence*1, 37589 author = {Y. Zhang}, 37590 title = {On the convergence of a class of infeasible interior-point methods for the 37591 horizontal linear complementarity problem}, 37592 journal = {SIAM Journal on Optimization}, 37593 year = {1994}, 37594 volume = {4}, 37595 pages = {208--227} 37596} 37597 37598@Article{ zhu.rockafellar:primal-dual, 37599 author = {C. Y. Zhu and R. T. Rockafellar}, 37600 title = {Primal-Dual Projected Gradient Algorithms for Extended Linear-Quadratic 37601 Programming}, 37602 journal = {SIAM Journal on Optimization}, 37603 year = {1993}, 37604 volume = {3}, 37605 pages = {751--783} 37606} 37607 37608@Article{ zhu:modified, 37609 author = {C. Y. Zhu}, 37610 title = {Modified Proximal Point Algorithm for Extended Linear--Quadratic Programming}, 37611 journal = {Computational Optimization and Applications}, 37612 year = {1992}, 37613 volume = {2}, 37614 pages = {182--205} 37615} 37616 37617@Article{ zhu:primal-dual, 37618 author = {C. Y. Zhu}, 37619 title = {On the Primal--Dual Steepest Descent Algorithm for Extended Linear--Quadratic 37620 Programming}, 37621 journal = {SIAM Journal on Optimization}, 37622 year = {1995}, 37623 volume = {5}, 37624 pages = {114--128} 37625} 37626 37627@Book{ zoutendijk:methods, 37628 author = {G. Zoutendijk}, 37629 title = {Methods of Feasible Directions}, 37630 year = {1960}, 37631 publisher = {Elsevier Publishing Company}, 37632 address = {Amsterdam} 37633} 37634 37635@Article{ zowe.kurcyusz:regularity, 37636 author = {J. Zowe and S. Kurcyusz}, 37637 title = {Regularity and Stability for Mathematical Programming in {B}anach Spaces}, 37638 journal = {Applied Mathematics and Optimization}, 37639 year = {1979}, 37640 volume = {5}, 37641 pages = {49--62} 37642} 37643 37644@InProceedings{ zowe:nondifferentiable, 37645 author = {J. Zowe}, 37646 title = {Nondifferentiable Optimization}, 37647 booktitle = {Computational Mathematical Programming}, 37648 year = {1985}, 37649 editor = {K. Schittkowski}, 37650 publisher = {Springer-Verlag}, 37651 address = {Berlin} 37652} 37653 37654@Proceedings{ bachem.grotschel.ea:mathematical, 37655 booktitle = {Mathematical Programming: The State of the Art, Bonn 1982}, 37656 title = {Mathematical Programming: The State of the Art, Bonn 1982}, 37657 year = {1983}, 37658 editor = {A. Bachem and M. Gr{\"{o}}tchel and B. Korte}, 37659 publisher = {Springer Verlag}, 37660 address = {Berlin} 37661} 37662 37663@Proceedings{ belew.booker:fourth, 37664 year = {1991}, 37665 editor = {R. K. Belew and L. B. Booker}, 37666 publisher = {Morgan Kaufmann Publishers, Inc}, 37667 address = {San Mateo, California}, 37668 booktitle = {Proceedings of the Fourth International Conference on Genetic Algorithms} 37669} 37670 37671@Proceedings{ coleman.li:large-scale, 37672 year = {1990}, 37673 editor = {T. F. Coleman and Y. Li}, 37674 publisher = {SIAM}, 37675 address = {Philadelphia, Pennsylvania}, 37676 note = {Proceedings of the Workshop on Large-Scale Numerical Optimization, Cornell 37677 University, Ithaca, New York, October 19-20, 1989}, 37678 booktitle = {Large-Scale Numerical Optimization} 37679} 37680 37681@Book{ davis:genetic, 37682 title = {Genetic Algorithms and Simulated Annealing}, 37683 year = {1987}, 37684 editor = {L. D. Davis}, 37685 publisher = {Pitman}, 37686 address = {London}, 37687 booktitle = {Genetic Algorithms and Simulated Annealing} 37688} 37689 37690@Proceedings{ ferris.pang:complementarity, 37691 title = {Complementarity and Variational Problems: State of the Art}, 37692 booktitle = {Complementarity and Variational Problems: State of the Art}, 37693 year = {1997}, 37694 key = {57}, 37695 editor = {M. C. Ferris and J. S. Pang}, 37696 publisher = {SIAM Publications}, 37697 address = {Philadelphia, Pennsylvania} 37698} 37699 37700@Proceedings{ ferris.mangasarian.ea:complementarity, 37701 title = {Complementarity: Applications, Algorithms and Extensions}, 37702 booktitle = {Complementarity: Applications, Algorithms and Extensions}, 37703 year = {2001}, 37704 key = {95}, 37705 editor = {M. C. Ferris and O.L. Mangasarian and J. S. Pang}, 37706 publisher = {Kluwer Academic Publishers}, 37707 address = {Dordrecht, The Netherlands} 37708} 37709 37710@Proceedings{ florian:traffic, 37711 title = {Traffic Equilibrium Methods}, 37712 year = {1976}, 37713 editor = {M. Florian}, 37714 publisher = {Springer-Verlag}, 37715 address = {Berlin} 37716} 37717 37718@Proceedings{ grefenstette:genetic, 37719 title = {Genetic Algorithms and their Applications: Proceedings of the Second 37720 International Conference on Genetic Algorithms}, 37721 year = {1987}, 37722 editor = {J. J. Grefenstette}, 37723 publisher = {Lawrence Erlbaum Associates}, 37724 address = {Hillsdale, New Jersey}, 37725 booktitle = {Genetic Algorithms and their Applications: Proceedings of the Second 37726 International Conference on Genetic Algorithms} 37727} 37728 37729@Proceedings{ mangasarian.meyer.ea:nonlinear*2, 37730 booktitle = {Nonlinear Programming}, 37731 volume = {2}, 37732 editor = {O. L. Mangasarian and R. R. Meyer and S. M. Robinson}, 37733 publisher = {Academic Press}, 37734 address = {New York}, 37735 year = {1975} 37736} 37737 37738@Proceedings{ mangasarian.meyer.ea:nonlinear*3, 37739 booktitle = {Nonlinear Programming}, 37740 volume = {3}, 37741 editor = {O. L. Mangasarian and R. R. Meyer and S. M. Robinson}, 37742 publisher = {Academic Press}, 37743 address = {London}, 37744 year = {1978} 37745} 37746 37747@Proceedings{ robinson:local, 37748 title = {Local Structure of Feasible Sets in Nonlinear Programming, {P}art~{I}: 37749 Regularity}, 37750 year = {1983}, 37751 editor = {V. Pereyra and A. Reinoza}, 37752 publisher = {Springer-Verlag}, 37753 address = {Berlin}, 37754 author = {S. M. Robinson}, 37755 pages = {240--251}, 37756 series = {Numerical Methods: Proceedings, Caracas 1982} 37757} 37758 37759@Proceedings{ schaeffer:third, 37760 year = {1989}, 37761 editor = {J. D. Schaeffer}, 37762 publisher = {Morgan Kaufmann Publishers, Inc}, 37763 address = {San Mateo, California}, 37764 booktitle = {Proceedings of the Third International Conference on Genetic Algorithms} 37765} 37766 37767@Book{ vanderbei:linear, 37768 author = {R. J. Vanderbei}, 37769 title = {Linear Programming: Foundations and Extensions}, 37770 year = {1997}, 37771 publisher = {Kluwer Academic Publishers}, 37772 address = {Boston, Massachusetts} 37773} 37774 37775@Book{ dfobook, 37776 title = {Introduction to Derivative-Free Optimization}, 37777 publisher = {Society for Industrial and Applied Mathematics}, 37778 year = {2009}, 37779 author = {Andrew R. Conn and Katya Scheinberg and Lu\'is N. Vicente}, 37780 series = {MPS/SIAM Series on Optimization}, 37781 address = {Philadelphia, PA, USA}, 37782 isbn = {0-89871-460-5} 37783} 37784 37785@Article{ unedf0, 37786 author = {{Kortelainen}, M. and {Lesinski}, T. and {Mor{\'e}}, J. and {Nazarewicz}, W. and 37787 {Sarich}, J. and {Schunck}, N. and {Stoitsov}, M.~V. and {Wild}, S.~M.}, 37788 title = {Nuclear Energy Density Optimization}, 37789 journal = {Physical Review C}, 37790 year = {2010}, 37791 volume = {82}, 37792 number = {2}, 37793 pages = {024313}, 37794 doi = {10.1103/PhysRevC.82.024313} 37795} 37796 37797@Article{ hestenes1969multiplier, 37798 title = {Multiplier and gradient methods}, 37799 author = {Hestenes, Magnus R}, 37800 journal = {Journal of optimization theory and applications}, 37801 volume = {4}, 37802 number = {5}, 37803 pages = {303--320}, 37804 year = {1969}, 37805 publisher = {Springer} 37806} 37807 37808@Article{ powell1969method, 37809 title = {A method for nonlinear constraints in minimization problems}, 37810 author = {Powell, Michael JD}, 37811 journal = {Optimization}, 37812 pages = {283--298}, 37813 year = {1969}, 37814 publisher = {Academic Press} 37815} 37816 37817@Book{ nocedal2006numerical, 37818 title = {Numerical optimization}, 37819 author = {Nocedal, Jorge and Wright, Stephen}, 37820 year = {2006}, 37821 publisher = {Springer Science \& Business Media} 37822} 37823 37824@Article{ rockafellar1974augmented, 37825 title = {Augmented Lagrange multiplier functions and duality in nonconvex programming}, 37826 author = {Rockafellar, R Tyrrell}, 37827 journal = {SIAM Journal on Control}, 37828 volume = {12}, 37829 number = {2}, 37830 pages = {268--285}, 37831 year = {1974}, 37832 publisher = {SIAM} 37833} 37834 37835@Article{ bacuta2006, 37836 title = {A unified approach for Uzawa algorithms}, 37837 author = {Constantin Bacuta}, 37838 journal = {SIAM Journal on Numerical Analysis}, 37839 volume = {44}, 37840 number = {6}, 37841 pages = {2633--2649}, 37842 year = {2006} 37843} 37844 37845@Article{ manteuffelrugesouthworth2018, 37846 title = {Nonsymmetric algebraic multigrid based on local approximate ideal restriction 37847 (AIR)}, 37848 author = {Thomas A Manteuffel and John Ruge and Ben S Southworth}, 37849 journal = {SIAM Journal on Scientific Computing}, 37850 volume = {40}, 37851 number = {6}, 37852 pages = {A4105--A4130}, 37853 year = {2018} 37854} 37855 37856@Article{ manteuffelmunzenmaierrugesouthworth2019, 37857 title = {Nonsymmetric reduction-based algebraic multigrid}, 37858 author = {Thomas A Manteuffel and Steffen M\"unzenmaier and John Ruge and Ben S Southworth}, 37859 journal = {SIAM Journal on Scientific Computing}, 37860 volume = {41}, 37861 number = {5}, 37862 pages = {S242--S268}, 37863 year = {2019} 37864} 37865 37866@PhDThesis{ sivas2021, 37867 title = {Preconditioning of HDG for the Navier–Stokes Equations}, 37868 author = {Abdullah Ali Sivas}, 37869 department = {Applied Mathematics}, 37870 institution = {University of Waterloo}, 37871 year = {2021} 37872} 37873 37874@Article{ brookshughes1982, 37875 title = {Streamline upwind/{Petrov-Galerkin} formulations for convection dominated flows 37876 with particular emphasis on the incompressible {Navier-Stokes} equations}, 37877 author = {Alexander N Brooks and Thomas JR Hughes}, 37878 journal = {Computer methods in applied mechanics and engineering}, 37879 volume = {32}, 37880 number = {1-3}, 37881 pages = {199--259}, 37882 year = {1982}, 37883 publisher = {Elsevier} 37884} 37885 37886@InProceedings{ suhisaac2020, 37887 title = {Evaluation of a minimally synchronous algorithm for 2: 1 octree balance}, 37888 author = {Hansol Suh and Tobin Isaac}, 37889 booktitle = {SC20: International Conference for High Performance Computing, Networking, 37890 Storage and Analysis}, 37891 pages = {1--12}, 37892 year = {2020}, 37893 organization = {IEEE} 37894} 37895 37896@Misc{ alauzet2010, 37897 title = {Metric-Based Anisotropic Mesh Adaptation}, 37898 author = {Fr\'{e}d\'{e}ric Alauzet}, 37899 howpublished = {\url{https://pages.saclay.inria.fr/frederic.alauzet/cours/cea2010_V3.pdf}}, 37900 year = {2010} 37901} 37902 37903@Article{ chan1994qmrcgs, 37904 title = {A quasi-minimal residual variant of the {Bi-CGSTAB} algorithm for nonsymmetric 37905 systems}, 37906 author = {Chan, Tony F and Gallopoulos, Efstratios and Simoncini, Valeria and Szeto, Tedd 37907 and Tong, Charles H}, 37908 journal = {SIAM Journal on Scientific Computing}, 37909 volume = {15}, 37910 number = {2}, 37911 pages = {338--347}, 37912 year = {1994}, 37913 publisher = {SIAM} 37914} 37915 37916@Article{ ghai2019comparison, 37917 title = {A comparison of preconditioned {K}rylov subspace methods for large-scale 37918 nonsymmetric linear systems}, 37919 author = {Ghai, Aditi and Lu, Cao and Jiao, Xiangmin}, 37920 journal = {Numerical Linear Algebra with Applications}, 37921 volume = {26}, 37922 number = {1}, 37923 pages = {e2215}, 37924 year = {2019}, 37925 publisher = {Wiley Online Library} 37926} 37927 37928@Article{ mishrasalacknepley2022, 37929 title = {On the order of accuracy for finite difference approximations of partial 37930 differential equations using stencil composition}, 37931 author = {Abhishek Mishra and David Salac and Matthew G. Knepley}, 37932 journal = {International Journal on Numerical Methods in Engineering}, 37933 note = {Submitted}, 37934 year = {2022} 37935} 37936 37937@Article{ nathawaniknepley2022, 37938 title = {Droplet formation simulation using mixed finite elements}, 37939 author = {Darsh K. Nathawani and Matthew G. Knepley}, 37940 journal = {Physics of Fluids}, 37941 volume = {34}, 37942 pages = {064105}, 37943 doi = {10.1063/5.0089752}, 37944 year = {2022} 37945} 37946 37947@InProceedings{ nathawaniknepley2022b, 37948 title = {Simulating Paraffin Wax Droplets Using Mixed Finite Element Method}, 37949 author = {Darsh K. Nathawani and Matthew G. Knepley}, 37950 booktitle = {Proceeedings of the International Conference on Computational Fluid Dynamics 11 37951 (ICCFD11)}, 37952 editor = {Christoph Brehm and Shishir Pandya}, 37953 number = {4103}, 37954 year = {2022} 37955} 37956 37957@Article{ nathawaniknepley2023, 37958 title = {One-dimensional model to simulate shear-induced droplet formation}, 37959 author = {Darsh K. Nathawani and Matthew G. Knepley}, 37960 journal = {Physics of Fluids}, 37961 note = {Submitted}, 37962 year = {2023} 37963} 37964 37965@Article{ georgalisnathawaniknepleypatra2023, 37966 title = {Uncertainty quantification of droplet atomization and pinch-off with {Gaussian 37967 Processes}}, 37968 author = {Georgios Georgalis and Darsh K. Nathawani and Matthew G. Knepley and Abani 37969 Patra}, 37970 note = {In preparation}, 37971 year = {2023} 37972} 37973 37974@Article{ brownbarrabeamsghaffariknepleymosesshakeristengelthompsonzhang2022, 37975 title = {Performance Portable Solid Mechanics via Matrix-Free $p$-Multigrid}, 37976 author = {Jed Brown and Valeria Barra and Natalie Beams and Leila Ghaffari and Matthew 37977 Knepley and William Moses and Rezgar Shakeri and Karen Stengel and Jeremy L. 37978 Thompson and Junchao Zhang}, 37979 doi = {10.48550/ARXIV.2204.01722}, 37980 url = {https://arxiv.org/abs/2204.01722}, 37981 publisher = {arXiv}, 37982 note = {Submitted}, 37983 year = {2022} 37984} 37985 37986@InCollection{ mayknepley2023, 37987 title = {Numerical Modeling of Subduction}, 37988 author = {Dave A. May and Matthew G. Knepley}, 37989 booktitle = {Dynamics of Plate Tectonics and Mantle Convection}, 37990 editor = {João C. Duarte}, 37991 pages = {539-571}, 37992 isbn = {978-0-323-85733-8}, 37993 doi = {https://doi.org/10.1016/B978-0-323-85733-8.00020-2}, 37994 url = {https://www.sciencedirect.com/science/article/pii/B9780323857338000202}, 37995 year = {2023} 37996} 37997 37998@Article{ adamsknepley2023, 37999 title = {A bespoke multigrid approach for magnetohydrodynamics models of magnetized 38000 plasmas in {PETSc}}, 38001 author = {Mark F. Adams and Matthew G. Knepley}, 38002 url = {https://arxiv.org/abs/2302.10242}, 38003 note = {In preparation}, 38004 year = {2023}, 38005 petsc_uses = {DMPlex} 38006} 38007 38008@Article{ finnknepleypusztayadams2023, 38009 title = {A Numerical Study of {Landau} Damping with {PETSc-PIC}}, 38010 author = {Daniel S. Finn and Matthew G. Knepley and Joseph V. Pusztay and Mark F. Adams}, 38011 url = {https://arxiv.org/abs/2303.12620}, 38012 journal = {Communications in Applied Mathematics and Computational Science}, 38013 note = {Submitted}, 38014 year = {2023} 38015} 38016 38017@Article{ eggersdupont1994, 38018 title = {Drop formation in a one-dimensional approximation of the {Navier--Stokes} 38019 equation}, 38020 author = {Jens Eggers and Todd F. Dupont}, 38021 journal = {Journal of fluid mechanics}, 38022 volume = {262}, 38023 pages = {205--221}, 38024 year = {1994}, 38025 publisher = {Cambridge University Press} 38026} 38027 38028@PhDThesis{ pusztaythesis2023, 38029 title = {A Particle Basis Vlasov-Poisson-Landau Solver for Plasma Simulation in PETSc}, 38030 author = {Joseph V. Pusztay}, 38031 type = {{PhD} thesis}, 38032 school = {University at Buffalo, Department of Computer Science and Engineering}, 38033 address = {Buffalo, NY}, 38034 month = may, 38035 year = {2022} 38036} 38037 38038@PhDThesis{ finnthesis2023, 38039 title = {Structure-Preserving Particle-In-Cell Methods for the Vlasov-Poisson-Landau 38040 System}, 38041 author = {Daniel S. Finn}, 38042 type = {{PhD} thesis}, 38043 school = {University at Buffalo, Program in Computational and Data-Enabled Science and 38044 Engineering}, 38045 address = {Buffalo, NY}, 38046 month = may, 38047 year = {2023} 38048} 38049 38050@PhDThesis{ nathawanithesis2023, 38051 title = {Droplet Formation: One-dimensional Mathematical Model and Computations}, 38052 author = {Darsh Kiritbhai Nathawani}, 38053 type = {{PhD} thesis}, 38054 school = {University at Buffalo, Program in Computational and Data-Enabled Science and 38055 Engineering}, 38056 address = {Buffalo, NY}, 38057 month = may, 38058 year = {2023} 38059} 38060